Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.576962761833520.0
YIL046W (MET30)64057020810.0
Scas_704.4060858820250.0
ADL082C56953620200.0
KLLA0F27511g62360220020.0
CAGL0L00781g67365419690.0
CAGL0L02629g7955553343e-32
YFL009W (CDC4)7795033282e-31
KLLA0D07546g6475003058e-29
Scas_707.227305113004e-28
YCR072C5153742965e-28
Kwal_23.50357445172853e-26
YJL112W (MDV1)7142972792e-25
Sklu_2173.25153742752e-25
Scas_720.955153842726e-25
CAGL0J03476g5173752672e-24
KLLA0C08547g5153752663e-24
Kwal_23.63245143812636e-24
AER263C5133812602e-23
Scas_711.116953022586e-23
CAGL0G04345g7112712577e-23
Kwal_27.126677212792577e-23
Scas_630.66213212569e-23
AEL314W7152682542e-22
KLLA0F21406g7052752532e-22
AGL024W7565062505e-22
AFR199C3341912391e-21
CAGL0M05335g8063232452e-21
ACR137W4252662403e-21
AEL246C8152832443e-21
KLLA0E23529g8262832444e-21
Scas_721.115*3181892329e-21
Scas_592.4*3181892292e-20
Kwal_27.120537552932372e-20
Kwal_26.87764331582323e-20
YBR198C (TAF5)7982872345e-20
CAGL0H03729g3033042255e-20
Scas_721.328223072337e-20
KLLA0F11231g4342752288e-20
CAGL0C03608g6433182301e-19
AGL234W6292622282e-19
YMR116C (ASC1)3191902212e-19
Sklu_2420.24412662235e-19
KLLA0E12287g3261982161e-18
KLLA0F10263g6821992193e-18
Sklu_2431.127492822185e-18
Scas_629.126712022175e-18
Scas_695.153273032106e-18
YGL137W (SEC27)8892812168e-18
KLLA0D04840g3033042088e-18
CAGL0I03718g12013422161e-17
YKR036C (CAF4)6592792122e-17
CAGL0H08932g9022812132e-17
CAGL0C02937g4672722083e-17
Kwal_23.64297502702104e-17
Kwal_26.75702181471984e-17
Scas_624.1112053422114e-17
YCR084C (TUP1)7132692104e-17
CAGL0M02277g4272572074e-17
YDL145C (COP1)12013422105e-17
CAGL0E00561g8361992095e-17
YNL006W (LST8)3032992017e-17
AFL118W8322712079e-17
Kwal_56.2452612103422081e-16
Sklu_2442.23033041991e-16
ADR077C12043422071e-16
YPL151C (PRP46)4512832022e-16
Scas_603.55892492032e-16
Kwal_0.2123033091954e-16
AAL009C3033051902e-15
YOR269W (PAC1)4943181942e-15
KLLA0F04884g12122401927e-15
CAGL0D02090g2772051802e-14
CAGL0L03201g5792601836e-14
Kwal_26.89534583271791e-13
KLLA0B01958g8902501802e-13
Kwal_23.53514742501772e-13
KLLA0C07425g4443191753e-13
YKL213C (DOA1)7152981749e-13
CAGL0L10890g4573381721e-12
CAGL0C00737g8162141731e-12
Kwal_27.115858232961731e-12
KLLA0E24508g3271611682e-12
ADR176W4613301702e-12
AEL269C4552601702e-12
Scas_713.509832351713e-12
KLLA0D16390g9362871703e-12
YLR129W (DIP2)9432891703e-12
Sklu_2160.37601391684e-12
Kwal_26.89754453461656e-12
Scas_558.37251651667e-12
AGL196C9351821678e-12
CAGL0M04279g9402831661e-11
Sklu_1880.34711791631e-11
Kwal_56.239209372821613e-11
Scas_631.174741941577e-11
Sklu_2318.17112861588e-11
AER337W4453351551e-10
Sklu_2172.62631161502e-10
AAR057W9221601552e-10
KLLA0F13244g8142981552e-10
AGR207C3201631503e-10
YLR222C (UTP13)8172661533e-10
YPR178W (PRP4)4652461514e-10
CAGL0A02772g4412191504e-10
AGR180W8062841516e-10
CAGL0K00275g7151581506e-10
CAGL0K09284g9112251516e-10
Kwal_23.62409132251506e-10
Scas_679.288151211507e-10
YCR057C (PWP2)9231611499e-10
KLLA0C08976g9111601481e-09
YBR175W (SWD3)3151281441e-09
CAGL0M06193g3161281432e-09
CAGL0M08646g3371581432e-09
YOR272W (YTM1)4603311442e-09
KLLA0E21879g3331601423e-09
Scas_658.14421741433e-09
KLLA0E21263g4291871424e-09
Scas_721.73251661405e-09
YKL021C (MAK11)4681621425e-09
AER448W7141761435e-09
Scas_720.83d9151601426e-09
CAGL0G09845g5002741407e-09
Scas_692.254881971407e-09
KLLA0E07073g4521621409e-09
Scas_717.689082251401e-08
ADL184W4491641381e-08
KLLA0C07513g4392071371e-08
Kwal_33.155917141581382e-08
Kwal_26.86284222561362e-08
YNL317W (PFS2)4651491363e-08
Sklu_1963.23141581334e-08
YDR267C3301551325e-08
YOR212W (STE4)4232771335e-08
AER255C4673061336e-08
Scas_692.294563571319e-08
Sklu_2416.54591541311e-07
KLLA0E07942g3901571301e-07
Kwal_55.215593511741281e-07
Scas_721.1288512211311e-07
ACR091W3281541282e-07
Kwal_27.122393161581272e-07
Kwal_55.220674511541282e-07
Scas_720.457551071283e-07
Kwal_56.24163729991283e-07
Scas_685.113841591255e-07
KLLA0B14410g7062911265e-07
Kwal_14.8843951581237e-07
Kwal_55.214505031811248e-07
Kwal_33.151364733151238e-07
Scas_397.24101211239e-07
YGL004C (RPN14)417781239e-07
Sklu_2406.114262551221e-06
Scas_571.46011761221e-06
Scas_585.8460711221e-06
AFL007C5511931221e-06
KLLA0D06787g4362611211e-06
CAGL0L06952g347671201e-06
KLLA0A08866g423861212e-06
YMR146C (TIF34)347681202e-06
ADL322C5012721202e-06
Sklu_2430.9966761212e-06
CAGL0M04081g4552351202e-06
AFL056C9761421203e-06
Scas_605.184242611193e-06
AER114W6331791193e-06
Scas_680.11347681173e-06
KLLA0E04741g4591671184e-06
ACR097W4672501184e-06
CAGL0F06853g3881251165e-06
YLR429W (CRN1)6511781167e-06
YLR409C (UTP21)9391551151e-05
KLLA0F16038g8621121151e-05
Sklu_1926.55092911122e-05
KLLA0D02530g7071251132e-05
ACR017W4231721112e-05
Kwal_34.158183492551112e-05
Scas_659.94751231112e-05
ABL024W734811122e-05
CAGL0M09845g936571122e-05
Scas_700.27*4331791113e-05
Sklu_2423.1944571123e-05
Sklu_2291.4997581123e-05
Kwal_27.11126996711113e-05
Sklu_2364.45551921113e-05
KLLA0E18986g9902871104e-05
Kwal_26.7655743801104e-05
AFL014C5571881095e-05
Scas_615.113491701075e-05
CAGL0A00561g412721085e-05
Kwal_14.12356072231086e-05
Sklu_1659.2613901087e-05
AAL157C4792771077e-05
AER081C10231541088e-05
Scas_465.41002581088e-05
KLLA0E11297g5121651078e-05
KLLA0B12804g852781088e-05
CAGL0K00957g7931701078e-05
Scas_718.6*5461681061e-04
AGR168W8251441071e-04
CAGL0J06512g545891061e-04
Kwal_23.41189391591061e-04
CAGL0L02761g4191661051e-04
Scas_660.7*6031431051e-04
CAGL0J04818g6541711051e-04
Scas_719.526281731051e-04
YMR102C834751051e-04
CAGL0A00605g6402661052e-04
Scas_719.30940571052e-04
KLLA0B02827g942571052e-04
Kwal_47.175554171401042e-04
YBR103W (SIF2)5352331042e-04
CAGL0C01441g10051951052e-04
Kwal_27.103855361041042e-04
YLL011W (SOF1)489881032e-04
YMR093W (UTP15)5132001033e-04
Kwal_33.154757831541033e-04
Kwal_27.125865091581023e-04
Scas_706.244601421023e-04
CAGL0K03377g978781024e-04
Sklu_675.130866995e-04
Sklu_1870.25692301015e-04
YDR364C (CDC40)4551221005e-04
KLLA0A04928g8612281015e-04
KLLA0F22000g7931651006e-04
Scas_670.215951751006e-04
Scas_702.168162241006e-04
KLLA0B11077g5673201006e-04
CAGL0D05588g47785997e-04
Sklu_1645.2587173998e-04
KLLA0F13772g520207980.001
ACR166W388128970.001
ADR264C34676960.001
Scas_660.8510250970.001
YCL039W (GID7)745114970.001
KLLA0F15598g478313960.002
ACL116W804180960.002
YGL003C (CDH1)566175960.002
Kwal_33.13515398120950.002
Kwal_27.10785367138940.002
AFL009C413112940.003
AGL301C361104940.003
YGR200C (ELP2)788143950.003
YPL183C101358950.003
CAGL0K12188g535192940.003
CAGL0J10340g33879930.003
Scas_721.2941450930.003
Kwal_55.21144570129940.003
Kwal_47.17567590264940.003
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5769
         (618 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5769                                                         1295   0.0  
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...   806   0.0  
Scas_704.40                                                           784   0.0  
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...   782   0.0  
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...   775   0.0  
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...   763   0.0  
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...   133   3e-32
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...   130   2e-31
KLLA0D07546g complement(647984..649927) some similarities with s...   122   8e-29
Scas_707.22                                                           120   4e-28
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...   118   5e-28
Kwal_23.5035                                                          114   3e-26
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...   112   2e-25
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                           110   2e-25
Scas_720.95                                                           109   6e-25
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...   107   2e-24
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...   107   3e-24
Kwal_23.6324                                                          105   6e-24
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...   104   2e-23
Scas_711.11                                                           103   6e-23
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...   103   7e-23
Kwal_27.12667                                                         103   7e-23
Scas_630.6                                                            103   9e-23
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...   102   2e-22
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...   102   2e-22
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...   100   5e-22
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    97   1e-21
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    99   2e-21
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    97   3e-21
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    99   3e-21
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    99   4e-21
Scas_721.115*                                                          94   9e-21
Scas_592.4*                                                            93   2e-20
Kwal_27.12053                                                          96   2e-20
Kwal_26.8776                                                           94   3e-20
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    95   5e-20
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    91   5e-20
Scas_721.32                                                            94   7e-20
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    92   8e-20
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    93   1e-19
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    92   2e-19
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    90   2e-19
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            91   5e-19
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    88   1e-18
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    89   3e-18
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      89   5e-18
Scas_629.12                                                            88   5e-18
Scas_695.15                                                            86   6e-18
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    88   8e-18
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    85   8e-18
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    88   1e-17
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    86   2e-17
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    87   2e-17
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    85   3e-17
Kwal_23.6429                                                           86   4e-17
Kwal_26.7570                                                           81   4e-17
Scas_624.11                                                            86   4e-17
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    86   4e-17
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    84   4e-17
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    86   5e-17
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    85   5e-17
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    82   7e-17
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    84   9e-17
Kwal_56.24526                                                          85   1e-16
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            81   1e-16
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    84   1e-16
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    82   2e-16
Scas_603.5                                                             83   2e-16
Kwal_0.212                                                             80   4e-16
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    78   2e-15
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    79   2e-15
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    79   7e-15
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    74   2e-14
CAGL0L03201g complement(366795..368534) some similarities with s...    75   6e-14
Kwal_26.8953                                                           74   1e-13
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    74   2e-13
Kwal_23.5351                                                           73   2e-13
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    72   3e-13
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    72   9e-13
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    71   1e-12
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    71   1e-12
Kwal_27.11585                                                          71   1e-12
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    69   2e-12
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    70   2e-12
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    70   2e-12
Scas_713.50                                                            70   3e-12
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    70   3e-12
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    70   3e-12
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         69   4e-12
Kwal_26.8975                                                           68   6e-12
Scas_558.3                                                             69   7e-12
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    69   8e-12
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    69   1e-11
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            67   1e-11
Kwal_56.23920                                                          67   3e-11
Scas_631.17                                                            65   7e-11
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          65   8e-11
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    64   1e-10
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       62   2e-10
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    64   2e-10
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    64   2e-10
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    62   3e-10
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    64   3e-10
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    63   4e-10
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    62   4e-10
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    63   6e-10
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    62   6e-10
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    63   6e-10
Kwal_23.6240                                                           62   6e-10
Scas_679.28                                                            62   7e-10
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    62   9e-10
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    62   1e-09
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    60   1e-09
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    60   2e-09
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    60   2e-09
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    60   2e-09
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    59   3e-09
Scas_658.1                                                             60   3e-09
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    59   4e-09
Scas_721.7                                                             59   5e-09
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    59   5e-09
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    60   5e-09
Scas_720.83d                                                           59   6e-09
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    59   7e-09
Scas_692.25                                                            59   7e-09
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    59   9e-09
Scas_717.68                                                            59   1e-08
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    58   1e-08
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    57   1e-08
Kwal_33.15591                                                          58   2e-08
Kwal_26.8628                                                           57   2e-08
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    57   3e-08
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         56   4e-08
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    55   5e-08
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    56   5e-08
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    56   6e-08
Scas_692.29                                                            55   9e-08
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           55   1e-07
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    55   1e-07
Kwal_55.21559                                                          54   1e-07
Scas_721.128                                                           55   1e-07
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    54   2e-07
Kwal_27.12239                                                          54   2e-07
Kwal_55.22067                                                          54   2e-07
Scas_720.45                                                            54   3e-07
Kwal_56.24163                                                          54   3e-07
Scas_685.11                                                            53   5e-07
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    53   5e-07
Kwal_14.884                                                            52   7e-07
Kwal_55.21450                                                          52   8e-07
Kwal_33.15136                                                          52   8e-07
Scas_397.2                                                             52   9e-07
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    52   9e-07
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      52   1e-06
Scas_571.4                                                             52   1e-06
Scas_585.8                                                             52   1e-06
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    52   1e-06
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    51   1e-06
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    51   1e-06
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    51   2e-06
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    51   2e-06
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    51   2e-06
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          51   2e-06
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    51   2e-06
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    51   3e-06
Scas_605.18                                                            50   3e-06
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    50   3e-06
Scas_680.11                                                            50   3e-06
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    50   4e-06
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    50   4e-06
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    49   5e-06
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    49   7e-06
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    49   1e-05
KLLA0F16038g complement(1487475..1490063) weakly similar to ca|C...    49   1e-05
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         48   2e-05
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    48   2e-05
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    47   2e-05
Kwal_34.15818                                                          47   2e-05
Scas_659.9                                                             47   2e-05
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    48   2e-05
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    48   2e-05
Scas_700.27*                                                           47   3e-05
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             48   3e-05
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         48   3e-05
Kwal_27.11126                                                          47   3e-05
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         47   3e-05
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    47   4e-05
Kwal_26.7655                                                           47   4e-05
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    47   5e-05
Scas_615.11                                                            46   5e-05
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    46   5e-05
Kwal_14.1235                                                           46   6e-05
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             46   7e-05
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    46   7e-05
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    46   8e-05
Scas_465.4                                                             46   8e-05
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    46   8e-05
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    46   8e-05
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    46   8e-05
Scas_718.6*                                                            45   1e-04
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    46   1e-04
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    45   1e-04
Kwal_23.4118                                                           45   1e-04
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    45   1e-04
Scas_660.7*                                                            45   1e-04
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    45   1e-04
Scas_719.52                                                            45   1e-04
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    45   1e-04
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    45   2e-04
Scas_719.30                                                            45   2e-04
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    45   2e-04
Kwal_47.17555                                                          45   2e-04
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    45   2e-04
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    45   2e-04
Kwal_27.10385                                                          45   2e-04
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    44   2e-04
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    44   3e-04
Kwal_33.15475                                                          44   3e-04
Kwal_27.12586                                                          44   3e-04
Scas_706.24                                                            44   3e-04
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    44   4e-04
Sklu_675.1 YMR146C, Contig c675 761-1687                               43   5e-04
Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement         44   5e-04
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    43   5e-04
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    44   5e-04
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    43   6e-04
Scas_670.21                                                            43   6e-04
Scas_702.16                                                            43   6e-04
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    43   6e-04
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    43   7e-04
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          43   8e-04
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    42   0.001
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    42   0.001
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    42   0.001
Scas_660.8                                                             42   0.001
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    42   0.001
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    42   0.002
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    42   0.002
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    42   0.002
Kwal_33.13515                                                          41   0.002
Kwal_27.10785                                                          41   0.002
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    41   0.003
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    41   0.003
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    41   0.003
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    41   0.003
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    41   0.003
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    40   0.003
Scas_721.29                                                            40   0.003
Kwal_55.21144                                                          41   0.003
Kwal_47.17567                                                          41   0.003
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    40   0.004
Scas_684.14                                                            40   0.004
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    40   0.004
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         40   0.005
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    39   0.005
Scas_652.16                                                            40   0.005
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    40   0.005
CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces c...    40   0.007
Scas_510.5                                                             39   0.009
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    39   0.010
Scas_699.5                                                             39   0.010
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    39   0.011
Scas_512.3                                                             39   0.011
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    39   0.012
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    39   0.012
Kwal_56.23685                                                          39   0.013
Sklu_1710.1 YDR267C, Contig c1710 17-739                               38   0.014
Scas_646.14                                                            39   0.015
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    39   0.016
Scas_442.2*                                                            39   0.016
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    38   0.017
Scas_705.2                                                             38   0.018
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    39   0.019
CAGL0M13409g complement(1316268..1320851) similar to sp|P38873 S...    38   0.022
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    38   0.022
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...    38   0.024
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          38   0.025
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    37   0.027
Kwal_47.17465                                                          38   0.028
Kwal_56.24596                                                          37   0.029
KLLA0F06688g 644040..645299 similar to sp|P38332 Saccharomyces c...    37   0.034
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         37   0.042
Scas_693.22                                                            37   0.047
Kwal_14.1710                                                           37   0.049
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    37   0.054
Scas_701.22                                                            37   0.054
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    36   0.070
ADR230W [1971] [Homologous to ScYOR080W (DIA2) - SH] complement(...    37   0.071
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    36   0.073
Scas_542.5                                                             36   0.073
Kwal_14.906                                                            36   0.083
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         36   0.086
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    36   0.086
Kwal_56.24399                                                          36   0.086
KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces c...    36   0.088
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    36   0.090
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    36   0.099
Kwal_33.13148                                                          36   0.10 
YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protei...    36   0.10 
Kwal_26.7738                                                           36   0.11 
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    36   0.11 
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    36   0.12 
Scas_642.1                                                             36   0.12 
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    35   0.12 
CAGL0L09757g complement(1046898..1047878) highly similar to sp|P...    35   0.15 
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    35   0.15 
Kwal_56.22345                                                          35   0.16 
YOL087C (YOL087C) [4733] chr15 complement(155286..158636) Protei...    35   0.17 
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    35   0.18 
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    35   0.18 
CAGL0H00781g complement(77292..78833) similar to tr|Q12523 Sacch...    35   0.19 
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       35   0.19 
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    35   0.19 
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    35   0.21 
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            35   0.21 
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    35   0.23 
YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein ...    35   0.23 
KLLA0E15950g complement(1417190..1418956) some similarities with...    35   0.25 
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    35   0.26 
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    34   0.26 
YER082C (UTP7) [1514] chr5 complement(324268..325932) Component ...    35   0.26 
YDL156W (YDL156W) [714] chr4 (174919..176487) Protein containing...    35   0.26 
ADR331C [2072] [Homologous to ScYHR186C - SH] (1285564..1290252)...    35   0.28 
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         34   0.30 
Scas_715.22                                                            34   0.31 
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    34   0.32 
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    34   0.32 
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            34   0.32 
KLLA0D12760g complement(1090428..1091909) weakly similar to sgd|...    34   0.33 
YGR225W (AMA1) [2174] chr7 (945146..946328,946422..946927) Prote...    34   0.34 
Scas_469.3                                                             34   0.37 
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    34   0.38 
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    34   0.38 
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    34   0.39 
KLLA0F08811g complement(819834..821744) some similarities with s...    34   0.40 
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            34   0.41 
YBR281C (YBR281C) [459] chr2 complement(764928..767564) Member o...    34   0.41 
Scas_595.3*                                                            34   0.42 
AGR367C [4678] [Homologous to ScYDR324C - SH] (1408366..1410681)...    34   0.42 
YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 a...    33   0.43 
Sklu_2438.4 YER082C, Contig c2438 8089-9810 reverse complement         34   0.46 
KLLA0C01177g 89978..92131 weakly similar to sp|P25569 Saccharomy...    33   0.52 
Kwal_33.14971                                                          33   0.55 
Scas_656.15                                                            33   0.56 
KLLA0A09471g complement(827264..831784) similar to sp|P38873 Sac...    33   0.58 
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    33   0.62 
YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component ...    33   0.63 
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    33   0.65 
CAGL0J01265g complement(118375..119928) highly similar to sp|Q04...    33   0.69 
CAGL0B03289g 319012..321624 similar to sp|P38149 Saccharomyces c...    33   0.69 
Scas_674.20                                                            33   0.70 
CAGL0J03344g complement(322226..323857) highly similar to sp|P40...    33   0.71 
KLLA0C16533g complement(1448866..1450404) similar to sgd|S000231...    33   0.76 
CAGL0I07821g complement(751484..754873) similar to tr|Q99247 Sac...    33   0.77 
CAGL0H04103g 388457..390460 similar to sp|Q04511 Saccharomyces c...    33   0.81 
AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH] (168010..16...    33   0.87 
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    33   0.92 
Kwal_56.24661                                                          33   0.92 
AFR438W [3630] [Homologous to ScYML088W (UFO1) - SH] complement(...    33   0.92 
YLR055C (SPT8) [3472] chr12 complement(251273..253081) Component...    33   0.93 
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    33   1.0  
KLLA0E23617g 2095246..2096499 similar to sp|P13712 Saccharomyces...    32   1.0  
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    32   1.1  
Kwal_33.14248                                                          32   1.2  
Kwal_47.17310                                                          32   1.2  
Scas_649.10                                                            32   1.2  
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...    32   1.2  
AFR153W [3345] [Homologous to ScYLR055C (SPT8) - SH] complement(...    32   1.3  
CAGL0L06578g complement(739738..>740336) weakly similar to sp|P5...    32   1.3  
ACR085C [1132] [Homologous to NOHBY] (508364..511228) [2865 bp, ...    32   1.4  
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    32   1.4  
Scas_609.12                                                            32   1.5  
KLLA0F21076g 1966373..1969036 highly similar to sp|Q9P4C0 Kluyve...    32   1.5  
Scas_675.18                                                            32   1.6  
KLLA0D13222g complement(1132067..1134277) similar to sgd|S000273...    32   1.6  
Kwal_27.12070                                                          32   1.7  
ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH] complement(1...    32   1.7  
YDR488C (PAC11) [1304] chr4 complement(1429176..1430777) Dynein ...    32   1.7  
YDR324C (UTP4) [1154] chr4 complement(1114426..1116756) Protein ...    32   1.7  
Kwal_47.17093                                                          32   1.7  
Kwal_47.18825                                                          32   1.8  
KLLA0F02013g 183770..185470 similar to sp|P40362 Saccharomyces c...    32   1.8  
Kwal_23.5529                                                           32   1.9  
KLLA0C16940g complement(1479541..1481469) weakly similar to sp|Q...    32   2.1  
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    32   2.1  
Kwal_56.24332                                                          32   2.1  
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    32   2.3  
YJL069C (UTP18) [2843] chr10 complement(310838..312622) Protein ...    32   2.3  
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    31   2.5  
CAGL0M01430g 164428..166683 highly similar to tr|Q06679 Saccharo...    32   2.5  
YPL126W (NAN1) [5319] chr16 (310209..312899) Nucleolar protein a...    32   2.6  
Kwal_26.7736                                                           31   2.7  
AAR078W [264] [Homologous to ScYLR196W (PWP1) - SH] complement(4...    31   2.8  
Kwal_55.20233                                                          31   2.9  
KLLA0E19745g complement(1750310..1750777) weakly similar to ca|C...    30   3.0  
Scas_700.47                                                            31   3.2  
CAGL0L08140g 892201..898470 similar to sp|P25356 Saccharomyces c...    31   3.4  
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    31   3.6  
AER145W [2649] [Homologous to NOHBY] complement(907744..911082) ...    31   3.6  
Kwal_14.1597                                                           30   4.2  
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    30   4.5  
CAGL0I03542g 299881..301485 similar to tr|Q12510 Saccharomyces c...    30   4.9  
KLLA0B04774g complement(433472..436759) some similarities with c...    30   5.3  
CAGL0A04037g complement(399371..401122) highly similar to sp|P21...    30   5.3  
ACR116W [1163] [Homologous to ScYPL139C (UME1) - SH] complement(...    30   5.7  
Kwal_26.6868                                                           30   5.7  
CAGL0M02805g 317204..319822 similar to tr|Q02931 Saccharomyces c...    30   5.9  
Sklu_1189.2 YGR279C, Contig c1189 1103-2263                            30   6.2  
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    30   6.3  
Kwal_0.40                                                              30   6.4  
Kwal_47.16912                                                          30   6.6  
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    30   6.7  
Scas_640.18                                                            30   6.9  
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    30   8.4  
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    30   8.4  
AGR149W [4460] [Homologous to ScYDR080W (VPS41) - SH] complement...    30   8.5  
YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein in...    30   8.9  
ADL054W [1687] [Homologous to ScYER124C (DSE1) - SH] complement(...    30   9.8  
KLLA0C12771g 1081988..1085017 similar to sp|P35729 Saccharomyces...    30   9.8  
YLR196W (PWP1) [3599] chr12 (543970..545700) Protein containing ...    30   9.9  

>Kwal_23.5769
          Length = 627

 Score = 1295 bits (3352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/618 (100%), Positives = 618/618 (100%)

Query: 1   MLEVLQSQEPSLSGLKTNSVPNTSMITKEAQQGATDGGKDKVKEQNGKRKAAEYEDGQLQ 60
           MLEVLQSQEPSLSGLKTNSVPNTSMITKEAQQGATDGGKDKVKEQNGKRKAAEYEDGQLQ
Sbjct: 1   MLEVLQSQEPSLSGLKTNSVPNTSMITKEAQQGATDGGKDKVKEQNGKRKAAEYEDGQLQ 60

Query: 61  EAQVDSVVPRGEVTESAASANSRTNKRVRGLPQYNFLRFCYRHNPDFQHSQTHTACYMQD 120
           EAQVDSVVPRGEVTESAASANSRTNKRVRGLPQYNFLRFCYRHNPDFQHSQTHTACYMQD
Sbjct: 61  EAQVDSVVPRGEVTESAASANSRTNKRVRGLPQYNFLRFCYRHNPDFQHSQTHTACYMQD 120

Query: 121 QQRHQKLNKKIEQLEPEEQRQVQNVLTTFAGCNDRIRKLLLEGLLANCCFPQLSFVASEV 180
           QQRHQKLNKKIEQLEPEEQRQVQNVLTTFAGCNDRIRKLLLEGLLANCCFPQLSFVASEV
Sbjct: 121 QQRHQKLNKKIEQLEPEEQRQVQNVLTTFAGCNDRIRKLLLEGLLANCCFPQLSFVASEV 180

Query: 181 QKMIKIDFISTLPEEVALKILGYLDCESLCNAARVCRRWQQMADDDKVWYHMCQQHIDRK 240
           QKMIKIDFISTLPEEVALKILGYLDCESLCNAARVCRRWQQMADDDKVWYHMCQQHIDRK
Sbjct: 181 QKMIKIDFISTLPEEVALKILGYLDCESLCNAARVCRRWQQMADDDKVWYHMCQQHIDRK 240

Query: 241 CPNCGWGLPLLHMKRARFIEPPAESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVE 300
           CPNCGWGLPLLHMKRARFIEPPAESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVE
Sbjct: 241 CPNCGWGLPLLHMKRARFIEPPAESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVE 300

Query: 301 SNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV 360
           SNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV
Sbjct: 301 SNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV 360

Query: 361 KAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVK 420
           KAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVK
Sbjct: 361 KAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVK 420

Query: 421 VWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
           VWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQ
Sbjct: 421 VWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480

Query: 481 VQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNT 540
           VQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNT
Sbjct: 481 VQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNT 540

Query: 541 IKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQA 600
           IKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQA
Sbjct: 541 IKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQA 600

Query: 601 PITCVGIGDSEFVSGDEL 618
           PITCVGIGDSEFVSGDEL
Sbjct: 601 PITCVGIGDSEFVSGDEL 618

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 50/92 (54%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGAC 389
           L + S D+T+ +W++ TGK VR   GH +G+  I  D  ++++G+ D+ ++VW+  +G C
Sbjct: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKC 591

Query: 390 VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKV 421
           +  +  H   +  V       VSG     VKV
Sbjct: 592 IHTFDSHQAPITCVGIGDSEFVSGDELGCVKV 623

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/570 (65%), Positives = 451/570 (79%), Gaps = 35/570 (6%)

Query: 74  TESAASANSRTNKRVRGLPQYNFLRFCYRHNPDFQHSQTHTACYMQDQQRHQKLNKKIEQ 133
           + S   A + +  RV+ LP+YNF +FCYRHNPD Q S THTACY QD +R Q++N  I +
Sbjct: 69  SSSPDLATNDSGTRVQPLPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQEINANIAK 128

Query: 134 LEPEEQRQVQNVLTTFAGCNDRIRKLLLEGLLANCCFPQLSFVASEVQKMIKIDFISTLP 193
           L  +EQ  + ++++ ++  ND+IRKL+L+G+L+  CFPQLS+++S V  MIKIDFIS LP
Sbjct: 129 LPLQEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISILP 188

Query: 194 EEVALKILGYLDCESLCNAARVCRRWQQMADDDKVWYHMCQQHIDRKCPNCGWGLPLLHM 253
           +E++LKIL YLDC+SLCNA RVCR+WQ++ADDD+VWYHMC+QHIDRKCPNCGWGLPLLHM
Sbjct: 189 QELSLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHM 248

Query: 254 KRARFIEPPAESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEF 313
           KRAR           Q+ +      ++  T+ TRPWKVIYRERFKVESNWRKG   IQEF
Sbjct: 249 KRARI----------QQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEF 298

Query: 314 KGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITG 373
           KGHMDGVL+LQFNYRLLFTGSYDST+ IWDL TGKL+RRL+GH DGVK +YFD +KLITG
Sbjct: 299 KGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITG 358

Query: 374 SLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR 433
           SLD+ IRVWNY+TG C++ Y GHSDSVLSVDSY+K+IVSGSADKTVKVWHVESRTCYTLR
Sbjct: 359 SLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLR 418

Query: 434 GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTE 493
           GHTEWV  VKLHPKSF+CFS SDDTTIRMWDIR+N+C+KVFRGHVGQVQK++PLTI D E
Sbjct: 419 GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVE 478

Query: 494 NLVTDRTSD--PPRNEATT------AQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWE 545
           NL TD TSD   P+++ T       +  P + Q + LD+++PYP+HLLSC LDNTIKLW+
Sbjct: 479 NLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWD 538

Query: 546 VRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQ------ 599
           V+TGKC+RT FGHVEG+WDIAADNFRI+SG+HD ++KVWDLQSGKC+HTF+  +      
Sbjct: 539 VKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQ 598

Query: 600 -----------APITCVGIGDSEFVSGDEL 618
                      API CV IGDSE  SGDE 
Sbjct: 599 HTQTQSLGDKVAPIACVCIGDSECFSGDEF 628

>Scas_704.40
          Length = 608

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/588 (62%), Positives = 443/588 (75%), Gaps = 58/588 (9%)

Query: 83  RTNKRVR-------GLPQYNFLRFCYRHNPDFQHSQTHTACYMQDQQRHQKLNKKIEQLE 135
           R+NK  R        LPQ+NF +FCYRHNP+   S THTACY QD +R + LN  I +L 
Sbjct: 18  RSNKEQRITPTFSSALPQFNFTKFCYRHNPEILSSPTHTACYNQDLKRFKDLNDNITKLP 77

Query: 136 PEEQRQVQNVLTTFAGCNDRIRKLLLEGLLANCCFPQLSFVASEVQKMIKIDFISTLPEE 195
            +EQ ++ ++++ F   ND++RKL+L+G+LA+ CFPQLS+++S+V  MI+IDFIS LP+E
Sbjct: 78  AQEQAEIHHIISKFNKSNDKLRKLILDGILASSCFPQLSYISSQVSNMIRIDFISILPQE 137

Query: 196 VALKILGYLDCESLCNAARVCRRWQQMADDDKVWYHMCQQHIDRKCPNCGWGLPLLHMKR 255
           ++LKIL YLDC+SLCNA +VCR+WQ +ADDD+VWYHMC+QHIDRKCPNCGWGLPLLHMKR
Sbjct: 138 LSLKILSYLDCQSLCNATKVCRKWQILADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKR 197

Query: 256 ARFIEPPAESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKG 315
           ARF+      K     A N     ++  +  RPWKVIYRERFKVESNWRKG   +QEFKG
Sbjct: 198 ARFV------KNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKG 251

Query: 316 HMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSL 375
           HMDGVL+LQFNYRLLFTGSYDSTVAIWDL + KL+RRL+GH DGVK +YFD  KL+TGSL
Sbjct: 252 HMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSL 311

Query: 376 DRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGH 435
           D+ IRVWNY TG C++ Y GH+DSV+SVD++KKIIVSGSADKTVK+WHVESRTCYTLRGH
Sbjct: 312 DKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGH 371

Query: 436 TEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENL 495
           TEWV  VKLHPKSFTCFSGSDDTTIRMWDIR+N+C+KVFRGHVGQVQKV+PLTI+D ENL
Sbjct: 372 TEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENL 431

Query: 496 VTDRTS------DPPRNEATTAQDPP------DGQLSALDDSLPYPSHLLSCSLDNTIKL 543
           V D  S      D P +  T            D +   LD S+PYP+HLLSCSLDNTIKL
Sbjct: 432 VVDNISGSNEGDDEPASTTTPTAAIAAEAATNDEENQTLDKSIPYPTHLLSCSLDNTIKL 491

Query: 544 WEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTF-------- 595
           W+V+TG+C+RT FGHVEG+WDIAADNFRI+SG+HD ++K+WDLQSGKC+HTF        
Sbjct: 492 WDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQ 551

Query: 596 ----DSHQA---------------------PITCVGIGDSEFVSGDEL 618
                +H A                     PI CV IGDSEF SGDEL
Sbjct: 552 DEEGSTHLASTSNATGTSTSTANPVQNKVSPIACVSIGDSEFFSGDEL 599

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/536 (68%), Positives = 428/536 (79%), Gaps = 11/536 (2%)

Query: 84  TNKRVRGLPQYNFLRFCYRHNPDFQHSQTHTACYMQDQQRHQKLNKKIEQLEPEEQRQV- 142
             K++R  PQYNF+R+CYRHNPD Q + T   C  Q+QQR ++   ++ +L  E +RQV 
Sbjct: 33  ATKQLRA-PQYNFVRYCYRHNPDIQAAPTQVRCVRQEQQRREEWQARVGELSSEGERQVV 91

Query: 143 QNVLTTFAGCNDRIRKLLLEGLLANCCFPQLSFVASEVQKMIKIDFISTLPEEVALKILG 202
           Q  +  F   ND++RKL+LEG+L   CFPQLSF+++++QK+IKIDFIS LPEEVALKILG
Sbjct: 92  QEAVRLFDSSNDKLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILG 151

Query: 203 YLDCESLCNAARVCRRWQQMADDDKVWYHMCQQHIDRKCPNCGWGLPLLHMKRARFIEPP 262
           YLDC+SLC+AA VCRRWQ++ADDD VWYHMC+QHIDRKCP CGWGLPLLHMKRAR+I+  
Sbjct: 152 YLDCQSLCSAAAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRARYIKSD 211

Query: 263 AESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLS 322
             S    +G   P         + RPWKV+YRERFKVESNWRKG   IQEFKGHMDGVLS
Sbjct: 212 KASASKGEGEDAP-------QSRMRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVLS 264

Query: 323 LQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVW 382
           LQ   +LL TGSYDSTVAIWDLATGKL+RRL+GH DGVKA+ FD QKLITGSLD+ IRVW
Sbjct: 265 LQLTNKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVW 324

Query: 383 NYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTV 442
           NYVTGACV+ Y GH DSVLSVDS++K+IVSGSADKTVKVWHVESRTCYTLRGHT WV  V
Sbjct: 325 NYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384

Query: 443 KLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD 502
           KLHPKSFTCFSGSDD TIRMWDIR+NTCV+VF GHVGQVQKV+PLT+    +L+ D    
Sbjct: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTL--GSDLIEDPKDA 442

Query: 503 PPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI 562
               +AT     P  Q +  D SLPYP+HLLSCSLDNTIKLW V+TG C+RT FGHVEG+
Sbjct: 443 VVPPDATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV 502

Query: 563 WDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSGDEL 618
           WDIAADNFRIVSG+HD++ KVWDLQ+GKC+HTF    AP+ CVGIGDSEFVSGDEL
Sbjct: 503 WDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEFVSGDEL 558

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 315 GHMDGVLSLQFNYRL-----LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
            H   V +  F++ L     L + S D+T+ +W++ TG  +R   GH +GV  I  D  +
Sbjct: 452 AHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR 511

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVES 426
           +++GS DR  +VW+  TG C+  + G    V  V       VSG     VK+++ ++
Sbjct: 512 IVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEFVSGDELGCVKLYNFDT 568

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/602 (61%), Positives = 452/602 (75%), Gaps = 34/602 (5%)

Query: 48  KRKAAEYEDGQLQEAQVDSVVPRGEVTESAASANSRTNKRVR---GLPQYNFLRFCYRHN 104
           KRK  + +   + + + D+   +GE+  + AS  ++ N+ ++    +PQ+NF +FCYRHN
Sbjct: 14  KRKFEDVDSNGVSDQRQDTD-GKGEILRNKASKVNQNNEEIQLPSEMPQFNFFKFCYRHN 72

Query: 105 PDFQHSQTHTACYMQDQQRHQKLNKKIEQLEPEEQRQV-QNVLTTFAGCNDRIRKLLLEG 163
           PD QH+   +  + QDQ R +K  +K++ L+ E  R + +  L  F   ND+IR+L+LEG
Sbjct: 73  PDIQHTCKDSMVF-QDQVRSEKWMEKMKALDKESDRAIIKQTLDNFQHSNDKIRRLMLEG 131

Query: 164 LLANCCFPQLSFVASEVQKMIKIDFISTLPEEVALKILGYLDCESLCNAARVCRRWQQMA 223
           +L  CCFPQLS++A EV+++IKIDFISTLPEE++LKILGYLDC+SLC A+  C+RW+ +A
Sbjct: 132 ILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCIASLTCKRWKTLA 191

Query: 224 DDDKVWYHMCQQHIDRKCPNCGWGLPLLHMKRARFIEPPAESKPGQKG------------ 271
           DDD+VWYHMC+QHIDRKCPNCGWGLPLLHMKRAR++         Q G            
Sbjct: 192 DDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQNGNQFQNVANGNGN 251

Query: 272 ----------AGNPP---VASETTTRK--TRPWKVIYRERFKVESNWRKGTAHIQEFKGH 316
                      GN P   VA+     +  TRPWKVIYRERF+VESNWR G   IQ FKGH
Sbjct: 252 EIGGGKSLINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGH 311

Query: 317 MDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLD 376
           MDGVLSL+FN+RLLFTGSYDSTVAIWD  +G L+RRLTGH DGVK IYFD QK+IT SLD
Sbjct: 312 MDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLD 371

Query: 377 RMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHT 436
           + IRVWNY+TG+C++ Y GH DSVLSVDSYKKIIVS SADKTVKVWHVESRTCYTLRGHT
Sbjct: 372 KTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHT 431

Query: 437 EWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLV 496
           EWV  VKLHPKSFTC+S SDD T+RMWDIR+N+C+KVFRGHVGQVQKV+PLTI DTENLV
Sbjct: 432 EWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLV 491

Query: 497 TDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHF 556
            D   +   N     +D  D      D +L YP+HLLSCSLDNTIKLWEV +G+C+RT F
Sbjct: 492 VDEKIEKVPN-PELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF 550

Query: 557 GHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSGD 616
           GHVEG+WDIAADNFRIVSG+HDK++KVWDLQ+GKCI TF  H+API CVGIGDS FVSGD
Sbjct: 551 GHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGD 610

Query: 617 EL 618
           EL
Sbjct: 611 EL 612

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 61/116 (52%), Gaps = 1/116 (0%)

Query: 311 QEFKGHMDGVLSLQFNYRL-LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
           ++F     G+      Y   L + S D+T+ +W++++G+ +R   GH +GV  I  D  +
Sbjct: 506 EDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR 565

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE 425
           +++GS D+ I+VW+   G C+  + GH   ++ V       VSG     VK+WH +
Sbjct: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGDELGEVKMWHFD 621

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/654 (56%), Positives = 454/654 (69%), Gaps = 76/654 (11%)

Query: 39  KDKVKEQNGKRKAAEYEDG--QLQEAQVDSVVPRGEVTESAASANSRTNKRVRGLPQYNF 96
           +D  + +  KR+   Y++    L E + +  + R      A S  S++   V  LP+ NF
Sbjct: 10  RDDTEAEGAKRRKMPYDEQIQMLAEEEEEDTMKRDMGDALATSTESQSGVSV--LPRDNF 67

Query: 97  LRFCYRHNPDFQHSQTHTACYMQDQQRHQKLNKKIEQLE-PEEQRQVQNVLTTFAGCNDR 155
            R+CYRHNP+ Q S TH  CY QD QR + +N KI QL  P+EQ  + ++++ +   ND+
Sbjct: 68  QRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACPKEQADIHHIISKYTNSNDK 127

Query: 156 IRKLLLEGLLANCCFPQLSFVASEVQKMIKIDFISTLPEEVALKILGYLDCESLCNAARV 215
           +RKL+L+G+L + CFPQLS++A  +  MIKIDFIS LP+E++LKILGYLDC+SLCNA+ V
Sbjct: 128 VRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQSLCNASMV 187

Query: 216 CRRWQQMADDDKVWYHMCQQHIDRKCPNCGWGLPLLHMKRARF----------------- 258
           C+ W  +ADDD+VWYHMC+QHIDRKCPNCGWGLPLLHMKRAR                  
Sbjct: 188 CKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARVCYIKAKNPNTTVNDRKM 247

Query: 259 -------IEPPAESKPGQKGAGNPPVASETTTR---------------------KTRPWK 290
                  I P  +   G +  G     +  TT                      + + WK
Sbjct: 248 IQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVSGSKSSGQGQQENGRCRQKSWK 307

Query: 291 VIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLV 350
           ++YRERFKVESNWRKG   IQEFKGHMDGVL+LQFNYRLLFTGSYD+TVAIWDL TGKL+
Sbjct: 308 MVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLI 367

Query: 351 RRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKII 410
           RRLTGH DGVK +YFD QKLITGSLD+ IRVWNY+TG C++ Y GH+DSV+SVDS+KKII
Sbjct: 368 RRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKII 427

Query: 411 VSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC 470
           VSGSADKTVKVWHVESRTCYTL+GHTEWV  VKLHPKSF+C+S SDDTTIRMWDIR+NTC
Sbjct: 428 VSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTC 487

Query: 471 VKVFRGHVGQVQKVLPLTILDTENLVTDR----TSDPPRNEATTAQDPPDG--QLSALDD 524
           ++VFRGHVGQVQKV+PLTI+D +NLVT        D   +  T   DP +G      LD 
Sbjct: 488 LRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDK 547

Query: 525 SLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVW 584
            +PYP+HLLSC+LDNTIKLWEVR+G+C+RT FGHVEG+WDIAADNFRI+SG+HD ++K+W
Sbjct: 548 KMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIW 607

Query: 585 DLQSGKCIHTFDSHQ--------------------APITCVGIGDSEFVSGDEL 618
           DLQSGKC+HTF   +                    AP+ CV IGDSE  SGDE 
Sbjct: 608 DLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAPVACVCIGDSECFSGDEF 661

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score =  133 bits (334), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 137/555 (24%), Positives = 224/555 (40%), Gaps = 141/555 (25%)

Query: 131 IEQLEPEEQRQVQNVLTTFAGCNDRIR-KLLLEGLLANCCFPQLSFVASEVQKMIKIDFI 189
           IE+ + +E+ + + +L T       +    L+  LL+     +LS +++ ++  +K DF+
Sbjct: 202 IEEYKDKERAETERLLATIKASLGAVNMNHLIYSLLSGMHRSELSDISTLLRDNLKRDFV 261

Query: 190 STLPEEVALKILGYLDCESLCNAARVCRRWQQMADDD-KVWYHMCQQHIDRKCPNCGWGL 248
           ++LP E+ LKIL  L  ES+ N  +V + W ++ +    +W H+                
Sbjct: 262 TSLPLEITLKILNKLPFESISNCLQVSKSWNRLINGTPALWKHL---------------- 305

Query: 249 PLLHMKRARFIEPPAESK--PGQKGAGNPPVASETTTRKTRPWKVIYRERF----KVESN 302
               +    F+   +  K  P +    +PP  +++           YR+ F     +  N
Sbjct: 306 ----LLSESFVSKDSFDKKYPVENNKLDPPFDNDSR----------YRQDFLMNCSILQN 351

Query: 303 WRKGTAHIQE--FKGHMDGVLS-LQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDG 359
           W       Q    KGHM  V++ LQF    + TG+ D  + I+D  T K +  L+GH  G
Sbjct: 352 WYNPDFIPQRTTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGHDGG 411

Query: 360 VKAIYFDGQK-LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK----KIIVSGS 414
           V A+ + G   L++GS DR +R+WN   G C   + GH+ +V  +D  +    K IV+GS
Sbjct: 412 VWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGS 471

Query: 415 ADKTVKVW--------------------------HVESRTCY---TLRGHTEWVGTVKLH 445
            D T+ +W                          H      Y    LRGH   V TV  H
Sbjct: 472 RDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVLRGHIASVRTVSGH 531

Query: 446 PKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPR 505
            +     SGS D  + +WDI    C+ +  GH  ++      TI D +           R
Sbjct: 532 GR--IVISGSYDNNLIVWDIIQMKCLYILMGHTDRIYS----TIYDYK-----------R 574

Query: 506 NEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVR----TGKCVR-------- 553
           N                          +S S+D+TIK+W+++     G+CV         
Sbjct: 575 NRC------------------------ISASMDSTIKIWDLQNIWNNGECVNVTNATVPC 610

Query: 554 --------THFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQ---API 602
                   T  GH   +  +   +  +VS A D +++ WD  S      F  H    + I
Sbjct: 611 TKITGPMMTLQGHTALVGLLKLSDKFLVSAAADGSLRGWD--SSDYSRKFAYHHNNLSAI 668

Query: 603 TCVGIGDSEFVSGDE 617
           T   + D+  VSG E
Sbjct: 669 TTFYMTDNILVSGSE 683

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score =  130 bits (328), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 127/503 (25%), Positives = 209/503 (41%), Gaps = 85/503 (16%)

Query: 149 FAGCNDRI----RKLLLEGLLANCCFPQLSFVASEVQKMIKIDFISTLPEEVALKILGYL 204
           F+  N+ +     K LL  L+AN    +LS + + ++  +K D I++LP E++LKI  YL
Sbjct: 231 FSAINNNLPHAYFKNLLFRLVANMDRSELSDLGTLIKDNLKRDLITSLPFEISLKIFNYL 290

Query: 205 DCESLCNAARVCRRWQQMADDDKVWYHMCQQHIDRKCPNCGWGLPLLHMKRARFIEPPAE 264
             E + N+  V + W +               I RK  +  W   L+      F+ P   
Sbjct: 291 QFEDIINSLGVSQNWNK---------------IIRKSTSL-WKKLLI---SENFVSPKGF 331

Query: 265 SKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVESNWR--KGTAHIQEFKGHMDGVLS 322
           +    K +   P  S+         ++ + E   +  NW   K        +GHM  V++
Sbjct: 332 NSLNLKLSQKYPKLSQQDR-----LRLSFLENIFILKNWYNPKFVPQRTTLRGHMTSVIT 386

Query: 323 -LQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YFDGQKLITGSLDRMIR 380
            LQF    + TG+ D  + ++D    K + +L+GH  GV A+ Y  G  L++GS DR +R
Sbjct: 387 CLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGGILVSGSTDRTVR 446

Query: 381 VWNYVTGACVAAYPGHSDSV--LSVDSYKKI--IVSGSADKTVKVW-------------- 422
           VW+   G C   + GH+ +V  L +  YK I  IV+GS D T+ VW              
Sbjct: 447 VWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEE 506

Query: 423 -------HVESRTCY---TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVK 472
                  H      Y    LRGH   V TV  H       SGS D T+ +WD+    C+ 
Sbjct: 507 HDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGN--IVVSGSYDNTLIVWDVAQMKCLY 564

Query: 473 VFRGHVGQVQKVL---------------PLTILDTENLVTDRTSDPPRNEATT------A 511
           +  GH  ++   +                + I D EN+  +       N A+       A
Sbjct: 565 ILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGA 624

Query: 512 QDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRT-GKCVRTHFGHVEGIWDIAADNF 570
                G  + +         L+S + D +I+ W+     +    H  ++  I      + 
Sbjct: 625 MYTLQGHTALVGLLRLSDKFLVSAAADGSIRGWDANDYSRKFSYHHTNLSAITTFYVSDN 684

Query: 571 RIVSGAHDKTVKVWDLQSGKCIH 593
            +VSG+ ++   +++L+SGK +H
Sbjct: 685 ILVSGSENQ-FNIYNLRSGKLVH 706

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 94/229 (41%), Gaps = 63/229 (27%)

Query: 395 GHSDSVLSVDSYK-KIIVSGSADKTVKVW-HVESRTCYTLRGHTEWVGTVKLHPKSFTCF 452
           GH  SV++   ++   +++G+ DK ++V+  +  +    L GH   V  +K +       
Sbjct: 379 GHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALK-YAHGGILV 437

Query: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512
           SGS D T+R+WDI+   C  VF+GH   V+    L I++ +N+                 
Sbjct: 438 SGSTDRTVRVWDIKKGCCTHVFKGHNSTVR---CLDIVEYKNI----------------- 477

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHF---------------- 556
                             ++++ S DNT+ +W++     V  H                 
Sbjct: 478 -----------------KYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENP 520

Query: 557 -------GHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSH 598
                  GH+  +  ++     +VSG++D T+ VWD+   KC++    H
Sbjct: 521 YFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGH 569

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA-ADNFRIVSGAHDKTVKVWDLQS 588
           +++++ + D  I++++    K +    GH  G+W +  A    +VSG+ D+TV+VWD++ 
Sbjct: 393 NYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGGILVSGSTDRTVRVWDIKK 452

Query: 589 GKCIHTFDSHQAPITCVGI 607
           G C H F  H + + C+ I
Sbjct: 453 GCCTHVFKGHNSTVRCLDI 471

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score =  122 bits (305), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 128/500 (25%), Positives = 208/500 (41%), Gaps = 100/500 (20%)

Query: 160 LLEGLLANCCFPQLSFVASEVQKMIKIDFISTLPEEVALKILGYLDCESLCNAARVCRRW 219
           L+ GL++N    QLS + S +   +K D   +LP E+ +KIL  L  E +     V R W
Sbjct: 123 LIFGLVSNMDRTQLSDLVSIITDNLKRDLFQSLPNEITVKILLNLSSEDIFACLLVNRNW 182

Query: 220 QQMADDDKV---WYHMCQQHI-DRKCPNCGWGLPLLHMKRARFIEPPAESKPGQKGAGNP 275
            ++ ++  V   W  + +  + + + P+    LP    K    I P              
Sbjct: 183 NRLIEEAPVVWKWLMLNEGFVTEDQFPSYCNSLP---SKYKHLINP-------------- 225

Query: 276 PVASETTTRKTRPWKVIYRERFKV---ESNWRKGTAHIQEFK-------GHMDGVLS-LQ 324
                              +RF++   E+NW     +   +K       GH   V++ LQ
Sbjct: 226 ------------------DDRFRLDFLENNWCLQNWYDPNYKPGRTCLDGHSTNVVTCLQ 267

Query: 325 FNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVWN 383
           F    + TG+ D  + ++D      +  L GH  GV A+ F DG+ L++GS DR +R+WN
Sbjct: 268 FENNYIITGADDKKINVYDAENDLFLLELNGHEGGVWALKFVDGKILVSGSTDRSVRIWN 327

Query: 384 YVTGACVAAYPGHSDSV--LSVDSY--KKIIVSGSADKTVKVWHV--------------- 424
             TG C   + GH+ +V  L V  Y   K IV+GS D T+ VW +               
Sbjct: 328 IETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIF 387

Query: 425 ----ESRTCY--TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV 478
               E    +   LRGH   V TV  H +     SGS D  + +WDI S   + +  GH 
Sbjct: 388 YRTPEENPYFVGVLRGHMSSVRTVSGHGR--IVISGSYDHNLMVWDIISMKLLYILTGHT 445

Query: 479 GQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLD 538
            +V      TI D +           RN   +A       +  L++     ++  + +++
Sbjct: 446 DRVYS----TIYDYK-----------RNRCISASMDTTVMIWDLEN---IENNGTTTTIN 487

Query: 539 NTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTF-DS 597
           +   +  V + KC+   +GH   +  +   N  +VS A D +++ WD        +F  +
Sbjct: 488 DGASIKVVGSMKCL---YGHTALVGLLCLSNKFLVSAAADGSIRGWDPNDYSRKFSFHHT 544

Query: 598 HQAPITCVGIGDSEFVSGDE 617
           + A IT   + D+  VSG E
Sbjct: 545 NLAAITSFSMNDNILVSGSE 564

>Scas_707.22
          Length = 730

 Score =  120 bits (300), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 126/511 (24%), Positives = 202/511 (39%), Gaps = 129/511 (25%)

Query: 158 KLLLEGLLANCCFPQLSFVASEVQKMIKIDFISTLPEEVALKILGYLDCESLCNAARVCR 217
           K L+  +L+N     LS + S +   +K D +S+LP E+ALKI  +L  + + N   VC 
Sbjct: 228 KNLIFKILSNLNRTALSDLNSVLNGNLKRDIVSSLPIEIALKIFQHLSYDDIFNCQSVCS 287

Query: 218 RWQQMADDDKV-WYHMCQQHIDRKCPNCGWGLPLLHMKRARFIEPPAESKPGQKGAGNPP 276
            W  + +   + W ++                    +    F+         Q+ A N  
Sbjct: 288 NWNAIINTTPLLWKNL--------------------LISESFVS-------AQEVANN-- 318

Query: 277 VASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQE--FKGHMDGVLS-LQFNYRLLFTG 333
                   K+  +K  + E  ++  NW   +   +     GH   V++ LQF    + TG
Sbjct: 319 ------NNKSSFFKEKFIESLRILQNWYNPSFKPERTTLTGHATSVVTCLQFEDDYVITG 372

Query: 334 SYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLI-TGSLDRMIRVWNYVTGACVAA 392
           + D  + I+D  + K ++ L+GH  GV A+ +D   +I +GS DR +R+W+   G C   
Sbjct: 373 ADDRQLRIYDARSKKFLKELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHV 432

Query: 393 YPGHSDSV--LSVDSYK--KIIVSGSADKTVKVWHV--------ESRTCY---------- 430
           + GH+ +V  L + +YK  K IV+GS D T+ VW +        E    Y          
Sbjct: 433 FKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYFV 492

Query: 431 -TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTI 489
             LRGH   V T+  H       SGS D  + +WDI    C+ V  GH  ++      TI
Sbjct: 493 GVLRGHMASVRTISGHGN--IVISGSYDNNLMVWDIAQMKCLYVLIGHTDRIYS----TI 546

Query: 490 LDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV--- 546
            D +                                       +S S+D+TIK+W++   
Sbjct: 547 YDHKR-----------------------------------QRCISASMDSTIKVWDLDNI 571

Query: 547 -RTGKC----------------VRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSG 589
              G C                + T  GH   +  +   +  +VS A D +++ WD  S 
Sbjct: 572 WNNGNCTIITNSATPCTKITGSMLTLQGHTALVGLLRLSDKYLVSAAADGSLRGWD--SN 629

Query: 590 KCIHTFDSHQ---APITCVGIGDSEFVSGDE 617
                F  H    + IT   + D+  VSG E
Sbjct: 630 DYSRKFSYHHNNLSAITTFYMNDNILVSGSE 660

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score =  118 bits (296), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 105/374 (28%), Positives = 159/374 (42%), Gaps = 67/374 (17%)

Query: 294 RERFKVESNWRKGTAHIQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGKLV 350
           R  FKV+   R  +A      GH   +L   F       + TG+ D+T  IWD  T   +
Sbjct: 124 RAVFKVKPVTRSSSA----IAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPM 179

Query: 351 RRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVA-AYPGHSDSVLSVD--- 404
             L GH + V  + +  DG+ + TGS+D  IR+W+  +G C+  A  GHS  + S+    
Sbjct: 180 HTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEP 239

Query: 405 ------SYKKIIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDD 457
                   K  + S S D T+K+W   SR C YT+ GHT  V  VK   +    +SGS D
Sbjct: 240 IHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGL-LYSGSHD 298

Query: 458 TTIRMWDIRS-NTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ---- 512
            T+R+WDI S   C+ + + H   V  +   T         D T   P       +    
Sbjct: 299 RTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALE 358

Query: 513 ----------DPPDGQLSALDDSL-----------------------------PYPSHLL 533
                     +  +  ++A DD                               P   +++
Sbjct: 359 NYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIV 418

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKC 591
           S S DN+IKLW+ R GK + T  GHV  ++ +A  +D   +VS + D T+KVWD+++ K 
Sbjct: 419 SASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKL 478

Query: 592 IHTFDSHQAPITCV 605
                 H+  +  V
Sbjct: 479 SVDLPGHKDEVYTV 492

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 123/302 (40%), Gaps = 86/302 (28%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLI-TGSLDRMIRVWNYVT-G 387
           L + S D T+ IWD  +      ++GH + V  + + GQ L+ +GS DR +RVW+  + G
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQG 310

Query: 388 ACVAAYPGHSDSV----LSVD---------------------------SYKKI------- 409
            C+     H+  V    LS D                           +Y+KI       
Sbjct: 311 RCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNS 370

Query: 410 ---IVSGSADKTVKVWHV--ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWD 464
              +V+ S D T+ +W+    ++    + GH + V  V   P      S S D +I++WD
Sbjct: 371 EEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430

Query: 465 IRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDD 524
            R    +  FRGHV  V +V   +                           D +L     
Sbjct: 431 GRDGKFISTFRGHVASVYQVAWSS---------------------------DCRL----- 458

Query: 525 SLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVK 582
                  L+SCS D T+K+W+VRT K      GH + ++  D + D  R+ SG  DK V+
Sbjct: 459 -------LVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVR 511

Query: 583 VW 584
           +W
Sbjct: 512 LW 513

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 75/141 (53%), Gaps = 6/141 (4%)

Query: 329 LLFTGSYDSTVAIWD-LATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYV 385
           ++ T S D T+ +W+ L + K + R+TGH+  V  + F  DG+ +++ S D  I++W+  
Sbjct: 373 MMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGR 432

Query: 386 TGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCYT-LRGHTEWVGTV 442
            G  ++ + GH  SV  V   S  +++VS S D T+KVW V +R     L GH + V TV
Sbjct: 433 DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTV 492

Query: 443 KLHPKSFTCFSGSDDTTIRMW 463
                     SG  D  +R+W
Sbjct: 493 DWSVDGKRVCSGGKDKMVRLW 513

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 60/124 (48%), Gaps = 6/124 (4%)

Query: 305 KGTAHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKA 362
           K T  I    GH   V  + F  + R + + S+D+++ +WD   GK +    GH   V  
Sbjct: 390 KSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQ 449

Query: 363 IYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKT 418
           + +  D + L++ S D  ++VW+  T       PGH D V +VD     K + SG  DK 
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKM 509

Query: 419 VKVW 422
           V++W
Sbjct: 510 VRLW 513

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           I  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH+D V  + +  
Sbjct: 437 ISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSV 496

Query: 366 DGQKLITGSLDRMIRVWNY 384
           DG+++ +G  D+M+R+W +
Sbjct: 497 DGKRVCSGGKDKMVRLWTH 515

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 78/194 (40%), Gaps = 50/194 (25%)

Query: 426 SRTCYTLRGHTEWVGTVKLHPKSFT-CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
           +R+   + GH   +      P + +   +G+ D T R+WD  + T +   +GH   V  V
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCV 192

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                                         PDG++ A            + S+DNTI+LW
Sbjct: 193 ---------------------------SWSPDGEVIA------------TGSMDNTIRLW 213

Query: 545 EVRTGKCVRTHF-GHVEGIWDIAADNF---------RIVSGAHDKTVKVWDLQSGKCIHT 594
           + ++G+C+     GH + I  ++ +           R+ S + D T+K+WD  S  C +T
Sbjct: 214 DPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYT 273

Query: 595 FDSHQAPITCVGIG 608
              H   ++CV  G
Sbjct: 274 MSGHTNSVSCVKWG 287

>Kwal_23.5035
          Length = 744

 Score =  114 bits (285), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 122/517 (23%), Positives = 204/517 (39%), Gaps = 85/517 (16%)

Query: 136 PEEQRQVQNVLTTFAGC-----NDRIRKLLLEGLLANCCFPQLSFVASEVQKMIKIDFIS 190
           P      Q+ L   A       +D   + L+  L++     +LS + + V+  +K DFI+
Sbjct: 205 PRRSVSQQDYLNAIASAAHSKLSDSAYRNLVFQLISKLSRSELSDLGTLVKDNLKRDFIT 264

Query: 191 TLPEEVALKILGYLDCESLCNAARVCRRWQQMADDDKVWYHMCQQHIDRKCPNCGWGLPL 250
           +LP EV++ IL  L  E +     V + W  +  D    +                    
Sbjct: 265 SLPLEVSMNILTNLGFEDISRCLSVSKAWNSLIRDTSYLWRTL----------------- 307

Query: 251 LHMKRARFIEPPAESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVESNW--RKGTA 308
             +    FI      K  Q      P    +       +++ + E      NW   K   
Sbjct: 308 --LVTENFITVEEYHKYSQG-----PQQLNSGHLHEDFFRLHFMENRAYLKNWYDSKFKP 360

Query: 309 HIQEFKGH-MDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           H    +GH M  V  LQF    + TG+ D  + ++D  T K + +L+GH  GV A+ +  
Sbjct: 361 HRTTLRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGH 420

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD----SYKKIIVSGSADKTVKV 421
           DG  L++GS DR +RVWN  +G C   + GH+ +V  +D    + KK IV+GS D T+ V
Sbjct: 421 DG-ILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHV 479

Query: 422 WHVES--------RTCY-------------TLRGHTEWVGTVKLHPKSFTCFSGSDDTTI 460
           W + +          C               LRGH   V TV  H       SGS D  +
Sbjct: 480 WKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVRTVSGHGN--IVVSGSYDFNL 537

Query: 461 RMWDIRSNTCVKVFRGHVGQVQKVL---------------PLTILDTENL------VTDR 499
            +WDI    C+ V  GH  ++   +                + + D  ++       T  
Sbjct: 538 MVWDIAQMKCLYVLTGHTDRIYSTIYDYQRNRCISAGMDSTVKVWDLADVSKNGPCTTIT 597

Query: 500 TSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRT-GKCVRTHFGH 558
           +S+ P  + T +     G  + +         L+S   D  ++ W+     +    H   
Sbjct: 598 SSNNPCTKVTGSSITLQGHTALVGLLGLSDKFLVSAGADGILRGWDSENYTRQFAYHHKD 657

Query: 559 VEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTF 595
           +  I     ++  +VSG+ +    +++L+SGK IH++
Sbjct: 658 LSAITTFYVNDNILVSGS-EGNFNIYNLRSGKLIHSY 693

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 531 HLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRI-VSGAHDKTVKVWDLQSG 589
           ++++ + D  I++++ +T K +    GH  G+W +   +  I VSG+ D++V+VW+++SG
Sbjct: 382 YVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGILVSGSTDRSVRVWNIKSG 441

Query: 590 KCIHTFDSHQAPITCVGI 607
           KC H F  H + + C+ I
Sbjct: 442 KCTHVFKGHTSTVRCLDI 459

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 136/297 (45%), Gaps = 45/297 (15%)

Query: 316 HMDGVLSLQFN--YRLLFTGSY-DSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKL 370
           H D +  L F+  +  L T  Y D TV IWDL+    +  L GH   +  +    D   L
Sbjct: 397 HDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTL 456

Query: 371 ITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCY 430
           +TG  D  +++WN                     +  + +   + + T    H++S   +
Sbjct: 457 VTGGRDAALKLWNL--------------------NLAQQLYQETQNLTSPTNHIDSPCVH 496

Query: 431 TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTIL 490
           T   HT+ V  + L P SF   SGS D TIR WD+RS  C++        V        L
Sbjct: 497 TFEAHTDEVTALSLDP-SF-LVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDL 554

Query: 491 DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGK 550
               L+T R            + P  G L + D +L       + + D  ++LW++R+GK
Sbjct: 555 SKSTLLTQRN-----------ERPSIGALQSFDAALA------TGTKDGVVRLWDLRSGK 597

Query: 551 CVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
            +RT  GH + I  +  D+  +V+G++D+TV++WDL++G  ++ F ++ AP+  + +
Sbjct: 598 VIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-LLNKFHAYSAPVLSLDL 653

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 77/139 (55%), Gaps = 6/139 (4%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGAC 389
           L TG+ D  V +WDL +GK++R L GH D + ++ FD   L+TGS DR +R+W+  TG  
Sbjct: 579 LATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-L 637

Query: 390 VAAYPGHSDSVLSVDSYKKIIVSGSADK-TVKVWHVESRTCYTL--RGHTEWVGTVKLHP 446
           +  +  +S  VLS+D +++      AD+ +V+++  E    ++   +G+   V TVK   
Sbjct: 638 LNKFHAYSAPVLSLDLFQENAAVVVADEPSVQIYDSEKDESWSCVEQGNETSVSTVKY-- 695

Query: 447 KSFTCFSGSDDTTIRMWDI 465
           K      G ++  + +W +
Sbjct: 696 KENYMVEGRENGDVNIWAV 714

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 82/179 (45%), Gaps = 25/179 (13%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLT--------------- 354
           +  F+ H D V +L  +   L +GS D T+  WDL +GK ++ +                
Sbjct: 495 VHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDL 554

Query: 355 ---------GHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDS 405
                      R  + A+      L TG+ D ++R+W+  +G  +    GH+D++ S+  
Sbjct: 555 SKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKF 614

Query: 406 YKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWD 464
               +V+GS D+TV++W + +        ++  V ++ L  ++      +D+ +++++D
Sbjct: 615 DSACLVTGSYDRTVRIWDLRTGLLNKFHAYSAPVLSLDLFQENAAVVV-ADEPSVQIYD 672

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 100/236 (42%), Gaps = 49/236 (20%)

Query: 406 YKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWD 464
           +  +  +G  D TVK+W +  +     L GH   +  ++++    T  +G  D  +++W+
Sbjct: 410 FGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWN 469

Query: 465 IRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTS-DPPRNEATTAQDPPDGQLSALD 523
           +  N   ++++               +T+NL +     D P      A       LS LD
Sbjct: 470 L--NLAQQLYQ---------------ETQNLTSPTNHIDSPCVHTFEAHTDEVTALS-LD 511

Query: 524 DSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT---HFGHV--------------------- 559
                PS L+S S D TI+ W++R+GKC++T    F +V                     
Sbjct: 512 -----PSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNER 566

Query: 560 EGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSG 615
             I  + + +  + +G  D  V++WDL+SGK I T   H   IT +    +  V+G
Sbjct: 567 PSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTG 622

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 7/119 (5%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YFDGQ 368
           I+  KGH D + SL+F+   L TGSYD TV IWDL TG L+ +   +   V ++  F   
Sbjct: 599 IRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-LLNKFHAYSAPVLSLDLFQEN 657

Query: 369 KLITGSLDRMIRVWNYVTG---ACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHV 424
             +  + +  +++++       +CV    G+  SV +V   +  +V G  +  V +W V
Sbjct: 658 AAVVVADEPSVQIYDSEKDESWSCVE--QGNETSVSTVKYKENYMVEGRENGDVNIWAV 714

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 21/123 (17%)

Query: 516 DGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIV 573
           D  L+ LD   P+ +   +  LD+T+K+W++     +    GH+  I    I  D   +V
Sbjct: 398 DDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLV 457

Query: 574 SGAHDKTVKVWDLQSGK-------------------CIHTFDSHQAPITCVGIGDSEFVS 614
           +G  D  +K+W+L   +                   C+HTF++H   +T + +  S  VS
Sbjct: 458 TGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPSFLVS 517

Query: 615 GDE 617
           G +
Sbjct: 518 GSQ 520

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score =  110 bits (275), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 105/374 (28%), Positives = 155/374 (41%), Gaps = 67/374 (17%)

Query: 294 RERFKVESNWRKGTAHIQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGKLV 350
           R  FKV+   R  +A      GH   +L   F       + TG+ D+T  IWD  T   +
Sbjct: 124 RAVFKVKPVTRSSSA----IAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPM 179

Query: 351 RRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVA-AYPGHSDSVLSVD--- 404
             L GH + V  + +  DG+ + TGS+D  IR+W    G  V  A  GH   + S+    
Sbjct: 180 STLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEP 239

Query: 405 ------SYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDD 457
                   K  + S S D T+K+W    R C  TL GHT  V  +K   +    +SGS D
Sbjct: 240 IHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGV-LYSGSHD 298

Query: 458 TTIRMWDIR-SNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPP-----------R 505
            TIR WD+     C+ + + H   V  +   T         D TS+ P           +
Sbjct: 299 KTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALK 358

Query: 506 NEATTAQ---DPPDGQLSALDDSLPY-----------------------------PSHLL 533
           N    A+   +  +  ++A DD   Y                               H++
Sbjct: 359 NYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIV 418

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKC 591
           S S DN+IKLW  R GK + T  GHV  ++ +A  +D   +VS + D T+KVWD+++ K 
Sbjct: 419 SASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKL 478

Query: 592 IHTFDSHQAPITCV 605
                 H+  +  V
Sbjct: 479 AVDLPGHKDEVYTV 492

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 120/302 (39%), Gaps = 86/302 (28%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK-LITGSLDRMIRVWNY-VTG 387
           L + S D T+ IWD      +  L+GH   V  I + GQ  L +GS D+ IR W+  + G
Sbjct: 251 LASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGG 310

Query: 388 ACVAAYPGHSDSV----LSVD---------------------------SYKKI------- 409
            C+     H+  V    LS D                           +Y+KI       
Sbjct: 311 KCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEV 370

Query: 410 ---IVSGSADKTVKVWHV--ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWD 464
              +V+ S D T+ +W+    ++    + GH + V  V   P      S S D +I++W+
Sbjct: 371 EELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWN 430

Query: 465 IRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDD 524
            R    +  FRGHV  V +V   +                           D +L     
Sbjct: 431 GRDGKFISTFRGHVASVYQVAWSS---------------------------DCRL----- 458

Query: 525 SLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVK 582
                  L+SCS D T+K+W+V+T K      GH + ++  D + D  R+ SG  DK V+
Sbjct: 459 -------LVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVR 511

Query: 583 VW 584
           +W
Sbjct: 512 LW 513

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 76/141 (53%), Gaps = 6/141 (4%)

Query: 329 LLFTGSYDSTVAIWD-LATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYV 385
           L+ T S D T+ +W+ L + K + R+TGH+  V  + F  DG+ +++ S D  I++WN  
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGR 432

Query: 386 TGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTV 442
            G  ++ + GH  SV  V   S  +++VS S D T+KVW V+++     L GH + V TV
Sbjct: 433 DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTV 492

Query: 443 KLHPKSFTCFSGSDDTTIRMW 463
                     SG  D  +R+W
Sbjct: 493 DWSVDGKRVCSGGKDKMVRLW 513

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 6/124 (4%)

Query: 305 KGTAHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKA 362
           K T  I    GH   V  + F  + R + + S+D+++ +W+   GK +    GH   V  
Sbjct: 390 KSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQ 449

Query: 363 IYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKT 418
           + +  D + L++ S D  ++VW+  T       PGH D V +VD     K + SG  DK 
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKM 509

Query: 419 VKVW 422
           V++W
Sbjct: 510 VRLW 513

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           I  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH+D V  + +  
Sbjct: 437 ISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSV 496

Query: 366 DGQKLITGSLDRMIRVWNY 384
           DG+++ +G  D+M+R+W +
Sbjct: 497 DGKRVCSGGKDKMVRLWTH 515

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 74/194 (38%), Gaps = 50/194 (25%)

Query: 426 SRTCYTLRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
           +R+   + GH   +      P  S    +G+ D T R+WD  + T +   +GH   V  V
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCV 192

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                                         PDG+L A            + S+DNTI+LW
Sbjct: 193 ---------------------------SWSPDGELIA------------TGSMDNTIRLW 213

Query: 545 EVRTGKCVRTHF-GHVEGIWDIAADNF---------RIVSGAHDKTVKVWDLQSGKCIHT 594
           E   G+ V     GH + I  ++ +           R+ S + D T+K+WD     C+ T
Sbjct: 214 EGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLIT 273

Query: 595 FDSHQAPITCVGIG 608
              H + ++C+  G
Sbjct: 274 LSGHTSSVSCIKWG 287

>Scas_720.95
          Length = 515

 Score =  109 bits (272), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 104/384 (27%), Positives = 167/384 (43%), Gaps = 79/384 (20%)

Query: 291 VIYRER--FKVESNWRKGTAHIQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLA 345
           +IY  R  FKV+   R  +A      GH   +L   F       + TG+ D+T  IWD  
Sbjct: 119 LIYTPRAVFKVKPVTRSSSA----IAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCD 174

Query: 346 TGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVA-AYPGHSDSVLS 402
           T      LTGH + V  + +  +G+ + TGS+D  IR+W+   G  +  A  GH   + S
Sbjct: 175 TQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITS 234

Query: 403 VDSYKKI----------IVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTC 451
           + +++ I          + S S D T+++W +  R C YT+ GHT  V  +K   +    
Sbjct: 235 L-AWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGI-I 292

Query: 452 FSGSDDTTIRMWDIRSN-TCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATT 510
           +SGS D T+R+WD+ ++  C+ + + H   V  +     L T+  +     D    +  +
Sbjct: 293 YSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLS----LSTDYALRVGAFDHTGAQPAS 348

Query: 511 AQDPPDGQL------------------SALDDSL-------------------------- 526
           A+D  D  L                  +A DD                            
Sbjct: 349 AKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHV 408

Query: 527 ---PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTV 581
              P   +++S S DN+IKLW+ R GK + T  GHV  ++ +A  AD   +VS + D T+
Sbjct: 409 AFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTL 468

Query: 582 KVWDLQSGKCIHTFDSHQAPITCV 605
           KVWD+++ K       H+  +  V
Sbjct: 469 KVWDVRTRKLSVDLPGHKDEVYTV 492

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 84/328 (25%), Positives = 133/328 (40%), Gaps = 95/328 (28%)

Query: 313 FKGHMDGVLSLQFN---------YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI 363
            +GH+  + SL +             L + S D T+ IWD+     +  ++GH + V  I
Sbjct: 225 LRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCI 284

Query: 364 YFDGQKLI-TGSLDRMIRVWNY-VTGACVAAYPGHSDSV----LSVD------------- 404
            + GQ +I +GS D+ +RVW+    G C+     H+  V    LS D             
Sbjct: 285 KWSGQGIIYSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGA 344

Query: 405 --------------SYKKII----------VSGSADKTVKVWHV--ESRTCYTLRGHTEW 438
                         +Y+K++          V+ S D T+ +W+    ++    + GH + 
Sbjct: 345 QPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKL 404

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTD 498
           V  V   P      S S D +I++WD R    +  FRGHV  V +V              
Sbjct: 405 VNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQV-------------- 450

Query: 499 RTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGH 558
                    A +A    D +L            L+SCS D T+K+W+VRT K      GH
Sbjct: 451 ---------AWSA----DCRL------------LVSCSKDTTLKVWDVRTRKLSVDLPGH 485

Query: 559 VEGIW--DIAADNFRIVSGAHDKTVKVW 584
            + ++  D + D  R+ SG  DK V++W
Sbjct: 486 KDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 6/124 (4%)

Query: 305 KGTAHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKA 362
           K    I    GH   V  + F  + R + + S+D+++ +WD   GK +    GH   V  
Sbjct: 390 KSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQ 449

Query: 363 IYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKT 418
           + +  D + L++ S D  ++VW+  T       PGH D V +VD     K + SG  DK 
Sbjct: 450 VAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKM 509

Query: 419 VKVW 422
           V++W
Sbjct: 510 VRIW 513

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           I  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH+D V  + +  
Sbjct: 437 ISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSV 496

Query: 366 DGQKLITGSLDRMIRVWNY 384
           DG+++ +G  D+M+R+W +
Sbjct: 497 DGKRVCSGGKDKMVRIWTH 515

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score =  107 bits (267), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 106/375 (28%), Positives = 159/375 (42%), Gaps = 69/375 (18%)

Query: 294 RERFKVESNWRKGTAHIQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGKLV 350
           R  FKV+   R  +A      GH   +L   F       + TG  D+T  IWD  T    
Sbjct: 126 RAVFKVKPITRSSSA----IAGHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPK 181

Query: 351 RRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVA-AYPGHSDSVLSVD--- 404
             L GHR+ V  + +  DG+ + TGS+D  IR+W+  +G  +  A  GHS  + S+    
Sbjct: 182 VTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEP 241

Query: 405 ------SYKKIIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDD 457
                   K  + S S D T+++W    R C  TL GHT  V  VK   +    +SGS D
Sbjct: 242 IHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEGI-LYSGSHD 300

Query: 458 TTIRMWDIRSN-TCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPP- 515
            T+R WD++ N  C+ + + H   V  +   T         D T   P N A  A+D   
Sbjct: 301 KTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPAN-AKEARDKAL 359

Query: 516 ---------DGQ-----LSALDDSL-----------------------------PYPSHL 532
                    +G+     ++A DD                               P   ++
Sbjct: 360 QNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYI 419

Query: 533 LSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGK 590
           +S S DN+IKLW+ + G  + T  GHV  ++ +A  +D   +VS + D T+KVWD+++ K
Sbjct: 420 VSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRK 479

Query: 591 CIHTFDSHQAPITCV 605
                  HQ  +  V
Sbjct: 480 LSVDLPGHQDEVYTV 494

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 6/141 (4%)

Query: 329 LLFTGSYDSTVAIWDLATG-KLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYV 385
           L+ T S D T+ +W+   G K + R+TGH+  V  + F  DG+ +++ S D  I++W+  
Sbjct: 375 LMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGK 434

Query: 386 TGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCYT-LRGHTEWVGTV 442
            G  ++ + GH  SV  V   S  +++VS S D T+KVW V++R     L GH + V TV
Sbjct: 435 EGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 494

Query: 443 KLHPKSFTCFSGSDDTTIRMW 463
                     SG  D  +R+W
Sbjct: 495 DWSVDGKRVCSGGKDKMMRLW 515

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 6/124 (4%)

Query: 305 KGTAHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKA 362
           KGT  I    GH   V  + F  + + + + S+D+++ +WD   G  +    GH   V  
Sbjct: 392 KGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQ 451

Query: 363 IYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKT 418
           + +  D + L++ S D  ++VW+  T       PGH D V +VD     K + SG  DK 
Sbjct: 452 VAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKM 511

Query: 419 VKVW 422
           +++W
Sbjct: 512 MRLW 515

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           +  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH+D V  + +  
Sbjct: 439 LSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSV 498

Query: 366 DGQKLITGSLDRMIRVWNY 384
           DG+++ +G  D+M+R+W +
Sbjct: 499 DGKRVCSGGKDKMMRLWTH 517

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 70/194 (36%), Gaps = 50/194 (25%)

Query: 426 SRTCYTLRGHTEWVGTVKLHPKSFT-CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
           +R+   + GH   +      P + +   +G  D T R+WD  + T      GH       
Sbjct: 135 TRSSSAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKVTLNGH------- 187

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                               RN         DG++ A            + S+DNTI+LW
Sbjct: 188 --------------------RNWVLCVSWSADGEVIA------------TGSMDNTIRLW 215

Query: 545 EVRTGKCVRTHF-GHVEGIWDIAADNF---------RIVSGAHDKTVKVWDLQSGKCIHT 594
           +  +GK +     GH + I  +  +           R+ S + D T+++WD     C+ T
Sbjct: 216 DAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMT 275

Query: 595 FDSHQAPITCVGIG 608
              H   ++CV  G
Sbjct: 276 LGGHTNSVSCVKWG 289

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score =  107 bits (266), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 106/375 (28%), Positives = 156/375 (41%), Gaps = 69/375 (18%)

Query: 294 RERFKVESNWRKGTAHIQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGKLV 350
           R  FKV+   R  +A      GH   +L   F       + TG+ D+T  IWD  T   +
Sbjct: 124 RAIFKVKPVTRSSSA----IAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRM 179

Query: 351 RRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVA-AYPGHSDSVLSVDSYK 407
             L GH + V    +  DG+ + TGS+D  IR+W    G     A  GHS  + S+ S++
Sbjct: 180 CTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSL-SWE 238

Query: 408 KI----------IVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSD 456
            I          + + S D T+K+W    R C  TL GHT  V  VK   K+   +SGS 
Sbjct: 239 PIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKN-VLYSGSH 297

Query: 457 DTTIRMWDIRSN-TCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ--- 512
           D TIR WD+  N  C+ + + H   V  +   T         D   + P +     Q   
Sbjct: 298 DKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKAL 357

Query: 513 -----------DPPDGQLSALDDSLPY-----------------------------PSHL 532
                      D  +  ++A DD   Y                               ++
Sbjct: 358 KNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYI 417

Query: 533 LSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGK 590
           +S S DN+IKLW+ R GK + T  GHV  ++ +A  +D   +VS + D T+KVWD+++ K
Sbjct: 418 VSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRK 477

Query: 591 CIHTFDSHQAPITCV 605
                  HQ  +  V
Sbjct: 478 LSVDLPGHQDEVYTV 492

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 76/141 (53%), Gaps = 6/141 (4%)

Query: 329 LLFTGSYDSTVAIWD-LATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYV 385
           L+ T S D T+ +W+ L + K + R+TGH+  V  + F  DG+ +++ S D  I++W+  
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGR 432

Query: 386 TGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCYT-LRGHTEWVGTV 442
            G  ++ + GH  SV  V   S  +++VS S D T+KVW V++R     L GH + V TV
Sbjct: 433 DGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 492

Query: 443 KLHPKSFTCFSGSDDTTIRMW 463
                     SG  D  +R+W
Sbjct: 493 DWSVDGKRVCSGGKDKMVRIW 513

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 60/124 (48%), Gaps = 6/124 (4%)

Query: 305 KGTAHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKA 362
           K T  I    GH   V  + F  + R + + S+D+++ +WD   GK +    GH   V  
Sbjct: 390 KSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQ 449

Query: 363 IYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKT 418
           + +  D + L++ S D  ++VW+  T       PGH D V +VD     K + SG  DK 
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKM 509

Query: 419 VKVW 422
           V++W
Sbjct: 510 VRIW 513

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           +  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH+D V  + +  
Sbjct: 437 LSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSV 496

Query: 366 DGQKLITGSLDRMIRVWNY 384
           DG+++ +G  D+M+R+W +
Sbjct: 497 DGKRVCSGGKDKMVRIWTH 515

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 73/194 (37%), Gaps = 50/194 (25%)

Query: 426 SRTCYTLRGHTEWVGTVKLHPKSFT-CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
           +R+   + GH   +      P + +   +G+ D T  +WD  + T +   +GH       
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQGH------- 185

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                                N        PDG+L A            + S+DNTI+LW
Sbjct: 186 --------------------HNWVLCCSWSPDGELIA------------TGSMDNTIRLW 213

Query: 545 EVRTGK----CVRTHFGHVEGI-WDI-----AADNFRIVSGAHDKTVKVWDLQSGKCIHT 594
           E   GK     +R H   +  + W+        D  R+ + + D T+K+WD     C+ T
Sbjct: 214 ESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLT 273

Query: 595 FDSHQAPITCVGIG 608
              H + ++CV  G
Sbjct: 274 LCGHTSSVSCVKWG 287

>Kwal_23.6324
          Length = 514

 Score =  105 bits (263), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 106/381 (27%), Positives = 158/381 (41%), Gaps = 73/381 (19%)

Query: 291 VIYRER--FKVESNWRKGTAHIQEFKGHMDGVLSLQFNYRL---LFTGSYDSTVAIWDLA 345
           ++Y  R  FKV    R  +A      GH   +L   F       + TGS D+T  IWD  
Sbjct: 118 IVYTPRAVFKVRPVTRSSSA----IAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCN 173

Query: 346 TGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVA-AYPGHSDSVLS 402
           T   +  L GH + V  + +  DG+ + TGS+D  IR+W+   G     A  GH+  + S
Sbjct: 174 TNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITS 233

Query: 403 VDSYKKIIV---------SGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCF 452
           +      +V         S S D T+K+W    R C  TL GHT  V  VK   +    +
Sbjct: 234 LTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGI-LY 292

Query: 453 SGSDDTTIRMWDIRS-NTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPP------- 504
           SGS D TIR WD+ +   C+ + + H   +  +   T         D T + P       
Sbjct: 293 SGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEAR 352

Query: 505 ----RNEATTAQDPPDGQL-----SALDDSLPY--------------------------- 528
               +N    A+   +GQL     +A DD   Y                           
Sbjct: 353 AKALKNYEKIAKK--NGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFS 410

Query: 529 --PSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVW 584
               +++S S DN+IKLW+ R G  + T  GHV  ++ +A  +D   +VS + D T+KVW
Sbjct: 411 PDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW 470

Query: 585 DLQSGKCIHTFDSHQAPITCV 605
           D+++ K       H   +  V
Sbjct: 471 DVRTKKLSVDLPGHNDEVYTV 491

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 73/194 (37%), Gaps = 50/194 (25%)

Query: 426 SRTCYTLRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
           +R+   + GH   +      P  S    +GS D T R+WD  +NT +   +GH   V  V
Sbjct: 132 TRSSSAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCV 191

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                                         PDG+L A            + S+DNTI+LW
Sbjct: 192 AWC---------------------------PDGELIA------------TGSMDNTIRLW 212

Query: 545 EVRTGKCVRTHF-GHVEGIWDI---------AADNFRIVSGAHDKTVKVWDLQSGKCIHT 594
           +   G+       GH + I  +         A D  R+ S + D T+K+WD     C+ T
Sbjct: 213 DSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLT 272

Query: 595 FDSHQAPITCVGIG 608
              H   ++CV  G
Sbjct: 273 LSGHTNSVSCVKWG 286

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 59/124 (47%), Gaps = 6/124 (4%)

Query: 305 KGTAHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKA 362
           K +  I    GH   V  + F  + R + + S+D+++ +WD   G  +    GH   V  
Sbjct: 389 KASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQ 448

Query: 363 IYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKT 418
           + +  D + L++ S D  ++VW+  T       PGH+D V +VD     K + S   DK 
Sbjct: 449 VAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKM 508

Query: 419 VKVW 422
           V++W
Sbjct: 509 VRIW 512

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (58%), Gaps = 5/85 (5%)

Query: 304 RKGTAHIQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK 361
           R GT  I  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH D V 
Sbjct: 431 RNGT-FIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVY 489

Query: 362 AIYF--DGQKLITGSLDRMIRVWNY 384
            + +  DG+++ +   D+M+R+W +
Sbjct: 490 TVDWSVDGKRVCSAGKDKMVRIWTH 514

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score =  104 bits (260), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 104/381 (27%), Positives = 157/381 (41%), Gaps = 87/381 (22%)

Query: 297 FKVESNWRKGTAHIQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGKLVRRL 353
           FKV    R  +A      GH   +L   F       + TG+ D+T  IWD  T   +  L
Sbjct: 125 FKVRPVTRSSSA----IAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPLCTL 180

Query: 354 TGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVA-AYPGHSDSVLSVDSYKKI- 409
            GH + V  + +  DG+ + TGS+D  IR+W+   G  +  A  GH+  + S+ S++ I 
Sbjct: 181 KGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSL-SWEPIH 239

Query: 410 ---------IVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTT 459
                    + S S D T+K+W    R C YTL GHT  V  +K   ++   +S S D T
Sbjct: 240 LVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSGHTSSVSCIKWGGRNV-LYSASHDRT 298

Query: 460 IRMWDIRS-NTCVKVFRGHVGQVQKVLPLTILDTENLVTDRT--SDPPRNEATTAQDPPD 516
           +R WD+ +   C+ + + H   V  +         +L TD      P  +  T    P D
Sbjct: 299 VRCWDMAAGGKCINILKSHAHWVNHL---------SLSTDYALRMGPFDHTGTKPASPED 349

Query: 517 GQLSAL---------------------DDSLPY--------------------------- 528
            Q  AL                     DD   Y                           
Sbjct: 350 AQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFS 409

Query: 529 --PSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVW 584
               +++S S DN+IKLW+ R GK + T  GHV  ++ +A  +D   +VS + D T+KVW
Sbjct: 410 PDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW 469

Query: 585 DLQSGKCIHTFDSHQAPITCV 605
           D+++ K       H   +  V
Sbjct: 470 DVKTRKLTVDLPGHNDEVYTV 490

 Score = 81.3 bits (199), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 129/336 (38%), Gaps = 95/336 (28%)

Query: 305 KGTAHIQEFKGHMDGVLSLQFN---------YRLLFTGSYDSTVAIWDLATGKLVRRLTG 355
           KG +     +GH   + SL +             L + S D T+ IWD      +  L+G
Sbjct: 215 KGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSG 274

Query: 356 HRDGVKAIYFDGQK-LITGSLDRMIRVWNYVTGA-CVAAYPGHSDSV----LSVD----- 404
           H   V  I + G+  L + S DR +R W+   G  C+     H+  V    LS D     
Sbjct: 275 HTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLSTDYALRM 334

Query: 405 ----------------------SYKKI----------IVSGSADKTVKVWHV--ESRTCY 430
                                 +Y+K+          +V+GS D T+ +W+    S+   
Sbjct: 335 GPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPIL 394

Query: 431 TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTIL 490
            + GH + V  V   P      S S D +I++WD R    +  FRGHV  V +V   +  
Sbjct: 395 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSS-- 452

Query: 491 DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGK 550
                                    D +L            L+SCS D T+K+W+V+T K
Sbjct: 453 -------------------------DCRL------------LVSCSKDTTLKVWDVKTRK 475

Query: 551 CVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVKVW 584
                 GH + ++  D + D  R+ SG  DK V++W
Sbjct: 476 LTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 48/79 (60%), Gaps = 4/79 (5%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           I  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH D V  + +  
Sbjct: 435 IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSV 494

Query: 366 DGQKLITGSLDRMIRVWNY 384
           DG+++ +G  D+M+R+W +
Sbjct: 495 DGKRVCSGGKDKMVRLWTH 513

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 76/194 (39%), Gaps = 50/194 (25%)

Query: 426 SRTCYTLRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
           +R+   + GH   +      P  S    +G+ D T R+WD  + T +   +GH   V  V
Sbjct: 131 TRSSSAIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCV 190

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                                  A +A    DG++ A            + S+D TI+LW
Sbjct: 191 -----------------------AWSA----DGEVIA------------TGSMDATIRLW 211

Query: 545 EVRTGKCVRTHF-GHVEGIWDIA---------ADNFRIVSGAHDKTVKVWDLQSGKCIHT 594
           +   G+ +     GH + I  ++          +  R+ S + D T+K+WD     CI+T
Sbjct: 212 DSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYT 271

Query: 595 FDSHQAPITCVGIG 608
              H + ++C+  G
Sbjct: 272 LSGHTSSVSCIKWG 285

>Scas_711.11
          Length = 695

 Score =  103 bits (258), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 133/302 (44%), Gaps = 52/302 (17%)

Query: 302 NWRKGTAHIQEF-----------KGHMDGVLSLQFNY---RLLFTGSYDSTVAIWDLATG 347
           N RK T  +Q++           K H D +  L F+     L   G  D  + IWDL+  
Sbjct: 346 NSRKITPTLQQYFEKGSMINTIQKAHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRS 405

Query: 348 KLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK 407
           K + R+TGH   V  +      L++G  D ++++WN   G               V S++
Sbjct: 406 KQIGRMTGHVATVNCMQITNNMLVSGGKDALLKLWNLNVG---------------VQSFR 450

Query: 408 KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
            ++ + +++  ++     +   +T   H + + +V +  ++    SGS D TIR WDI S
Sbjct: 451 NVLPTNNSN--LEPISSSASCIHTFDSHVDEITSVTVAGENL--ISGSQDRTIRQWDIPS 506

Query: 468 NTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLP 527
             C++        +    P+ + D+  L T + +               G L   D +L 
Sbjct: 507 GKCLQTIDLSFVAIASP-PIQVTDSPFLTTTKAT------------AIIGALQCFDAALA 553

Query: 528 YPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQ 587
             +       D  ++LW++R GK VR   GH   I  +  DN  IV+G+ DKTV++WDL+
Sbjct: 554 TGTR------DGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLR 607

Query: 588 SG 589
           SG
Sbjct: 608 SG 609

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 53/93 (56%), Gaps = 1/93 (1%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGAC 389
           L TG+ D  V +WDL  GK+VR L GH   +  + FD + ++TGS+D+ +R+W+  +G  
Sbjct: 552 LATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSG-I 610

Query: 390 VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVW 422
           ++        VLSVD  K  I   + D+  KV+
Sbjct: 611 LSDMLTFEKPVLSVDFDKNKIAIATHDEACKVY 643

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 57/130 (43%), Gaps = 22/130 (16%)

Query: 510 TAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADN 569
           T Q   D  ++ LD  LP+ +   +  LD+ IK+W++   K +    GHV  +  +   N
Sbjct: 366 TIQKAHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITN 425

Query: 570 FRIVSGAHDKTVKVWDLQSG----------------------KCIHTFDSHQAPITCVGI 607
             +VSG  D  +K+W+L  G                       CIHTFDSH   IT V +
Sbjct: 426 NMLVSGGKDALLKLWNLNVGVQSFRNVLPTNNSNLEPISSSASCIHTFDSHVDEITSVTV 485

Query: 608 GDSEFVSGDE 617
                +SG +
Sbjct: 486 AGENLISGSQ 495

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 102/247 (41%), Gaps = 47/247 (19%)

Query: 395 GHSDSVLSVD---SYKKIIVSGSADKTVKVWHVE-SRTCYTLRGHTEWVGTVKLHPKSFT 450
            H D++  +D    +  +  +G  D  +K+W +  S+    + GH   V  +++      
Sbjct: 370 AHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITNNMLV 429

Query: 451 CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATT 510
             SG  D  +++W++  N  V+ FR        VLP          T+ ++  P + + +
Sbjct: 430 --SGGKDALLKLWNL--NVGVQSFR-------NVLP----------TNNSNLEPISSSAS 468

Query: 511 AQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT---HFGHVEG------ 561
                D  +  +        +L+S S D TI+ W++ +GKC++T    F  +        
Sbjct: 469 CIHTFDSHVDEITSVTVAGENLISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASPPIQVT 528

Query: 562 -------------IWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIG 608
                        I  +   +  + +G  D  V++WDL++GK +   + H   ITC+   
Sbjct: 529 DSPFLTTTKATAIIGALQCFDAALATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFD 588

Query: 609 DSEFVSG 615
           +   V+G
Sbjct: 589 NKNIVTG 595

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 58/125 (46%), Gaps = 11/125 (8%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
           ++  +GH   +  L+F+ + + TGS D TV IWDL +G L   LT  +  V ++ FD  K
Sbjct: 572 VRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSGILSDMLTFEKP-VLSVDFDKNK 630

Query: 370 LITGSLDRMIRVW----NYVTGACVAAYPGHSDSVLSVDSYKKI------IVSGSADKTV 419
           +   + D   +V+    N +           SD  + V + + +      +V G +D T+
Sbjct: 631 IAIATHDEACKVYDRQLNNLQTCTSTDEASTSDPTIPVSTVETMSYQNGYLVEGRSDGTI 690

Query: 420 KVWHV 424
             W V
Sbjct: 691 NSWAV 695

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 92/257 (35%), Gaps = 89/257 (34%)

Query: 401 LSVDSYKKIIVSGSADKTVKVWHVESRTCY----TLRGHTE---WVGTV-KLHPKSFTCF 452
           LS DS   I     ADK  + +H ++R       TL+ + E    + T+ K H  + TC 
Sbjct: 324 LSADSNGDI-----ADKLGQFYHNQNRNSRKITPTLQQYFEKGSMINTIQKAHDDNITCL 378

Query: 453 -----------SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTS 501
                      +G  D  I++WD+  +  +    GHV  V       +  T N+      
Sbjct: 379 DFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVN-----CMQITNNM------ 427

Query: 502 DPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTG------------ 549
                                         L+S   D  +KLW +  G            
Sbjct: 428 ------------------------------LVSGGKDALLKLWNLNVGVQSFRNVLPTNN 457

Query: 550 ----------KCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQ 599
                      C+ T   HV+ I  +      ++SG+ D+T++ WD+ SGKC+ T D   
Sbjct: 458 SNLEPISSSASCIHTFDSHVDEITSVTVAGENLISGSQDRTIRQWDIPSGKCLQTIDLSF 517

Query: 600 APITC--VGIGDSEFVS 614
             I    + + DS F++
Sbjct: 518 VAIASPPIQVTDSPFLT 534

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score =  103 bits (257), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 124/271 (45%), Gaps = 43/271 (15%)

Query: 355 GHRDGVKAIYFD---GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKI 409
            H D +  + FD         G +D ++++W+Y     + A  GH  ++  + VD    +
Sbjct: 402 AHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVATISCMQVDKNYNM 461

Query: 410 IVSGSADKTVKVWHVE-----------SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDT 458
           + +GS D TVK+W+             S   +TL  H + V +  L+       + S D 
Sbjct: 462 VATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSS--LYIDGANLMTASQDK 519

Query: 459 TIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEAT----TAQDP 514
           TIR WD+ S  C++VF               ++  +L   ++S    NE +    T   P
Sbjct: 520 TIRRWDLYSGKCIQVFD--------------VNFPSLSAYKSSFMKSNEDSMILKTVNTP 565

Query: 515 PDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVS 574
             G + + D +L       + + D  I+LW++RTG+ VR   GH++ I  +  D   I+S
Sbjct: 566 IIGSIQSFDAALA------TGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIIS 619

Query: 575 GAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
           G+ D T+++WDL+S        S++ PI+ +
Sbjct: 620 GSLDGTIRLWDLRSNNLTDII-SYEKPISSL 649

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 93/204 (45%), Gaps = 40/204 (19%)

Query: 309 HIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLA----------TGKLVRRLTGH 356
            I   +GH+  +  +Q   NY ++ TGS D+TV +W+              + +  L  H
Sbjct: 439 QIGAMEGHVATISCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAH 498

Query: 357 RDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAY---------------PGHSDSVL 401
            D V ++Y DG  L+T S D+ IR W+  +G C+  +                 + DS++
Sbjct: 499 LDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMI 558

Query: 402 ----------SVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFT 450
                     S+ S+   + +G+ D  +++W + +      L GH + + ++K    + T
Sbjct: 559 LKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKF--DATT 616

Query: 451 CFSGSDDTTIRMWDIRSNTCVKVF 474
             SGS D TIR+WD+RSN    + 
Sbjct: 617 IISGSLDGTIRLWDLRSNNLTDII 640

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 78/188 (41%), Gaps = 31/188 (16%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVR-------RLTGHRDG--- 359
           +     H+D V SL  +   L T S D T+  WDL +GK ++        L+ ++     
Sbjct: 492 LHTLDAHLDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMK 551

Query: 360 ---------------VKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD 404
                          + +I      L TG+ D +IR+W+  TG  V    GH D++ S+ 
Sbjct: 552 SNEDSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLK 611

Query: 405 SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTI---- 460
                I+SGS D T+++W + S     +  + + + ++    K     S   +T I    
Sbjct: 612 FDATTIISGSLDGTIRLWDLRSNNLTDIISYEKPISSLDFDAKHIVVASNEHNTHIYDRN 671

Query: 461 --RMWDIR 466
               WD++
Sbjct: 672 DGNKWDLQ 679

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 64/134 (47%), Gaps = 1/134 (0%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGAC 389
           L TG+ D  + +WD+ TG++VR L GH D + ++ FD   +I+GSLD  IR+W+ +    
Sbjct: 577 LATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIISGSLDGTIRLWD-LRSNN 635

Query: 390 VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSF 449
           +     +   + S+D   K IV  S +    ++       + L+   +   ++ +  K  
Sbjct: 636 LTDIISYEKPISSLDFDAKHIVVASNEHNTHIYDRNDGNKWDLQDEEQDTTSLFVKYKER 695

Query: 450 TCFSGSDDTTIRMW 463
               G  +  I +W
Sbjct: 696 YTMEGRSNGDIGIW 709

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/262 (18%), Positives = 104/262 (39%), Gaps = 61/262 (23%)

Query: 384 YVTGACVAAYP-GHSDSVLSVD---SYKKIIVSGSADKTVKVW-HVESRTCYTLRGHTEW 438
           Y +G  ++  P  H D++  +D    +  +  +G  D  VK+W + + R    + GH   
Sbjct: 390 YNSGKKLSTIPKAHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVAT 449

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTD 498
           +  +++        +GS D T+++W+                             N V  
Sbjct: 450 ISCMQVDKNYNMVATGSKDATVKLWNA----------------------------NDVIG 481

Query: 499 RTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT---H 555
           R  +   +EA    D    ++S+L       ++L++ S D TI+ W++ +GKC++    +
Sbjct: 482 RYEEGNNSEALHTLDAHLDEVSSL---YIDGANLMTASQDKTIRRWDLYSGKCIQVFDVN 538

Query: 556 FGHVEG----------------------IWDIAADNFRIVSGAHDKTVKVWDLQSGKCIH 593
           F  +                        I  I + +  + +G  D  +++WD+++G+ + 
Sbjct: 539 FPSLSAYKSSFMKSNEDSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVR 598

Query: 594 TFDSHQAPITCVGIGDSEFVSG 615
             + H   IT +    +  +SG
Sbjct: 599 VLEGHMDAITSLKFDATTIISG 620

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 55/116 (47%), Gaps = 2/116 (1%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
           ++  +GHMD + SL+F+   + +GS D T+ +WDL +  L   +  +   + ++ FD + 
Sbjct: 597 VRVLEGHMDAITSLKFDATTIISGSLDGTIRLWDLRSNNLT-DIISYEKPISSLDFDAKH 655

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK-KIIVSGSADKTVKVWHV 424
           ++  S +    +++   G          D+      YK +  + G ++  + +W V
Sbjct: 656 IVVASNEHNTHIYDRNDGNKWDLQDEEQDTTSLFVKYKERYTMEGRSNGDIGIWIV 711

>Kwal_27.12667
          Length = 721

 Score =  103 bits (257), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 129/279 (46%), Gaps = 53/279 (18%)

Query: 355 GHRDGVKAIYFD---GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV---DSYKK 408
            H D +  + FD   G     G LD  +++WN      + A PGH  SV  +   DS+  
Sbjct: 402 AHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHS- 460

Query: 409 IIVSGSADKTVKVWHVESRT---------------CYTLRGHTEWVGTVKLHPKSFTCFS 453
            +++G  D  +K+W +E                   +T   H + +    LH +  +  S
Sbjct: 461 -LITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEI--TALHFEGNSLVS 517

Query: 454 GSDDTTIRMWDIRSNTCVKVF------RGHVGQVQKVLPLTILDTENLVTDRTSDPPRNE 507
           GS D TIR WD+ +  C++        RG  G   K+               +S+ PR+ 
Sbjct: 518 GSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKI---------------SSNNPRSS 562

Query: 508 AT-TAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA 566
              T  DPP   + AL     Y + + + + D  ++LW++R+G+ +RT  GH + +  + 
Sbjct: 563 ILLTHNDPP--VIGALQ---CYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQ 617

Query: 567 ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
            D+  +V+G+ D+++++WDL++G     F ++ +PI+ +
Sbjct: 618 FDSVNLVTGSLDRSIRIWDLRTGLLADAF-AYNSPISSL 655

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/349 (22%), Positives = 135/349 (38%), Gaps = 98/349 (28%)

Query: 283 TRKTRPWKVIYRERFKVESNWRKGTAHIQEF-KGHMDGVLSLQFNY---RLLFTGSYDST 338
           +RKT P          ++  +  GT  I  F K H D +  L F+     +   G  D +
Sbjct: 379 SRKTYP---------TLQQFYEPGT-QISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHS 428

Query: 339 VAIWDLATGKLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVWN-------YVTGA-- 388
           V IW+L+    +  L GH   V  +   D   LITG  D ++++W+       Y  GA  
Sbjct: 429 VKIWNLSKKTQIGALPGHLASVSCMQMEDSHSLITGGRDALLKLWDIEKAEELYNDGATE 488

Query: 389 -----CVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTC-------YTLRGHT 436
                CV  +  H D + ++      +VSGS D+T++ W + +  C       +  RG +
Sbjct: 489 GEEELCVHTFDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTS 548

Query: 437 EWVGTVKL-HPKS--------------FTCF-----SGSDDTTIRMWDIRSNTCVKVFRG 476
                +   +P+S                C+     +G+ D  +R+WD+RS   ++   G
Sbjct: 549 GGFSKISSNNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEG 608

Query: 477 HVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCS 536
           H   V  +      D+ NLVT                                      S
Sbjct: 609 HTDAVTGLQ----FDSVNLVT-------------------------------------GS 627

Query: 537 LDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWD 585
           LD +I++W++RTG  +   F +   I  +  D   I+   ++  V+V++
Sbjct: 628 LDRSIRIWDLRTG-LLADAFAYNSPISSLQFDLEHILVSNNESVVQVYN 675

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 107/279 (38%), Gaps = 89/279 (31%)

Query: 384 YVTGACVAAYP-GHSDSVLSVD---SYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEW 438
           Y  G  ++++P  H DS+  +D    +  +  +G  D +VK+W++  +T    L GH   
Sbjct: 390 YEPGTQISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLAS 449

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIR--------------SNTCVKVFRGHVGQVQKV 484
           V  +++   S +  +G  D  +++WDI                  CV  F  HV ++   
Sbjct: 450 VSCMQME-DSHSLITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEI--- 505

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
              T L  E                                    + L+S S D TI+ W
Sbjct: 506 ---TALHFEG-----------------------------------NSLVSGSQDRTIRQW 527

Query: 545 EVRTGKCVRT------HFGHVEGIWDIAADNFR----------------------IVSGA 576
           ++ TGKC++T      + G   G   I+++N R                      + +G 
Sbjct: 528 DLTTGKCLQTIDINFANRGTSGGFSKISSNNPRSSILLTHNDPPVIGALQCYDAAMATGT 587

Query: 577 HDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSG 615
            D  V++WDL+SG+ I T + H   +T +       V+G
Sbjct: 588 KDGLVRLWDLRSGQVIRTLEGHTDAVTGLQFDSVNLVTG 626

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 56/117 (47%), Gaps = 15/117 (12%)

Query: 516 DGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI-AADNFRIVS 574
           D  ++ LD  LP+ +   +  LD+++K+W +     +    GH+  +  +   D+  +++
Sbjct: 404 DDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHSLIT 463

Query: 575 GAHDKTVKVWDLQSGK--------------CIHTFDSHQAPITCVGIGDSEFVSGDE 617
           G  D  +K+WD++  +              C+HTFD+H   IT +    +  VSG +
Sbjct: 464 GGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNSLVSGSQ 520

>Scas_630.6
          Length = 621

 Score =  103 bits (256), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 90/321 (28%), Positives = 143/321 (44%), Gaps = 66/321 (20%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDG---------------------VKAIYF- 365
           + L TG  + T  I+D+ATG+L  +L                           +++I F 
Sbjct: 292 KYLATGC-NRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETVTTTADLYIRSICFS 350

Query: 366 -DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVW 422
            DG+ L TG+ D++IR+WN      V    GH   + S+D +   + +VSGS D+++++W
Sbjct: 351 PDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIW 410

Query: 423 HVESRTCYTLRGHTEWVGTVKLHPKSFTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
            +++  C       + V TV + P       +GS D ++R+WD  S+T   V R      
Sbjct: 411 DLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWD--SSTGFLVER------ 462

Query: 482 QKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTI 541
                   LD++N   +   D   + A T     DGQ            H++S SLD T+
Sbjct: 463 --------LDSDNESGNGHQDSVYSVAFTK----DGQ------------HVVSGSLDRTV 498

Query: 542 KLWEV-----RTGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVWDLQSGKCIHT 594
           KLW +      TGKC  T+ GH + +  +A   D+  I SG+ D+ V +WD  SG  I  
Sbjct: 499 KLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILM 558

Query: 595 FDSHQAPITCVGIGDSEFVSG 615
              H+  +  V   +S    G
Sbjct: 559 LQGHRKSVISVATVNSNVDDG 579

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 121/268 (45%), Gaps = 39/268 (14%)

Query: 354 TGHRDGVKAIYFD---GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKK 408
           + H D V  + F+   G     G LD  I+VWN      VA+  GH  +V  + +D Y  
Sbjct: 408 SAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNT 467

Query: 409 IIVSGSADKTVKVWHVE----------SRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDD 457
           +I +G  D  +K+W ++             C YT   H + +  +     +    SGS D
Sbjct: 468 LI-TGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANNLV--SGSQD 524

Query: 458 TTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDG 517
            TIR WD+ +  CV+            L +      NL          N  T    P  G
Sbjct: 525 RTIRQWDLNNGKCVQT-----------LDINFATGGNLSRSMIGSGFLN--TNNDHPIIG 571

Query: 518 QLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAH 577
            +        Y + L + + D  ++LW++R+G+ VRT  GH + +  +  D+  +V+G+ 
Sbjct: 572 AIQC------YDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSL 625

Query: 578 DKTVKVWDLQSGKCIHTFDSHQAPITCV 605
           D ++++WDL++G    TF S++ P+TC+
Sbjct: 626 DNSIRIWDLRTGTLADTF-SYEHPVTCL 652

 Score = 91.3 bits (225), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 135/333 (40%), Gaps = 78/333 (23%)

Query: 294 RERFKVESNWRKGTAHIQEF-KGHMDGVLSLQFNY---RLLFTGSYDSTVAIWDLATGKL 349
           R+ +     + +  A+I  F   H D V  L FN     L   G  D T+ +W+L+  K 
Sbjct: 387 RKTYPTLQQYYEPGANILSFDSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKH 446

Query: 350 VRRLTGHRDGVKAIYFDG-QKLITGSLDRMIRVWNYVTG----------ACVAAYPGHSD 398
           V  +TGH   V  +  D    LITG  D ++++W+               C+  +  H D
Sbjct: 447 VASITGHLATVSCMQMDQYNTLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHID 506

Query: 399 SVLSVDSYKKIIVSGSADKTVKVWHVESRTC-------YTLRGH-------TEWVGTVKL 444
            + ++      +VSGS D+T++ W + +  C       +   G+       + ++ T   
Sbjct: 507 EITALSFEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNND 566

Query: 445 HP--KSFTCF-----SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVT 497
           HP   +  C+     +G+ D  +R+WD+RS   V+   GH   V  +      D+ NLVT
Sbjct: 567 HPIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQ----FDSLNLVT 622

Query: 498 DRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFG 557
                                                 SLDN+I++W++RTG    T F 
Sbjct: 623 -------------------------------------GSLDNSIRIWDLRTGTLADT-FS 644

Query: 558 HVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGK 590
           +   +  +  D  +IV    + TVKV++ Q  K
Sbjct: 645 YEHPVTCLQFDLNKIVVANQEGTVKVYNRQEKK 677

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 109/269 (40%), Gaps = 79/269 (29%)

Query: 384 YVTGACVAAY-PGHSDSVLSVD---SYKKIIVSGSADKTVKVWHV-ESRTCYTLRGHTEW 438
           Y  GA + ++   H D+V  +D    +  +  +G  D T+KVW++ +++   ++ GH   
Sbjct: 397 YEPGANILSFDSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLAT 456

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIR----------SNTCVKVFRGHVGQVQKVLPLT 488
           V  +++   + T  +G  D  ++MWDI+             C+  F  H+ ++      T
Sbjct: 457 VSCMQMDQYN-TLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEI------T 509

Query: 489 ILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRT 548
            L  E                                    ++L+S S D TI+ W++  
Sbjct: 510 ALSFE-----------------------------------ANNLVSGSQDRTIRQWDLNN 534

Query: 549 GKCVRT---HF---GHVE------GIWDIAAD----------NFRIVSGAHDKTVKVWDL 586
           GKCV+T   +F   G++       G  +   D          +  + +G  D  V++WDL
Sbjct: 535 GKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCYDAALATGTKDGIVRLWDL 594

Query: 587 QSGKCIHTFDSHQAPITCVGIGDSEFVSG 615
           +SG+ + T + H   +T +       V+G
Sbjct: 595 RSGRVVRTLEGHSDAVTSLQFDSLNLVTG 623

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 56/110 (50%), Gaps = 11/110 (10%)

Query: 519 LSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-IVSGAH 577
           ++ LD +LP+ +   +  LD TIK+W +   K V +  GH+  +  +  D +  +++G  
Sbjct: 414 VTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNTLITGGR 473

Query: 578 DKTVKVWDLQSG----------KCIHTFDSHQAPITCVGIGDSEFVSGDE 617
           D  +K+WD+Q             CI+TFDSH   IT +    +  VSG +
Sbjct: 474 DALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANNLVSGSQ 523

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 58/117 (49%), Gaps = 3/117 (2%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
           ++  +GH D V SLQF+   L TGS D+++ IWDL TG L    + +   V  + FD  K
Sbjct: 600 VRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLRTGTLADTFS-YEHPVTCLQFDLNK 658

Query: 370 LITGSLDRMIRVWNYVTGAC-VAAYPGHSDSVLSVDSYKK-IIVSGSADKTVKVWHV 424
           ++  + +  ++V+N             HS++ +    YK   +V G A+  +  W +
Sbjct: 659 IVVANQEGTVKVYNRQEKKHWFCGGDEHSENAVEYVRYKDGYLVEGRANGDINAWAI 715

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score =  102 bits (253), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 122/275 (44%), Gaps = 51/275 (18%)

Query: 355 GHRDGVKAIYFD---GQKLITGSLDRMIRVWNYVTGACVAAYPGH--SDSVLSVDSYKKI 409
            H + +  + FD   G     GSLD  ++VW+      +A   GH  S S + +D Y  +
Sbjct: 395 AHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTL 454

Query: 410 IVSGSADKTVKVWHVESRTC--------------YTLRGHTEWVGTVKLHPKSFTCFSGS 455
           I +G  D  +K+W ++                  YT   H + +  +     +    SGS
Sbjct: 455 I-TGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISFDGDNLV--SGS 511

Query: 456 DDTTIRMWDIRSNTCVKV----FRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTA 511
            D T+R WD+ S  C +     F     + Q+ +PL                 RN     
Sbjct: 512 QDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPL-----------------RNSVLLT 554

Query: 512 QDPPD-GQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF 570
           ++PP  G L   D +L       + + D  ++LW++R+GK VR   GH + I  +  D+ 
Sbjct: 555 KEPPAIGALQCFDAALA------TGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSV 608

Query: 571 RIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
            +V+GA D+++++WDL++G     F +++ PIT +
Sbjct: 609 NLVTGAMDRSIRIWDLRTGILSDVF-AYEQPITSL 642

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 78/359 (21%), Positives = 141/359 (39%), Gaps = 98/359 (27%)

Query: 281 TTTRKTRPWKVIYRERFKVESNWRKGTAHIQEF-----------KGHMDGVLSLQFNY-- 327
           +T++K +   V +R R       RK    +Q+F           K H + +  L F+   
Sbjct: 356 STSKKIKDVGVSHRNR------RRKTYPTLQQFYDSGSKITSLPKAHDEDITCLDFDMPF 409

Query: 328 -RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG-QKLITGSLDRMIRVWNYV 385
             +   GS D +V +WDL+  K +  L GH   +  +  D    LITG  D ++++W+  
Sbjct: 410 GTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTLITGGRDAVLKLWDID 469

Query: 386 TG-------------ACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTL 432
                          AC+  +  H D + ++      +VSGS D+TV+ W + S  C   
Sbjct: 470 KAMADEASNSSEDNDACLYTFDSHVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQT 529

Query: 433 RGHTEWVGTVKLHPK-----------------SFTCF-----SGSDDTTIRMWDIRSNTC 470
              +   G ++                     +  CF     +G+ D  +R+WD+RS   
Sbjct: 530 IDISFATGPMRSQRNIPLRNSVLLTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKV 589

Query: 471 VKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPS 530
           V++  GH   +  +      D+ NLVT                                 
Sbjct: 590 VRMLEGHTDAITSLQ----FDSVNLVT--------------------------------- 612

Query: 531 HLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSG 589
                ++D +I++W++RTG  +   F + + I  +  D  +IV   ++ TVK+++ + G
Sbjct: 613 ----GAMDRSIRIWDLRTG-ILSDVFAYEQPITSLHFDLDKIVISNNEPTVKIYNRKDG 666

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 57/116 (49%), Gaps = 14/116 (12%)

Query: 516 DGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-IVS 574
           D  ++ LD  +P+ +   + SLD+++K+W++   K + T  GH+  I  +  D +  +++
Sbjct: 397 DEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTLIT 456

Query: 575 GAHDKTVKVWDLQSG-------------KCIHTFDSHQAPITCVGIGDSEFVSGDE 617
           G  D  +K+WD+                 C++TFDSH   IT +       VSG +
Sbjct: 457 GGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISFDGDNLVSGSQ 512

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/273 (20%), Positives = 103/273 (37%), Gaps = 83/273 (30%)

Query: 384 YVTGACVAAYP-GHSDSVLSVD---SYKKIIVSGSADKTVKVWHV-ESRTCYTLRGHTEW 438
           Y +G+ + + P  H + +  +D    +  +  +GS D +VKVW + + +   TL GH   
Sbjct: 383 YDSGSKITSLPKAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLAS 442

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIR-------------SNTCVKVFRGHVGQVQKVL 485
           +  +++   S T  +G  D  +++WDI              ++ C+  F  HV ++  + 
Sbjct: 443 ISCMQIDQYS-TLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAI- 500

Query: 486 PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWE 545
                D +NLV                                     S S D T++ W+
Sbjct: 501 ---SFDGDNLV-------------------------------------SGSQDRTVRQWD 520

Query: 546 VRTGKCVRT-----HFGHVEGIWDIAADN------------------FRIVSGAHDKTVK 582
           + +GKC +T       G +    +I   N                    + +G  D  V+
Sbjct: 521 LNSGKCTQTIDISFATGPMRSQRNIPLRNSVLLTKEPPAIGALQCFDAALATGTKDGIVR 580

Query: 583 VWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSG 615
           +WDL+SGK +   + H   IT +       V+G
Sbjct: 581 LWDLRSGKVVRMLEGHTDAITSLQFDSVNLVTG 613

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 61/120 (50%), Gaps = 9/120 (7%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
           ++  +GH D + SLQF+   L TG+ D ++ IWDL TG ++  +  +   + +++FD  K
Sbjct: 590 VRMLEGHTDAITSLQFDSVNLVTGAMDRSIRIWDLRTG-ILSDVFAYEQPITSLHFDLDK 648

Query: 370 LITGSLDRMIRVWNYVTGA---CVAAYP--GHSDSVLSVDSYKKIIVSGSADKTVKVWHV 424
           ++  + +  ++++N   G    C    P  G+ D V     Y   +V G ++  +  W +
Sbjct: 649 IVISNNEPTVKIYNRKDGNHWFCGEDDPEQGNVDFVRYKHGY---LVEGRSNGDINTWAI 705

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score =  100 bits (250), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 126/506 (24%), Positives = 207/506 (40%), Gaps = 78/506 (15%)

Query: 139 QRQVQNVLTT-FAGCNDRIRKLLLEGLLANCCFPQLSFVASEVQKMIKIDFISTLPEEVA 197
           Q  +QN+ T  F        K L+  LL+     +LS +++ ++  +K DF+  LP EV+
Sbjct: 208 QDTMQNIATNAFLQLPHSAFKNLVFQLLSKLNRSELSDLSTYLKDHLKRDFLQYLPMEVS 267

Query: 198 LKILGYLDCESLCNAARVCRRWQQMADDDK-VWYHM--CQQHIDRKCPN--CGWGLPLLH 252
           + IL  LD E +C+   V R W  +  +   +W HM   +  +   C +  C   +P  H
Sbjct: 268 MNILNNLDFEDICSCLLVNRTWNNLIRNSPYLWKHMMLSEGFVTEDCFSSYCD-SIPEKH 326

Query: 253 MKRA----RFIEPPAESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVESNW----- 303
                   RF     E++   +   NP      T       KV+    F+ E N+     
Sbjct: 327 RHLPNPSDRFRLDFLENRWLLENWCNPCYRPGRTCLDGHRTKVV--TCFQFEGNYIITGA 384

Query: 304 -----RKGTAHIQEFK----GHMDGVLSLQF-NYRLLFTGSYDSTVAIWDLATGKLVRRL 353
                    A  ++FK    GH  GV +L++    +L +GS D TV IW++  GK     
Sbjct: 385 DDKRINVYDADREQFKLELVGHEGGVWALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVF 444

Query: 354 TGHRDGVK---AIYFDGQK-LITGSLDRMIRVW--------NYVTGAC------------ 389
            GH   V+    +   G K ++TGS D  + VW        +Y   A             
Sbjct: 445 RGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPFF 504

Query: 390 VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHV-ESRTCYTLRGHTEWVGTVKLHPKS 448
           V    GH  SV +V  +  I+VSGS D  + VW + + +  Y L GHT+ + +     K 
Sbjct: 505 VGVLRGHMASVRTVSGHGNIVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTLYDHKR 564

Query: 449 FTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEA 508
             C S S DTT+++WD+          G V Q+     L +  +   +   T+       
Sbjct: 565 KRCISASMDTTVKVWDLSDINN----NGPVSQINSTSALKVSGSVRTLCGHTALV----- 615

Query: 509 TTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRT-GKCVRTHFGHVEGIWDIAA 567
                   G L   D       +L+S + D +++ W+     K    H  +   I     
Sbjct: 616 --------GLLGLSD------KYLVSAAADGSLRGWDASDYSKRFSFHHTNQSAITTFFV 661

Query: 568 DNFRIVSGAHDKTVKVWDLQSGKCIH 593
            +  +VSG+ +    ++DL++G+ +H
Sbjct: 662 SDNILVSGS-EHQFNIYDLRTGRLVH 686

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 87/206 (42%), Gaps = 20/206 (9%)

Query: 395 GHSDSVLSVDSYK-KIIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCF 452
           GH   V++   ++   I++G+ DK + V+  +       L GH   V  +K +       
Sbjct: 364 GHRTKVVTCFQFEGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALK-YAGDEILV 422

Query: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512
           SGS D T+R+W++++  C  VFRGH   V+ +  +     + +VT    +          
Sbjct: 423 SGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDP 482

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRI 572
           + PD   +A+           +   DN   +  +R         GH+  +  ++     +
Sbjct: 483 NSPDYNPNAMRQ--------FNSIEDNPFFVGVLR---------GHMASVRTVSGHGNIV 525

Query: 573 VSGAHDKTVKVWDLQSGKCIHTFDSH 598
           VSG++D  + VWD+   K ++    H
Sbjct: 526 VSGSYDHNLMVWDIAKMKLLYVLTGH 551

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDLQ 587
           +++++ + D  I +++    +      GH  G+W +  A D   +VSG+ D+TV++W+++
Sbjct: 378 NYIITGADDKRINVYDADREQFKLELVGHEGGVWALKYAGDEI-LVSGSTDRTVRIWNVK 436

Query: 588 SGKCIHTFDSHQAPITCVGI 607
           +GKC H F  H + + C+ +
Sbjct: 437 AGKCTHVFRGHTSTVRCLDV 456

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 92/191 (48%), Gaps = 17/191 (8%)

Query: 313 FKGHMDGVLSLQFNY---RLLFTGSYDSTVAIWDLA-----TGKLVRRLTGHRDGVK--A 362
            +GH   V SL  +     +L +GS D T+  W L       G  VR   GH   V+   
Sbjct: 29  LEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCT 88

Query: 363 IYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVK 420
           +  DG+  ++ S D+ +R+W+  +G C+  + GH   V+SV  D     IVS S DKTVK
Sbjct: 89  VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVK 148

Query: 421 VWHVESRTCYTLRGHTEWVGTVKLHPK-----SFTCFSGSDDTTIRMWDIRSNTCVKVFR 475
           VW+       TL GH +WV  V++ P      + T  S   D  +++WD++S T    F 
Sbjct: 149 VWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFI 208

Query: 476 GHVGQVQKVLP 486
           GH   V  V P
Sbjct: 209 GHNNYVTTVTP 219

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 91/227 (40%), Gaps = 56/227 (24%)

Query: 395 GHSDSVLSVDSYK---KIIVSGSADKTVKVWHVESRT------CYTLRGHTEWVGTVKLH 445
           GH+  V S+ +      +++SGS DKT+  W +            + +GH+  V    + 
Sbjct: 31  GHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVT 90

Query: 446 PKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPR 505
                  S S D T+R+WD++S  C+K F GH   V  V                     
Sbjct: 91  HDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSV--------------------- 129

Query: 506 NEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI 565
                          ++D   P  + ++S S D T+K+W    G CV T  GH + + ++
Sbjct: 130 ---------------SID---PRATQIVSASRDKTVKVWNT-VGDCVVTLLGHNDWVSNV 170

Query: 566 -------AADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
                  + D   ++S   DK VKVWDLQS      F  H   +T V
Sbjct: 171 RIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTV 217

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 79/189 (41%), Gaps = 48/189 (25%)

Query: 431 TLRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMW-----DIRSNTCVKVFRGHVGQVQKV 484
           TL GH  WV ++   P +     SGS D T+  W     D +    V+ F+GH   VQ  
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQ-- 85

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                                 + T   D                 + LS S D T++LW
Sbjct: 86  ----------------------DCTVTHDG---------------KYALSASWDKTLRLW 108

Query: 545 EVRTGKCVRTHFGHVEGIWDIAAD--NFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPI 602
           ++++GKC++   GH   +  ++ D    +IVS + DKTVKVW+   G C+ T   H   +
Sbjct: 109 DLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWN-TVGDCVVTLLGHNDWV 167

Query: 603 TCVGIGDSE 611
           + V I  SE
Sbjct: 168 SNVRIAPSE 176

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 100/252 (39%), Gaps = 46/252 (18%)

Query: 310 IQEFKGHMDGVLSLQFNYRL--LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           I+ F GH   V+S+  + R   + + S D TV +W+   G  V  L GH D V  +    
Sbjct: 116 IKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWN-TVGDCVVTLLGHNDWVSNVRIAP 174

Query: 366 -----DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIVSGSADKT 418
                D   +I+  +D++++VW+  +    A + GH++ V +V       I  S   D  
Sbjct: 175 SEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQ 234

Query: 419 VKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           + +W++  +T  YTL    E V  V   P  +   + +  + I+++D+   T V   +  
Sbjct: 235 IILWNLNEKTALYTLDAKDE-VFAVAFSPNRY-WLTAATASGIKIFDLEERTIVDDLKPE 292

Query: 478 VGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSL 537
                K                           AQDP    L+   D       L +   
Sbjct: 293 FAGYNK---------------------------AQDPHAVSLAWSADG----QTLFAGYT 321

Query: 538 DNTIKLWEVRTG 549
           DN I++W+V T 
Sbjct: 322 DNIIRVWQVMTA 333

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 88/323 (27%), Positives = 130/323 (40%), Gaps = 81/323 (25%)

Query: 320 VLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVR------------------RLTGHRDG 359
           + SL+F  + RL   G  DS + IW L    L+                    L GH   
Sbjct: 476 MTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGT 535

Query: 360 VKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVSGSA 415
           V +  F  D   L++GS D+ +++W+  T   +  Y GH+  V  V          S S 
Sbjct: 536 VYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASH 595

Query: 416 DKTVKVWHVESRTCYTLR---GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVK 472
           D+T ++W  +    Y LR   GHT  V TV  HP     F+GS D T RMWD+ +   V+
Sbjct: 596 DQTARLWACDH--IYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVR 653

Query: 473 VFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHL 532
           +F GH   V                            + Q  PDG+             L
Sbjct: 654 LFLGHTAPV---------------------------LSTQVSPDGRW------------L 674

Query: 533 LSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-----IVSGAHDKTVKVWDLQ 587
            + S D  I LW++ TGK ++   GH  G   + + +F      ++SG  D +V+VWD++
Sbjct: 675 ATGSEDGVICLWDIGTGKRIKQMRGH--GKNAVHSLSFNKEGNVLISGGADHSVRVWDVK 732

Query: 588 SGKC------IHTFDSHQAPITC 604
            G           F++H   IT 
Sbjct: 733 HGTTEQGPEPEQPFNAHVGDITA 755

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 81/175 (46%), Gaps = 17/175 (9%)

Query: 315 GHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKL 370
           GH   V S  F  +   L +GS D TV +W + T   +    GH   V  + F   G   
Sbjct: 531 GHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYF 590

Query: 371 ITGSLDRMIRVWNYVTGACVAAYP-----GHSDSVLSVDSYKK--IIVSGSADKTVKVWH 423
            + S D+  R+W     AC   YP     GH++ V +V  +     + +GS+DKT ++W 
Sbjct: 591 ASASHDQTARLW-----ACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWD 645

Query: 424 VESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           V +     L  GHT  V + ++ P      +GS+D  I +WDI +   +K  RGH
Sbjct: 646 VSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGH 700

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 68/124 (54%), Gaps = 7/124 (5%)

Query: 313 FKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKA--IYFDGQ 368
           F GH + V ++ F  N   +FTGS D T  +WD++TG  VR   GH   V +  +  DG+
Sbjct: 613 FAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGR 672

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHVE 425
            L TGS D +I +W+  TG  +    GH  + +   S+ K   +++SG AD +V+VW V+
Sbjct: 673 WLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVK 732

Query: 426 SRTC 429
             T 
Sbjct: 733 HGTT 736

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 89/197 (45%), Gaps = 22/197 (11%)

Query: 313 FKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQ 368
           +KGH   V  ++F+       + S+D T  +W       +R   GH + V  + F  +G 
Sbjct: 571 YKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGC 630

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS--VDSYKKIIVSGSADKTVKVWHVES 426
            + TGS D+  R+W+  TG  V  + GH+  VLS  V    + + +GS D  + +W + +
Sbjct: 631 YVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGT 690

Query: 427 -RTCYTLRGHTEWVGTVKLHPKSFT-----CFSGSDDTTIRMWDIRSNTC------VKVF 474
            +    +RGH    G   +H  SF        SG  D ++R+WD++  T        + F
Sbjct: 691 GKRIKQMRGH----GKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPF 746

Query: 475 RGHVGQVQKVLPLTILD 491
             HVG +   +   I D
Sbjct: 747 NAHVGDITASINQDIKD 763

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 5/83 (6%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGH-RDGVKAIYF- 365
           ++ F GH   VLS Q   + R L TGS D  + +WD+ TGK ++++ GH ++ V ++ F 
Sbjct: 652 VRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFN 711

Query: 366 -DGQKLITGSLDRMIRVWNYVTG 387
            +G  LI+G  D  +RVW+   G
Sbjct: 712 KEGNVLISGGADHSVRVWDVKHG 734

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF--RIVSGAHDKTVKVW 584
           P   +L+S S D T+KLW + T   +  + GH   +WD+          S +HD+T ++W
Sbjct: 543 PDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLW 602

Query: 585 DLQSGKCIHTFDSHQAPITCVGI 607
                  +  F  H   +  V  
Sbjct: 603 ACDHIYPLRIFAGHTNDVDTVSF 625

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/266 (28%), Positives = 107/266 (40%), Gaps = 48/266 (18%)

Query: 345 ATGKLVRRLTGHRDGVKAIYFD---GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV- 400
           A  KL R + GH   V+ +  D        TGS D  IRVW+  TG       GH  +V 
Sbjct: 101 APWKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVR 160

Query: 401 -LSVDSYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDT 458
            + + +    + S S DK VK W +E  T      G    V +V LHP      S   D+
Sbjct: 161 DICISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDS 220

Query: 459 TIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQ 518
            +R+WDIRS +CV    GH G + KV                                  
Sbjct: 221 VVRVWDIRSRSCVLTLAGHRGPINKV---------------------------------- 246

Query: 519 LSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAAD--NFRIVSGA 576
                  LP    ++SCS D T+KLW++  GK ++T   H   + D+A +   F   S  
Sbjct: 247 -----RCLPVDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFSFASAC 301

Query: 577 HDKTVKVWDLQSGKCIHTFDSHQAPI 602
            D  ++ W L  G+ +  F+S    I
Sbjct: 302 TDD-IRSWKLVDGQLLTNFNSEALGI 326

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 128/292 (43%), Gaps = 36/292 (12%)

Query: 332 TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGAC 389
           TGS DST+ +WDLATGKL   L GH   V+ I    +   + + S D++++ W+      
Sbjct: 131 TGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTV 190

Query: 390 VAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHP 446
           V  + G    V SVD +    +IVS   D  V+VW + SR+C  TL GH   +  V+  P
Sbjct: 191 VRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLP 250

Query: 447 KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRN 506
                 S S D T+++WD+ +   +K    H   V+    L    TE       +D  R+
Sbjct: 251 VDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRD---LAFNPTEFSFASACTDDIRS 307

Query: 507 EATTAQDPPDGQ-LSALDDSLPYPSHLLSCSLDNT---------IKLWEVRTG----KCV 552
                    DGQ L+  +       + L+C+ D           +  ++ +TG    K  
Sbjct: 308 WKLV-----DGQLLTNFNSEALGIVNTLACNQDGVLFAGGDTGELSFFDYKTGHKFQKLE 362

Query: 553 RTHF-GHVEGIWDIAADNF-----RIVSGAHDKTVKVWDLQSGKCIHTFDSH 598
            T   G +E    + A  F     R+++   DK++K+W    G    T DSH
Sbjct: 363 TTAMPGSLESEKGVLASTFDRTGLRLLTCERDKSIKIWKHIDGA---TQDSH 411

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 100/202 (49%), Gaps = 16/202 (7%)

Query: 422 WHVESRTCYTLRGHTEWVGTVKLHPKSFTCFS-GSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
           WH   +    + GHT WV  V + P     F+ GS+D+TIR+WD+ +       +GH+  
Sbjct: 99  WHAPWKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMT 158

Query: 481 VQKVL-----PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSH--LL 533
           V+ +      P     +++ +  +  D  RN  T  +D   G LS +     +PS   ++
Sbjct: 159 VRDICISARHPYMFSASQDKLV-KCWDLERN--TVVRDF-HGTLSGVHSVDLHPSLDLIV 214

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGH---VEGIWDIAADNFRIVSGAHDKTVKVWDLQSGK 590
           S   D+ +++W++R+  CV T  GH   +  +  +  D  +IVS + D TVK+WDL +GK
Sbjct: 215 SAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDP-QIVSCSTDATVKLWDLVAGK 273

Query: 591 CIHTFDSHQAPITCVGIGDSEF 612
            + T   H+  +  +    +EF
Sbjct: 274 PMKTLTHHKRNVRDLAFNPTEF 295

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 6/96 (6%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHR---DGVKAIY 364
           +++F G + GV S+    +  L+ +   DS V +WD+ +   V  L GHR   + V+ + 
Sbjct: 191 VRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLP 250

Query: 365 FDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV 400
            D Q +++ S D  +++W+ V G  +     H  +V
Sbjct: 251 VDPQ-IVSCSTDATVKLWDLVAGKPMKTLTHHKRNV 285

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 10/77 (12%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTG--------HRDGVKAIYFD--GQKLITGSLDRM 378
           +LF G     ++ +D  TG   ++L             GV A  FD  G +L+T   D+ 
Sbjct: 337 VLFAGGDTGELSFFDYKTGHKFQKLETTAMPGSLESEKGVLASTFDRTGLRLLTCERDKS 396

Query: 379 IRVWNYVTGACVAAYPG 395
           I++W ++ GA   ++PG
Sbjct: 397 IKIWKHIDGATQDSHPG 413

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 98.6 bits (244), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 123/283 (43%), Gaps = 64/283 (22%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRL-------------TGHRDGVKAIYF--DGQKLIT 372
           RL+  G  DS + +W L    L  +L              GH   V ++ F  D + L++
Sbjct: 500 RLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVS 559

Query: 373 GSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCY 430
            S D+ +R+W+  T  C+ +Y GH+  V  V          +GS D+T ++W  +    Y
Sbjct: 560 ASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDH--IY 617

Query: 431 TLR---GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPL 487
            LR   GH   V  V  HP      +GS D T RMWDI++   V++F GH   V  V   
Sbjct: 618 PLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSV--- 674

Query: 488 TILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVR 547
                               A +    PDG+             L + S D  I +W++ 
Sbjct: 675 --------------------AVS----PDGRW------------LTTGSEDGVIIVWDIG 698

Query: 548 TGKCVRTHFGHVE-GIWDIA--ADNFRIVSGAHDKTVKVWDLQ 587
           TGK ++   GH +  ++ ++   +   +VSG  D++V+VWDL+
Sbjct: 699 TGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 104/251 (41%), Gaps = 57/251 (22%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYP-------------GHSDSVLSVD--SYKKII 410
           D + +  G  D  I++W+       +  P             GHS  V SV      + +
Sbjct: 498 DSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYL 557

Query: 411 VSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNT 469
           VS S DKTV++W +++ TC  + +GH   V  VK  P      +GS D T R+W      
Sbjct: 558 VSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIY 617

Query: 470 CVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYP 529
            +++F GH+  V            + VT                 P+G            
Sbjct: 618 PLRIFAGHLNDV------------DCVTFH---------------PNG------------ 638

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVWDLQ 587
           +++L+ S D T ++W+++TG  VR   GH   +  +A   D   + +G+ D  + VWD+ 
Sbjct: 639 TYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIG 698

Query: 588 SGKCIHTFDSH 598
           +GK I     H
Sbjct: 699 TGKRIKQMRGH 709

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 7/123 (5%)

Query: 313 FKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK--AIYFDGQ 368
           F GH++ V  + F  N   + TGS D T  +WD+ TG  VR   GH   V   A+  DG+
Sbjct: 622 FAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGR 681

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHVE 425
            L TGS D +I VW+  TG  +    GH  S +   S+ K   I+VSG AD++V+VW ++
Sbjct: 682 WLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

Query: 426 SRT 428
             T
Sbjct: 742 KFT 744

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 83/175 (47%), Gaps = 17/175 (9%)

Query: 315 GHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKL 370
           GH   V S+ F  + R L + S D TV +W L T   +    GH   V  + F   G   
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 371 ITGSLDRMIRVWNYVTGACVAAYP-----GHSDSVLSVDSYKK--IIVSGSADKTVKVWH 423
            TGS D+  R+W     +C   YP     GH + V  V  +     +++GS+DKT ++W 
Sbjct: 600 ATGSHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWD 654

Query: 424 VESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           +++     L  GHT  V +V + P      +GS+D  I +WDI +   +K  RGH
Sbjct: 655 IQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGH 709

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 48/79 (60%), Gaps = 5/79 (6%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGH-RDGVKAIYF- 365
           ++ F GH   V+S+    + R L TGS D  + +WD+ TGK ++++ GH +  V ++ F 
Sbjct: 661 VRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFN 720

Query: 366 -DGQKLITGSLDRMIRVWN 383
            +G  L++G  D+ +RVW+
Sbjct: 721 KEGNILVSGGADQSVRVWD 739

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 2/77 (2%)

Query: 531 HLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF--RIVSGAHDKTVKVWDLQS 588
           +L+S S D T++LW + T  C+ ++ GH   +WD+          +G+HD+T ++W    
Sbjct: 556 YLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDH 615

Query: 589 GKCIHTFDSHQAPITCV 605
              +  F  H   + CV
Sbjct: 616 IYPLRIFAGHLNDVDCV 632

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 98.6 bits (244), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 122/283 (43%), Gaps = 64/283 (22%)

Query: 328 RLLFTGSYDSTVAIWDLATGKL-------------VRRLTGHRDGVKAIYF--DGQKLIT 372
           RL   G  DST+ +W L    L                L GH   V ++ F  D + L++
Sbjct: 511 RLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLS 570

Query: 373 GSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCY 430
            S D+ +R+W+  T  C+  Y GH+  V  +         ++ S D+T ++W  +    Y
Sbjct: 571 ASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDH--IY 628

Query: 431 TLR---GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPL 487
            LR   GH   V     HP     F+GS D T RMWDI++   V++F GH        P+
Sbjct: 629 PLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTS------PV 682

Query: 488 TILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVR 547
           T L+                       PDG+             L + S D TI +W++ 
Sbjct: 683 TALEVS---------------------PDGRW------------LTTGSEDGTIIVWDIG 709

Query: 548 TGKCVRTHFGHVEG-IWDIAADNFR--IVSGAHDKTVKVWDLQ 587
           TGK ++   GH +  I+ I  +     +V+G  D++V+VWD++
Sbjct: 710 TGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 107/260 (41%), Gaps = 60/260 (23%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACV--------------AAYPGHSDSVLSV--DSYKKI 409
           D +    G  D  I+VW Y+ G+ +              A   GHS  V SV      + 
Sbjct: 509 DARLTAAGFQDSTIKVW-YLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRY 567

Query: 410 IVSGSADKTVKVWHVESRTCYT-LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN 468
           ++S S DKTV++W +++ TC    +GH   V  VK  P      + S D T R+W     
Sbjct: 568 LLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHI 627

Query: 469 TCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPY 528
             +++F GH+                           N+   +   P+G           
Sbjct: 628 YPLRIFSGHL---------------------------NDVDCSTFHPNG----------- 649

Query: 529 PSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDL 586
             ++ + S D T ++W+++TG  VR   GH   +   +++ D   + +G+ D T+ VWD+
Sbjct: 650 -CYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDI 708

Query: 587 QSGKCIHTFDSH-QAPITCV 605
            +GK I     H + PI  +
Sbjct: 709 GTGKRIKQMKGHGKNPIYSI 728

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 313 FKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQ 368
           F GH++ V    F  N   +FTGS D T  +WD+ TG  VR   GH   V A+    DG+
Sbjct: 633 FSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGR 692

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHVE 425
            L TGS D  I VW+  TG  +    GH  + +   ++ K    +V+G AD++V+VW ++
Sbjct: 693 WLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

Query: 426 SRT 428
             T
Sbjct: 753 RFT 755

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 82/175 (46%), Gaps = 17/175 (9%)

Query: 315 GHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKL 370
           GH   V S+ F  + R L + S D TV +W L T   +    GH   V  + F   G   
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYF 610

Query: 371 ITGSLDRMIRVWNYVTGACVAAYP-----GHSDSVLSVDSYKK--IIVSGSADKTVKVWH 423
           IT S D+  R+W     +C   YP     GH + V     +     + +GS+DKT ++W 
Sbjct: 611 ITASHDQTARLW-----SCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWD 665

Query: 424 VESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           +++     L  GHT  V  +++ P      +GS+D TI +WDI +   +K  +GH
Sbjct: 666 IQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGH 720

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 80/162 (49%), Gaps = 8/162 (4%)

Query: 313 FKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQ 368
           +KGH   V  ++F+       T S+D T  +W       +R  +GH + V    F  +G 
Sbjct: 591 YKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGC 650

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES 426
            + TGS D+  R+W+  TG  V  + GH+  V  L V    + + +GS D T+ VW + +
Sbjct: 651 YVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGT 710

Query: 427 -RTCYTLRGHTEW-VGTVKLHPKSFTCFSGSDDTTIRMWDIR 466
            +    ++GH +  + ++  + +     +G  D ++R+WDI+
Sbjct: 711 GKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGH-RDGVKAIYF- 365
           ++ F GH   V +L+   + R L TGS D T+ +WD+ TGK ++++ GH ++ + +I F 
Sbjct: 672 VRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFN 731

Query: 366 -DGQKLITGSLDRMIRVWN 383
            +G  L+TG  D+ +RVW+
Sbjct: 732 KEGNCLVTGGADQSVRVWD 750

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 74/204 (36%), Gaps = 60/204 (29%)

Query: 448 SFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNE 507
           + TC   SDD  +     + +T +KV+      +Q +LP    D  N  T      P   
Sbjct: 500 NMTCVEFSDDARLTAAGFQDST-IKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYS 558

Query: 508 ATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW---- 563
              +   PD +            +LLS S D T++LW + T  C+  + GH   +W    
Sbjct: 559 VAFS---PDNR------------YLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKF 603

Query: 564 -----------------------------------DIAADNFR-----IVSGAHDKTVKV 583
                                              D+    F      + +G+ DKT ++
Sbjct: 604 SPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRM 663

Query: 584 WDLQSGKCIHTFDSHQAPITCVGI 607
           WD+Q+G  +  F  H +P+T + +
Sbjct: 664 WDIQTGDSVRLFLGHTSPVTALEV 687

>Scas_721.115*
          Length = 318

 Score = 94.0 bits (232), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 62/189 (32%), Positives = 90/189 (47%), Gaps = 17/189 (8%)

Query: 313 FKGHMDGVLSLQFNY---RLLFTGSYDSTVAIWDLAT-----GKLVRRLTGHRDGVK--A 362
            +GH   V SL  +     LL +GS D T+  W L       G  VR   GH   V+   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 363 IYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVK 420
           +  DG   ++ S D+ +R+W+  TG     + GH   V+SV  D    +I+SGS DKT+K
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 421 VWHVESRTCYTLRGHTEWVGTVKLHPK-----SFTCFSGSDDTTIRMWDIRSNTCVKVFR 475
           VW ++ +   TL GH +WV  V++ P      S T  S  +D  ++ W++        F 
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 476 GHVGQVQKV 484
           GH G V  V
Sbjct: 193 GHNGNVNTV 201

 Score = 75.9 bits (185), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 82/170 (48%), Gaps = 17/170 (10%)

Query: 310 IQEFKGH----MDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF 365
           ++ FKGH     D  L+    Y L  + S+D T+ +WD+ATG+  +R  GH+  V ++  
Sbjct: 58  VRSFKGHSHIVQDCTLTQDGAYAL--SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI 115

Query: 366 D--GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV-------DSYKKIIVSGSAD 416
           D     +I+GS D+ I+VW  + G C+A   GH+D V  V       +     ++S   D
Sbjct: 116 DRKASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGND 174

Query: 417 KTVKVWHV-ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           K VK W++ + +      GH   V TV   P      S   D  I +W++
Sbjct: 175 KMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNL 224

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 79/189 (41%), Gaps = 48/189 (25%)

Query: 431 TLRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMW-----DIRSNTCVKVFRGHVGQVQKV 484
           TL GH  WV ++     +     SGS D T+  W     D +    V+ F+GH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ-- 69

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                                 + T  QD                ++ LS S D T++LW
Sbjct: 70  ----------------------DCTLTQDG---------------AYALSASWDKTLRLW 92

Query: 545 EVRTGKCVRTHFGHVEGIWDIAADN--FRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPI 602
           +V TG+  +   GH   +  +A D     I+SG+ DKT+KVW ++ G+C+ T   H   +
Sbjct: 93  DVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWV 151

Query: 603 TCVGIGDSE 611
           + V I  ++
Sbjct: 152 SQVRIAPTD 160

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 87/227 (38%), Gaps = 56/227 (24%)

Query: 395 GHSDSVLSVDSYK---KIIVSGSADKTVKVWHVESRT------CYTLRGHTEWVGTVKLH 445
           GH+  V S+ +      +++SGS DKT+  W +            + +GH+  V    L 
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLT 74

Query: 446 PKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPR 505
                  S S D T+R+WD+ +    + F GH   V  V             DR +    
Sbjct: 75  QDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV-----------AIDRKA---- 119

Query: 506 NEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--- 562
                                   S ++S S D TIK+W ++ G+C+ T  GH + +   
Sbjct: 120 ------------------------SMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQV 154

Query: 563 ----WDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
                D   D+  ++S  +DK VK W+L   +    F  H   +  V
Sbjct: 155 RIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTV 201

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 311 QEFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--- 365
           Q F GH   V+S+  + +  ++ +GS D T+ +W +  G+ +  L GH D V  +     
Sbjct: 101 QRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRIAPT 159

Query: 366 ----DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKTV 419
               D   +I+   D+M++ WN       A + GH+ +V +V +     +I S   D  +
Sbjct: 160 DQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEI 219

Query: 420 KVWHV-ESRTCYTLRGHTEWVGTVKLHPKSF 449
            +W++ E +  YTL    E V  +   P  +
Sbjct: 220 MLWNLAEKKAMYTLSAQDE-VFALAFSPNRY 249

>Scas_592.4*
          Length = 318

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 90/189 (47%), Gaps = 17/189 (8%)

Query: 313 FKGHMDGVLSLQFNY---RLLFTGSYDSTVAIWDLAT-----GKLVRRLTGHRDGVK--A 362
            +GH   V SL  +     LL +GS D T+  W L       G  VR   GH   V+   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 363 IYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVK 420
           +  DG   ++ S D+ +R+W+  TG     + GH   V+SV  D    +I+SGS DKT+K
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 421 VWHVESRTCYTLRGHTEWVGTVKLHPK-----SFTCFSGSDDTTIRMWDIRSNTCVKVFR 475
           VW ++ +   TL GH +WV  V++ P      + T  S  +D  ++ W++        F 
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 476 GHVGQVQKV 484
           GH G V  V
Sbjct: 193 GHNGNVNAV 201

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 79/189 (41%), Gaps = 48/189 (25%)

Query: 431 TLRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMW-----DIRSNTCVKVFRGHVGQVQKV 484
           TL GH  WV ++     +     SGS D T+  W     D +    V+ F+GH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ-- 69

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                                 + T  QD                ++ LS S D T++LW
Sbjct: 70  ----------------------DCTLTQDG---------------AYALSASWDKTLRLW 92

Query: 545 EVRTGKCVRTHFGHVEGIWDIAADN--FRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPI 602
           +V TG+  +   GH   +  +A D     I+SG+ DKT+KVW ++ G+C+ T   H   +
Sbjct: 93  DVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWV 151

Query: 603 TCVGIGDSE 611
           + V I  ++
Sbjct: 152 SQVRIAPTD 160

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 86/227 (37%), Gaps = 56/227 (24%)

Query: 395 GHSDSVLSVDSYK---KIIVSGSADKTVKVWHVESRT------CYTLRGHTEWVGTVKLH 445
           GH+  V S+ +      +++SGS DKT+  W +            + +GH+  V    L 
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLT 74

Query: 446 PKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPR 505
                  S S D T+R+WD+ +    + F GH   V  V             DR +    
Sbjct: 75  QDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV-----------AIDRKA---- 119

Query: 506 NEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--- 562
                                   S ++S S D TIK+W ++ G+C+ T  GH + +   
Sbjct: 120 ------------------------SMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQV 154

Query: 563 ----WDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
                D   D   ++S  +DK VK W+L   +    F  H   +  V
Sbjct: 155 RIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAV 201

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 311 QEFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--- 365
           Q F GH   V+S+  + +  ++ +GS D T+ +W +  G+ +  L GH D V  +     
Sbjct: 101 QRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRIAPT 159

Query: 366 ----DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKTV 419
               D   +I+   D+M++ WN       A + GH+ +V +V +     +I S   D  +
Sbjct: 160 DQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEI 219

Query: 420 KVWHV-ESRTCYTLRGHTEWVGTVKLHPKSF 449
            +W++ E +  YTL    E V ++   P  +
Sbjct: 220 MLWNLAEKKAMYTLSAQDE-VFSLAFSPNRY 249

>Kwal_27.12053
          Length = 755

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 124/293 (42%), Gaps = 66/293 (22%)

Query: 320 VLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRL-------------TGHRDGVKAIY 364
           + SL+F  + RL   G  DS + IW L    L  +L              GH   V +  
Sbjct: 430 MTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTS 489

Query: 365 F--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVK 420
           F  D + L++ S D+ +R+W+  T   +  Y GH+  +  ++         + S D+T +
Sbjct: 490 FSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTAR 549

Query: 421 VWHVESRTCYTLR---GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           +W  +    Y LR   GH   V TV  HP     F+GS D T RMWDI S   V++F GH
Sbjct: 550 LWSCDH--IYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGH 607

Query: 478 VGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSL 537
              V                           T+    PDG+             L + S 
Sbjct: 608 TAPV---------------------------TSTAVSPDGRW------------LSTGSE 628

Query: 538 DNTIKLWEVRTGKCVRTHFGHVE-GIWDI--AADNFRIVSGAHDKTVKVWDLQ 587
           D  I +W++ TGK ++   GH +  ++ +  + +   ++SG  D +V+VWD++
Sbjct: 629 DGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 68/124 (54%), Gaps = 7/124 (5%)

Query: 313 FKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV--KAIYFDGQ 368
           F GH++ V ++ F  N   +FTGS D T  +WD+ +G  VR   GH   V   A+  DG+
Sbjct: 562 FAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGR 621

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHVE 425
            L TGS D +I VW+  TG  +    GH  + +   SY K   +++SG AD +V+VW V+
Sbjct: 622 WLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

Query: 426 SRTC 429
             T 
Sbjct: 682 KSTA 685

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 78/175 (44%), Gaps = 17/175 (9%)

Query: 315 GHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKL 370
           GH   V S  F  + R L + S D TV +W   T   +    GH   +  + F   G   
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYF 539

Query: 371 ITGSLDRMIRVWNYVTGACVAAYP-----GHSDSVLSVDSYKK--IIVSGSADKTVKVWH 423
            T S D+  R+W     +C   YP     GH + V +V  +     + +GS+DKT ++W 
Sbjct: 540 ATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWD 594

Query: 424 VESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           + S     L  GHT  V +  + P      +GS+D  I +WDI +   +K  RGH
Sbjct: 595 ITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGH 649

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 85/183 (46%), Gaps = 14/183 (7%)

Query: 313 FKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQ 368
           +KGH   +  + F+       T S+D T  +W       +R   GH + V  + F  +G 
Sbjct: 520 YKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGT 579

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS--VDSYKKIIVSGSADKTVKVWHVES 426
            + TGS D+  R+W+  +G  V  + GH+  V S  V    + + +GS D  + VW + +
Sbjct: 580 YVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGT 639

Query: 427 -RTCYTLRGHTE-WVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC------VKVFRGHV 478
            +    +RGH +  V ++    +     SG  D ++R+WD++ +T        + F G+ 
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVKKSTAEPGSEPEQPFTGYS 699

Query: 479 GQV 481
           G V
Sbjct: 700 GDV 702

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/216 (19%), Positives = 78/216 (36%), Gaps = 55/216 (25%)

Query: 408 KIIVSGSADKTVKVWHV--------------ESRTCYTLRGHTEWVGTVKLHPKSFTCFS 453
           ++  +G  D  +K+W +              E     TL GH+  V +    P +    S
Sbjct: 440 RLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFSPDNRYLLS 499

Query: 454 GSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQD 513
            S+D T+R+W   + T +  ++GH   +  V                             
Sbjct: 500 ASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVA---------------------------- 531

Query: 514 PPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFR 571
                        P   +  + S D T +LW       +R   GH+  +  ++   +   
Sbjct: 532 -----------FSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTY 580

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
           + +G+ DKT ++WD+ SG  +  F  H AP+T   +
Sbjct: 581 VFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAV 616

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 9/81 (11%)

Query: 310 IQEFKGHMDGVLS--LQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           ++ F GH   V S  +  + R L TGS D  + +WD+ TGK ++++ GH  G  A+Y   
Sbjct: 601 VRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGH--GKNAVYSLS 658

Query: 366 ---DGQKLITGSLDRMIRVWN 383
              +G  LI+G  D  +RVW+
Sbjct: 659 YSKEGHVLISGGADHSVRVWD 679

>Kwal_26.8776
          Length = 433

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 82/158 (51%), Gaps = 5/158 (3%)

Query: 332 TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGAC 389
           TGS D+T+ +WD+A+GKL   LTGH   V+++    +   + + S D+M++ W+    A 
Sbjct: 139 TGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAA 198

Query: 390 VAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHP 446
           +  Y GH   V +VD +    +I S   D  V++W + +R    TL GH   +  VK  P
Sbjct: 199 IRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFP 258

Query: 447 KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
                 S S D T+R+WDIR+    K+   H   V+ +
Sbjct: 259 VDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAI 296

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 109/279 (39%), Gaps = 51/279 (18%)

Query: 345 ATGKLVRRLTGHRDGVKAI---YFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVL 401
           A  KL+R + GH   V+ +     D     TGS D  I+VW+  +G       GH  +V 
Sbjct: 109 APWKLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVR 168

Query: 402 SVDSYKK--IIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDT 458
           SV   ++  ++ S S DK VK W +E         GH   V TV +HP      S   D 
Sbjct: 169 SVAVSQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDA 228

Query: 459 TIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQ 518
            +R+WDIR+   V    GH   + +V                                  
Sbjct: 229 VVRLWDIRTRLPVMTLAGHKSPINQV---------------------------------- 254

Query: 519 LSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-IVSGAH 577
                   P    ++SCS D T++LW++R GK  +    H + +  IAA      V+ A 
Sbjct: 255 -----KCFPVDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAAHPAESSVATAS 309

Query: 578 DKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSGD 616
              V+ W    G+ +  + S       +GI +S  V+ D
Sbjct: 310 TSDVRSWRHSDGQLLTNYHSE-----GIGIINSLSVNAD 343

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 77/168 (45%), Gaps = 10/168 (5%)

Query: 308 AHIQEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIWDLATGKLVRRLTGHR---DGVKA 362
           A I+++ GH  GV ++  +    L+ +   D+ V +WD+ T   V  L GH+   + VK 
Sbjct: 197 AAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKC 256

Query: 363 IYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY-KKIIVSGSADKTVKV 421
              D Q +++ S D  +R+W+   G        HS SV ++ ++  +  V+ ++   V+ 
Sbjct: 257 FPVDPQ-IMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAAHPAESSVATASTSDVRS 315

Query: 422 WHVESRTCYTLRGHTEWVGTVKLHPKSF--TCFSGSDDTTIRMWDIRS 467
           W        T   H+E +G +     +     F G DD  +  +D +S
Sbjct: 316 WRHSDGQLLT-NYHSEGIGIINSLSVNADGVLFGGGDDGNLSFFDYKS 362

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 10/76 (13%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLT-----GHRD---GVKAIYFD--GQKLITGSLDRM 378
           +LF G  D  ++ +D  +G   + L      G  D   G+ +  FD  G +LITG  D+ 
Sbjct: 345 VLFGGGDDGNLSFFDYKSGHKYQELPTTKIPGSLDSERGILSASFDQTGLRLITGESDKS 404

Query: 379 IRVWNYVTGACVAAYP 394
           I++W  +  A    +P
Sbjct: 405 IKMWKQIPEATPETHP 420

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 94.7 bits (234), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 118/287 (41%), Gaps = 68/287 (23%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLV-----------------RRLTGHRDGVKAIYF--DGQ 368
           R+   G  DS + IW L    L                  + L GH   V +  F  D +
Sbjct: 479 RIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNK 538

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES 426
            L++GS D+ +R+W+  T   + +Y GH+  V  +S         + S D+T ++W  + 
Sbjct: 539 YLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH 598

Query: 427 RTCYTLR---GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQK 483
              Y LR   GH   V  V  HP     F+GS D T RMWD+ +   V++F GH   V  
Sbjct: 599 --IYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIS 656

Query: 484 VLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKL 543
           +                              PDG+             L + S D  I +
Sbjct: 657 IAVC---------------------------PDGRW------------LSTGSEDGIINV 677

Query: 544 WEVRTGKCVRTHFGHVE-GIWDI--AADNFRIVSGAHDKTVKVWDLQ 587
           W++ TGK ++   GH +  I+ +  + +   ++SG  D TV+VWDL+
Sbjct: 678 WDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 68/124 (54%), Gaps = 7/124 (5%)

Query: 313 FKGHMDGV--LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQ 368
           F GH++ V  +S   N   +FTGS D T  +WD++TG  VR   GH   V +I    DG+
Sbjct: 605 FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGR 664

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHVE 425
            L TGS D +I VW+  TG  +    GH  + +   SY K   +++SG AD TV+VW ++
Sbjct: 665 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

Query: 426 SRTC 429
             T 
Sbjct: 725 KATT 728

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 91/229 (39%), Gaps = 53/229 (23%)

Query: 408 KIIVSGSADKTVKVWHV------------------ESRTCYTLRGHTEWVGTVKLHPKSF 449
           +I  +G  D  +K+W +                  E  TC TL GH+  V +    P + 
Sbjct: 479 RIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNK 538

Query: 450 TCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEAT 509
              SGS+D T+R+W + ++T +  ++GH                + V D +  P  +   
Sbjct: 539 YLLSGSEDKTVRLWSMDTHTALVSYKGH---------------NHPVWDVSFSPLGHYFA 583

Query: 510 TAQDPPDGQLSALDDSLP---YPSHL---------------LSCSLDNTIKLWEVRTGKC 551
           TA      +L + D   P   +  HL                + S D T ++W+V TG  
Sbjct: 584 TASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 643

Query: 552 VRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVWDLQSGKCIHTFDSH 598
           VR   GH   +  IA   D   + +G+ D  + VWD+ +GK +     H
Sbjct: 644 VRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 692

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 80/175 (45%), Gaps = 17/175 (9%)

Query: 315 GHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKL 370
           GH   V S  F  + + L +GS D TV +W + T   +    GH   V  + F   G   
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYF 582

Query: 371 ITGSLDRMIRVWNYVTGACVAAYP-----GHSDSVLSVDSYKK--IIVSGSADKTVKVWH 423
            T S D+  R+W     +C   YP     GH + V  V  +     + +GS+DKT ++W 
Sbjct: 583 ATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWD 637

Query: 424 VESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           V +     L  GHT  V ++ + P      +GS+D  I +WDI +   +K  RGH
Sbjct: 638 VSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 692

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 86/183 (46%), Gaps = 14/183 (7%)

Query: 313 FKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQ 368
           +KGH   V  + F+       T S+D T  +W       +R   GH + V  + F  +G 
Sbjct: 563 YKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGC 622

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD--SYKKIIVSGSADKTVKVWHVES 426
            + TGS D+  R+W+  TG  V  + GH+  V+S+      + + +GS D  + VW + +
Sbjct: 623 YVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGT 682

Query: 427 -RTCYTLRGHTE-WVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCV------KVFRGHV 478
            +    +RGH +  + ++    +     SG  D T+R+WD++  T        + F G++
Sbjct: 683 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPSAEPDEPFIGYL 742

Query: 479 GQV 481
           G V
Sbjct: 743 GDV 745

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 9/81 (11%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           ++ F GH   V+S+    + R L TGS D  + +WD+ TGK ++++ GH  G  AIY   
Sbjct: 644 VRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH--GKNAIYSLS 701

Query: 366 ---DGQKLITGSLDRMIRVWN 383
              +G  LI+G  D  +RVW+
Sbjct: 702 YSKEGNVLISGGADHTVRVWD 722

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF--RIVSGAHDKTVKVW 584
           P   +LLS S D T++LW + T   + ++ GH   +WD++         + +HD+T ++W
Sbjct: 535 PDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLW 594

Query: 585 DLQSGKCIHTFDSHQAPITCVGI 607
                  +  F  H   + CV  
Sbjct: 595 SCDHIYPLRIFAGHLNDVDCVSF 617

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 91.3 bits (225), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 130/304 (42%), Gaps = 28/304 (9%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVWNYVTG 387
           LL +  YD T+  W+  TG  +R +      V  +   + +KL+  +  + IR+++  T 
Sbjct: 4   LLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKTS 63

Query: 388 AC--VAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVK 443
               VA++ GH  +V SV   +  K +V+ S D T+KVW + S +      H   V  V 
Sbjct: 64  NSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVV 123

Query: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDP 503
           +HP      S   D  IR+WD+  N C      H    +  +PL  L   +  +   +  
Sbjct: 124 IHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDDVPLQSLSVASDGSMLVAAN 178

Query: 504 PRNEATTAQDPPDGQLSALDDSLPY---PS------------HLLSCSLDNTIKLWEVRT 548
            +      + P     S L  +  +   PS            H+ +CS D+T ++W V  
Sbjct: 179 NKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVED 238

Query: 549 GKCVRTHF-GHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
              + +   GH   +WD A  AD+  +V+ + D  V++WDL +   I  +  H     CV
Sbjct: 239 NFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAVCV 298

Query: 606 GIGD 609
            + D
Sbjct: 299 ALND 302

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 86/227 (37%), Gaps = 62/227 (27%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK--AIYF 365
           +  F+GH   V S+ F  + + + T S D T+ +WD+ +  + R    H   V    I+ 
Sbjct: 68  VASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYK-HNAPVNEVVIHP 126

Query: 366 DGQKLITGSLDRMIRVWNYVTGAC------------------------VAA--------- 392
           +  +LI+   D  IR+W+     C                        VAA         
Sbjct: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVW 186

Query: 393 -YPGHSDS-------------------VLSVDSYKKIIVSGSADKTVKVWHVESRTCY-- 430
             P H+D+                   +LS D   K + + SAD T ++W VE       
Sbjct: 187 EMPNHTDASNLKPATKFKAHPSYITRVLLSSDV--KHMATCSADHTARIWSVEDNFNLES 244

Query: 431 TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           TL GH  WV        S    + S D  +R+WD+ +   ++ + GH
Sbjct: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGH 291

>Scas_721.32
          Length = 822

 Score = 94.4 bits (233), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 123/307 (40%), Gaps = 73/307 (23%)

Query: 313 FKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVR------------------- 351
           F     G+ SLQF  + RL+  G  DS + +W L    L +                   
Sbjct: 483 FHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTS 542

Query: 352 -RLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSY 406
             L GH   V +  F  D + L++GS D+ +R+W+  T   + +Y GH+  V  V     
Sbjct: 543 TTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPL 602

Query: 407 KKIIVSGSADKTVKVWHVESRTCYTLR---GHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
                + S D+T ++W  +    Y LR   GH   V  V  HP     F+GS D T RMW
Sbjct: 603 GHYFATASHDQTARLWSCDH--IYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMW 660

Query: 464 DIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALD 523
           DI +   V++F GH   V             L T  +              PDG+     
Sbjct: 661 DISTGDSVRLFLGHTAPV-------------LCTAVS--------------PDGRW---- 689

Query: 524 DSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI---WDIAADNFRIVSGAHDKT 580
                   L + S D  I LW++ T K ++   GH +          +   +VSG  D +
Sbjct: 690 --------LATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHS 741

Query: 581 VKVWDLQ 587
           V+VWDL+
Sbjct: 742 VRVWDLK 748

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 66/124 (53%), Gaps = 7/124 (5%)

Query: 313 FKGHMDGV--LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV--KAIYFDGQ 368
           F GH+  V  +S   N   +FTGS D T  +WD++TG  VR   GH   V   A+  DG+
Sbjct: 629 FAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGR 688

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHVE 425
            L TGS D +I +W+  T   +    GH  + +   SY K   ++VSG AD +V+VW ++
Sbjct: 689 WLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

Query: 426 SRTC 429
             T 
Sbjct: 749 KSTA 752

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 77/202 (38%), Gaps = 42/202 (20%)

Query: 408 KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
           K I   SAD ++    +   T  TL GH+  V +    P +    SGS+D T+R+W   +
Sbjct: 522 KQIQEKSAD-SINTGDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDT 580

Query: 468 NTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLP 527
            T +  ++GH   V  V                                 Q S      P
Sbjct: 581 YTSLVSYKGHNHPVWDV---------------------------------QFS------P 601

Query: 528 YPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWD 585
              +  + S D T +LW       +R   GH+  +       +   + +G+ DKT ++WD
Sbjct: 602 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWD 661

Query: 586 LQSGKCIHTFDSHQAPITCVGI 607
           + +G  +  F  H AP+ C  +
Sbjct: 662 ISTGDSVRLFLGHTAPVLCTAV 683

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 92.4 bits (228), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 126/275 (45%), Gaps = 27/275 (9%)

Query: 332 TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGAC 389
           TGS D+T+ IWDLA GKL   L GH   V+ I    +   + + S D++++ W+      
Sbjct: 140 TGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTA 199

Query: 390 VAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHP 446
           +  + GH   V +VD +    II +   D  V++W + SR+    L GH   +  VK  P
Sbjct: 200 IRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLP 259

Query: 447 KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTE-NLVTDRTSD--- 502
                 S S D T+R+WDI +    KV   H   ++    LT+   E +  +  T+D   
Sbjct: 260 VDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRD---LTLHPAEFSFASVSTNDVRS 316

Query: 503 ---PPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHF--- 556
              P     T  Q    G L+ +  S+ + + LL+   D T+  ++ +TG   ++     
Sbjct: 317 WKLPEGQLLTNFQSQNTGILNTV--SINHDNVLLAGGDDGTLCFYDYKTGHKYQSMMTTE 374

Query: 557 --GHVEGIWDIAADNF-----RIVSGAHDKTVKVW 584
             G +E    I    F     R+++G  DK++K+W
Sbjct: 375 VAGSLESERSILCSTFDVTGTRLITGEGDKSIKIW 409

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 103/268 (38%), Gaps = 52/268 (19%)

Query: 345 ATGKLVRRLTGHRDGVKAIYFD---GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV- 400
           A  KL + + GH   V+ +  D    +   TGS D  I++W+   G       GH  SV 
Sbjct: 110 APWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVR 169

Query: 401 -LSVDSYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDT 458
            +++      + S S DK VK W +E  T      GH   V TV +HP      +   D 
Sbjct: 170 DIAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDA 229

Query: 459 TIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQ 518
            +R+WDIRS + + V  GH   + KV                                  
Sbjct: 230 VVRLWDIRSRSEIMVLPGHKSPINKV---------------------------------- 255

Query: 519 LSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI----AADNFRIVS 574
                  LP    ++SCS D T++LW++  GK  +    H   I D+    A  +F  VS
Sbjct: 256 -----KCLPVDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRDLTLHPAEFSFASVS 310

Query: 575 GAHDKTVKVWDLQSGKCIHTFDSHQAPI 602
                 V+ W L  G+ +  F S    I
Sbjct: 311 T---NDVRSWKLPEGQLLTNFQSQNTGI 335

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 91/201 (45%), Gaps = 14/201 (6%)

Query: 422 WHVESRTCYTLRGHTEWVGTVKLHPKSFTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
           WH   +    + GHT WV  V + P     F +GS+DTTI++WD+ +        GHV  
Sbjct: 108 WHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMS 167

Query: 481 VQKVL-----PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSH--LL 533
           V+ +      P     +E+ +  +  D  RN   TA     G LS +     +PS   + 
Sbjct: 168 VRDIAISKRHPYMFSASEDKLV-KCWDLERN---TAIRDFHGHLSGVHTVDVHPSLDIIA 223

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKC 591
           +   D  ++LW++R+   +    GH   I  +     + +I+S + D TV++WD+ +GK 
Sbjct: 224 TAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDATVRLWDIIAGKA 283

Query: 592 IHTFDSHQAPITCVGIGDSEF 612
                 H   I  + +  +EF
Sbjct: 284 SKVLTHHSRNIRDLTLHPAEF 304

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 12/98 (12%)

Query: 310 IQEFKGHMDGVL-SLQFNY-RLLFTGSYDSTVAIWDLATGK-----LVRRLTGHRDGVKA 362
           +  F+    G+L ++  N+  +L  G  D T+  +D  TG      +   + G  +  ++
Sbjct: 325 LTNFQSQNTGILNTVSINHDNVLLAGGDDGTLCFYDYKTGHKYQSMMTTEVAGSLESERS 384

Query: 363 IY---FD--GQKLITGSLDRMIRVWNYVTGACVAAYPG 395
           I    FD  G +LITG  D+ I++W  V  A    +PG
Sbjct: 385 ILCSTFDVTGTRLITGEGDKSIKIWKQVPDATEDTFPG 422

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 83/318 (26%), Positives = 140/318 (44%), Gaps = 67/318 (21%)

Query: 326 NYRLLFTGSYDSTVAIWDLATGKLVRRL-----TGHRDG---------VKAIYF--DGQK 369
           N   L TG  + T  I+++ATG LV  L     TG  D          ++++ F  DG+ 
Sbjct: 329 NGEYLATGC-NKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKF 387

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVESR 427
           L TG+ D++IR+W+      V    GH   + S+D ++    +VSGS D+T+++W + + 
Sbjct: 388 LATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTG 447

Query: 428 TCYTLRGHTEWVGTVKLHPKSFT-CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLP 486
            C       + V TV + P +     +GS D T+R+WD  SN+   V R           
Sbjct: 448 QCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWD--SNSGFLVER----------- 494

Query: 487 LTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV 546
              LD+E      T    ++   +     DG+            +++S SLD ++KLW +
Sbjct: 495 ---LDSEG----ETGVGHKDSVYSVVFTRDGK------------NIVSGSLDRSVKLWNL 535

Query: 547 RT-------------GKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVWDLQSGKC 591
           R              G C  T+ GH + +  +    ++  I+SG+ D+ V  WD  SG  
Sbjct: 536 RNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVP 595

Query: 592 IHTFDSHQAPITCVGIGD 609
           +     H+  +  V + +
Sbjct: 596 LLMLQGHRNSVISVAVAN 613

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 72/178 (40%), Gaps = 45/178 (25%)

Query: 438 WVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVT 497
           ++ +V   P      +G++D  IR+WDI     V V RGH    Q +  L    + N   
Sbjct: 375 YIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHE---QDIYSLDYFQSGN--- 428

Query: 498 DRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFG 557
                                             L+S S D TI++W++ TG+C  T   
Sbjct: 429 ---------------------------------KLVSGSGDRTIRIWDLHTGQCSLT-LS 454

Query: 558 HVEGIWDIA---ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEF 612
             +G+  +A    +   + +G+ D+TV+VWD  SG  +   DS     T VG  DS +
Sbjct: 455 IEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGE--TGVGHKDSVY 510

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 51/96 (53%), Gaps = 5/96 (5%)

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVKVW 584
           P    L + + D  I++W++   K V    GH + I+  D      ++VSG+ D+T+++W
Sbjct: 383 PDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIW 442

Query: 585 DLQSGKCIHTFDSHQAPITCVGI--GDSEFVSGDEL 618
           DL +G+C  T  S +  +T V +  G+  +V+   L
Sbjct: 443 DLHTGQCSLTL-SIEDGVTTVAVSPGNGNYVAAGSL 477

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 120/262 (45%), Gaps = 46/262 (17%)

Query: 360 VKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK--IIVSGSA 415
           ++++ F  DG+ L TG+ D++IR+W+  T   +    GH   + S+D +     +VSGS 
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 414

Query: 416 DKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCF-SGSDDTTIRMWDIRSNTCVKVF 474
           D+TV++W + +  C       + V TV + P       +GS D T+R+WD  S T   V 
Sbjct: 415 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD--SETGFLVE 472

Query: 475 RGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLS 534
           R              LD+EN ++    D   +   T     DGQ             ++S
Sbjct: 473 R--------------LDSENELSTGHKDSVYSVVFTR----DGQ------------GVIS 502

Query: 535 CSLDNTIKLWEVRT-------GKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVWD 585
            SLD ++KLW++R          C  T+ GH + +  +A   D+  I+SG+ D+ V  WD
Sbjct: 503 GSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWD 562

Query: 586 LQSGKCIHTFDSHQAPITCVGI 607
             SG  +     H+  +  V +
Sbjct: 563 TASGNPLLMLQGHRNSVISVAV 584

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 117/296 (39%), Gaps = 90/296 (30%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YFD-GQKLITGSLDRMIRVWNYV 385
           + L TG+ D  + IWDL T K++  L GH   + ++ YF  G KL++GS DR +R+W+  
Sbjct: 365 KYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLR 424

Query: 386 TGAC------------VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR 433
           TG C            VA  PG            K I +GS D+TV+VW  +S T + + 
Sbjct: 425 TGQCSLTLSIEDGVTTVAVSPGDG----------KYIAAGSLDRTVRVW--DSETGFLVE 472

Query: 434 ----------GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS-------NTCVKVFRG 476
                     GH + V +V          SGS D ++++WD+R         TC   + G
Sbjct: 473 RLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTG 532

Query: 477 HVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCS 536
           H   V  V                       ATT  D                 ++LS S
Sbjct: 533 HKDFVLSV-----------------------ATTQDD----------------EYILSGS 553

Query: 537 LDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADN-FRI-------VSGAHDKTVKVW 584
            D  +  W+  +G  +    GH   +  +A  N F +        +G+ D   ++W
Sbjct: 554 KDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 100/224 (44%), Gaps = 57/224 (25%)

Query: 408 KIIVSGSADKTVKVWHVESR-TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIR 466
           K + +G+ DK +++W + ++    TL+GH + + ++   P      SGS D T+R+WD+R
Sbjct: 365 KYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLR 424

Query: 467 SNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSL 526
           +  C              L L+I   E+ VT           T A  P DG+        
Sbjct: 425 TGQC-------------SLTLSI---EDGVT-----------TVAVSPGDGK-------- 449

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCV-------RTHFGHVEGIWDIA--ADNFRIVSGAH 577
               ++ + SLD T+++W+  TG  V           GH + ++ +    D   ++SG+ 
Sbjct: 450 ----YIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSL 505

Query: 578 DKTVKVWDLQS-------GKCIHTFDSHQAPITCVGIG-DSEFV 613
           D++VK+WDL+          C  T+  H+  +  V    D E++
Sbjct: 506 DRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYI 549

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 58/98 (59%), Gaps = 9/98 (9%)

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF----RIVSGAHDKTVK 582
           P   +L + + D  I++W++ T K + T  GH + I+ +  D F    ++VSG+ D+TV+
Sbjct: 362 PDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSL--DYFPAGDKLVSGSGDRTVR 419

Query: 583 VWDLQSGKCIHTFDSHQAPITCVGI--GDSEFVSGDEL 618
           +WDL++G+C  T  S +  +T V +  GD ++++   L
Sbjct: 420 IWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSL 456

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 10/82 (12%)

Query: 313 FKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF----- 365
           + GH D VLS+        + +GS D  V  WD A+G  +  L GHR+ V ++       
Sbjct: 530 YTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFP 589

Query: 366 ---DGQKLITGSLDRMIRVWNY 384
              D     TGS D   R+W Y
Sbjct: 590 LGPDVGVFATGSGDCKARIWKY 611

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 89.7 bits (221), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/190 (31%), Positives = 90/190 (47%), Gaps = 18/190 (9%)

Query: 313 FKGHMDGVLSLQFNY---RLLFTGSYDSTVAIWDLAT-----GKLVRRLTGHRDGVK--A 362
            +GH   V SL  +     LL + S D T+  W L       G  VR   GH   V+   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 363 IYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVK 420
           +  DG   ++ S D+ +R+W+  TG     + GH   V+SVD  KK  +I+SGS DKT+K
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIK 132

Query: 421 VWHVESRTCYTLRGHTEWVGTVKLHPK------SFTCFSGSDDTTIRMWDIRSNTCVKVF 474
           VW ++ +   TL GH +WV  V++ P       S T  S  +D  ++ W++        F
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 475 RGHVGQVQKV 484
            GH   +  +
Sbjct: 193 IGHNSNINTL 202

 Score = 76.6 bits (187), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 111/270 (41%), Gaps = 39/270 (14%)

Query: 310 IQEFKGH----MDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF 365
           ++ FKGH     D  L+    Y L  + S+D T+ +WD+ATG+  +R  GH+  V ++  
Sbjct: 58  VRSFKGHSHIVQDCTLTADGAYAL--SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDI 115

Query: 366 D--GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--------DSYKKIIVSGSA 415
           D     +I+GS D+ I+VW  + G C+A   GH+D V  V        D     I+S   
Sbjct: 116 DKKASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGN 174

Query: 416 DKTVKVWHV-ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVF 474
           DK VK W++ + +      GH   + T+   P      S   D  I +W++ +   +   
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 475 RGH---------------VGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQL 519
                                    + +  LD + LV D    P     + A +P    L
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLR--PEFAGYSKAAEPHAVSL 292

Query: 520 SALDDSLPYPSHLLSCSLDNTIKLWEVRTG 549
           +   D       L +   DN I++W+V T 
Sbjct: 293 AWSADG----QTLFAGYTDNVIRVWQVMTA 318

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 85/228 (37%), Gaps = 57/228 (25%)

Query: 395 GHSDSVLSVDSYK---KIIVSGSADKTVKVWHVESRT------CYTLRGHTEWVGTVKLH 445
           GH+  V S+ +      +++S S DKT+  W +            + +GH+  V    L 
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLT 74

Query: 446 PKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPR 505
                  S S D T+R+WD+ +    + F GH   V  V                     
Sbjct: 75  ADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV--------------------- 113

Query: 506 NEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI 565
                             D     S ++S S D TIK+W ++ G+C+ T  GH + +  +
Sbjct: 114 ------------------DIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQV 154

Query: 566 AA--------DNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
                     D+  I+S  +DK VK W+L   +    F  H + I  +
Sbjct: 155 RVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTL 202

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 3/91 (3%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVKVWDLQ 587
           ++ LS S D T++LW+V TG+  +   GH   +   DI      I+SG+ DKT+KVW ++
Sbjct: 78  AYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK 137

Query: 588 SGKCIHTFDSHQAPITCVGIGDSEFVSGDEL 618
            G+C+ T   H   ++ V +  +E    D +
Sbjct: 138 -GQCLATLLGHNDWVSQVRVVPNEKADDDSV 167

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 7/99 (7%)

Query: 516 DGQLSALDDSLPYPSHLLSCSLDNTIKLWEV-----RTGKCVRTHFGHVEGIWD--IAAD 568
           +G +++L  S   P+ LLS S D T+  W++     + G  VR+  GH   + D  + AD
Sbjct: 17  NGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTAD 76

Query: 569 NFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
               +S + DKT+++WD+ +G+    F  H++ +  V I
Sbjct: 77  GAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDI 115

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 105/266 (39%), Gaps = 48/266 (18%)

Query: 345 ATGKLVRRLTGHRDGVKAIY---FDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV- 400
           A  KL+R + GH   V+ +     D +   TGS D  I++W+  TG       GH  +V 
Sbjct: 117 APWKLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVK 176

Query: 401 -LSVDSYKKIIVSGSADKTVKVWHVE-SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDT 458
            + +      + S S DK VK W +E +R      GH   V TV +HP      +   D+
Sbjct: 177 DICISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDS 236

Query: 459 TIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQ 518
            +R+WDIR+   V    GH   + +V                                  
Sbjct: 237 VVRLWDIRTKLPVMTMAGHKSPINRV---------------------------------- 262

Query: 519 LSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAAD--NFRIVSGA 576
                  LP    ++SCS D T++LW++  GK ++    H   + DI      F I S  
Sbjct: 263 -----KCLPVDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPGEFSISSAC 317

Query: 577 HDKTVKVWDLQSGKCIHTFDSHQAPI 602
            D  ++ W L  G+ +  F S +  I
Sbjct: 318 TDD-IRSWKLPEGQLLTNFQSEKTGI 342

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 124/275 (45%), Gaps = 27/275 (9%)

Query: 332 TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGAC 389
           TGS D+T+ IWDLATGKL   L+GH   VK I    +   + + S D++++ W+      
Sbjct: 147 TGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEKNRV 206

Query: 390 VAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHP 446
           +  Y GH   V +VD +    +I +   D  V++W + ++    T+ GH   +  VK  P
Sbjct: 207 IRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLP 266

Query: 447 KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD---- 502
                 S S D T+R+WDI +   +KV   H   V+ +    I   E  ++   +D    
Sbjct: 267 VDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDI---GIHPGEFSISSACTDDIRS 323

Query: 503 ---PPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVR----TH 555
              P     T  Q    G ++ L  S+     L + S +  +  ++ +TG   +    T 
Sbjct: 324 WKLPEGQLLTNFQSEKTGIINTL--SINQDDVLFAGSDNGVLSFYDYKTGHKYQQLDTTE 381

Query: 556 F-GHVEGIWDIAADNF-----RIVSGAHDKTVKVW 584
             G +E    I    F     R+++G  DK++K+W
Sbjct: 382 IPGSLESERGILTSTFDQTGLRLITGESDKSIKIW 416

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 93/201 (46%), Gaps = 14/201 (6%)

Query: 422 WHVESRTCYTLRGHTEWVGTVKLHPKSFTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
           WH   +    + GH  WV TV + P     F +GS+DTTI++WD+ +        GH+  
Sbjct: 115 WHAPWKLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMT 174

Query: 481 VQKVL-----PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALD--DSLPYPSHLL 533
           V+ +      P     +E+ +  +  D  +N          G LS +   D  P  + + 
Sbjct: 175 VKDICISKRHPYMFSASEDKLV-KCWDLEKNRVIRDYH---GHLSGVHTVDIHPTLNLIA 230

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKC 591
           +   D+ ++LW++RT   V T  GH   I  +     + ++VS + D TV++WD+ +GK 
Sbjct: 231 TAGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLPVDPQVVSCSADATVRLWDITAGKT 290

Query: 592 IHTFDSHQAPITCVGIGDSEF 612
           +     H+  +  +GI   EF
Sbjct: 291 LKVLTHHKRSVRDIGIHPGEF 311

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 85/201 (42%), Gaps = 21/201 (10%)

Query: 292 IYRERFKVESN------WRKGTAHIQ-EFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIW 342
           I  E F   SN      W   T  ++    GH+  V  +  + R   +F+ S D  V  W
Sbjct: 140 IDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCW 199

Query: 343 DLATGKLVRRLTGHRDGVKA--IYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV 400
           DL   +++R   GH  GV    I+     + T   D ++R+W+  T   V    GH   +
Sbjct: 200 DLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHKSPI 259

Query: 401 -----LSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSG 454
                L VD     +VS SAD TV++W + + +T   L  H   V  + +HP  F+  S 
Sbjct: 260 NRVKCLPVDPQ---VVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPGEFSISSA 316

Query: 455 SDDTTIRMWDIRSNTCVKVFR 475
             D  IR W +     +  F+
Sbjct: 317 CTD-DIRSWKLPEGQLLTNFQ 336

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 12/98 (12%)

Query: 310 IQEFKGHMDGVL-SLQFNYR-LLFTGSYDSTVAIWDLATGKLVRRLTG--------HRDG 359
           +  F+    G++ +L  N   +LF GS +  ++ +D  TG   ++L             G
Sbjct: 332 LTNFQSEKTGIINTLSINQDDVLFAGSDNGVLSFYDYKTGHKYQQLDTTEIPGSLESERG 391

Query: 360 VKAIYFD--GQKLITGSLDRMIRVWNYVTGACVAAYPG 395
           +    FD  G +LITG  D+ I++W     A    Y G
Sbjct: 392 ILTSTFDQTGLRLITGESDKSIKIWKQDQDATPETYTG 429

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 91/198 (45%), Gaps = 24/198 (12%)

Query: 313 FKGHMDGVLSLQFNY---RLLFTGSYDSTVAIWDLAT-----GKLVRRLTGHRDGVKAIY 364
            +GH   V SL  +     LL +GS D T+  W L       G  VR   GH   V+ + 
Sbjct: 14  LEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVV 73

Query: 365 F--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVK 420
              DG   ++ S D+ +R+WN  TG   A + GH+  VLSV  D+    I+S S DKT++
Sbjct: 74  VSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIR 133

Query: 421 VWHVESRTCYTLRGHTEWVGTVKLHPKSF----------TCFSGSDDTTIRMWDIRSNT- 469
           VW+      Y L GHT+WV  V++ PK+           T  S   D  +R W +  ++ 
Sbjct: 134 VWNTVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSY 193

Query: 470 -CVKVFRGHVGQVQKVLP 486
                F GH   +  V P
Sbjct: 194 RIEADFIGHNNYINVVQP 211

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 110/279 (39%), Gaps = 49/279 (17%)

Query: 310 IQEFKGH----MDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF 365
           ++ +KGH     D V+S   NY +  + S+D T+ +W+LATG    R  GH   V ++  
Sbjct: 59  VRSYKGHSHIVQDVVVSADGNYAV--SASWDKTLRLWNLATGNSEARFVGHTGDVLSVAI 116

Query: 366 DGQ--KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVL------------SVDSYKKIIV 411
           D    K+I+ S D+ IRVWN V G C     GH+D V              VD  +   V
Sbjct: 117 DANSSKIISASRDKTIRVWNTV-GDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFV 175

Query: 412 SGSADKTVKVWHVES---RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN 468
           S   DK V+ W +     R      GH  ++  V+  P      S   D  I +W+++  
Sbjct: 176 SAGMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHK 235

Query: 469 TCVKVFRGHVGQVQKVLPLT-----------------ILDTENLVTDRTSDPPRNEATTA 511
           +    F        +V  L                  I D EN V      P     T A
Sbjct: 236 SAFMNFDAK----DEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKA 291

Query: 512 QDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGK 550
           QDP    L+   D       L +   DN I++W+V T  
Sbjct: 292 QDPHAVSLAWSADG----QTLFAGYTDNVIRVWQVMTAN 326

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 73/194 (37%), Gaps = 48/194 (24%)

Query: 431 TLRGHTEWVGTVKLHPKSFTCF-SGSDDTTIRMWDIRSN-----TCVKVFRGHVGQVQKV 484
           TL GH  WV ++           SGS D T+  W +  N       V+ ++GH   VQ V
Sbjct: 13  TLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDV 72

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
           +                              DG             + +S S D T++LW
Sbjct: 73  VV---------------------------SADGN------------YAVSASWDKTLRLW 93

Query: 545 EVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPI 602
            + TG       GH   +  +A  A++ +I+S + DKT++VW+   G C +    H   +
Sbjct: 94  NLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWN-TVGDCAYVLLGHTDWV 152

Query: 603 TCVGIGDSEFVSGD 616
           T V +       G+
Sbjct: 153 TKVRVAPKNLEDGE 166

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 93/199 (46%), Gaps = 27/199 (13%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           +   KGH   + SL +  +   L +GS D TV IWDL TG     L+   DGV  +    
Sbjct: 441 VMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLS-IEDGVTTVAVSP 499

Query: 366 -DGQKLITGSLDRMIRVWNYVTGACVAAY-------PGHSDSVLSVDSYK--KIIVSGSA 415
            +G+ +  GSLDR +RVW+  TG  V           GH DSV SV   +  K +VSGS 
Sbjct: 500 GEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSL 559

Query: 416 DKTVKVW----------HVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           D++VK+W          H E    YT  GH ++V +V          SGS D  +  WD 
Sbjct: 560 DRSVKLWNLNGLSGQKSHAECEVTYT--GHKDFVLSVATTQNDEYILSGSKDRGVLFWDT 617

Query: 466 RSNTCVKVFRGHVGQVQKV 484
           +S   + + +GH   V  V
Sbjct: 618 KSGNPLLMLQGHRNSVISV 636

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 122/264 (46%), Gaps = 46/264 (17%)

Query: 360 VKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIVSGSA 415
           ++++ F  DG+ L TG+ D++IR+W+  T   V    GH   + S+D +     +VSGS 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSG 468

Query: 416 DKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFS-GSDDTTIRMWDIRSNTCVKVF 474
           D+TV++W + + TC       + V TV + P      + GS D T+R+WD  S+T   V 
Sbjct: 469 DRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWD--SDTGFLVE 526

Query: 475 RGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLS 534
           R              LD+EN +     D   +   T     DG+             ++S
Sbjct: 527 R--------------LDSENELGTGHRDSVYSVVFTR----DGK------------GVVS 556

Query: 535 CSLDNTIKLWEVRT-------GKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVWD 585
            SLD ++KLW +          +C  T+ GH + +  +A   ++  I+SG+ D+ V  WD
Sbjct: 557 GSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 616

Query: 586 LQSGKCIHTFDSHQAPITCVGIGD 609
            +SG  +     H+  +  V + +
Sbjct: 617 TKSGNPLLMLQGHRNSVISVTVAN 640

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 53/96 (55%), Gaps = 5/96 (5%)

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVKVW 584
           P    L + + D  I++W++ T K V T  GH + I+  D      ++VSG+ D+TV++W
Sbjct: 416 PDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIW 475

Query: 585 DLQSGKCIHTFDSHQAPITCVGI--GDSEFVSGDEL 618
           DL +G C  T  S +  +T V +  G+ +F++   L
Sbjct: 476 DLTTGTCSLTL-SIEDGVTTVAVSPGEGKFIAAGSL 510

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/240 (20%), Positives = 90/240 (37%), Gaps = 49/240 (20%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE 425
           DG+ L TG  ++  +V+   TG  VA     S S        + + + ++         E
Sbjct: 332 DGEFLATG-CNKTTQVYKVSTGELVARLSDDSASQPQPQPQNQTVTAETSTSNSNGSSAE 390

Query: 426 SRT-----CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
             T       +      ++ +V   P      +G++D  IR+WD+ +   V   +GH   
Sbjct: 391 DGTGNQNSAASTASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQD 450

Query: 481 VQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNT 540
           +  +                                       D  P  + L+S S D T
Sbjct: 451 IYSL---------------------------------------DYFPSGNKLVSGSGDRT 471

Query: 541 IKLWEVRTGKCVRTHFGHVEGIWDIA---ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDS 597
           +++W++ TG C  T     +G+  +A    +   I +G+ D+TV+VWD  +G  +   DS
Sbjct: 472 VRIWDLTTGTCSLT-LSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDS 530

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 119/282 (42%), Gaps = 64/282 (22%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRL-------------TGHRDGVKAIYF--DGQKLITG 373
           L   G  DS + +W L    L  +L              GH   V +  F  D + L++ 
Sbjct: 435 LAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSA 494

Query: 374 SLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCYT 431
           S D+ +R+W+  T + + +Y GH+  V  +S         + S D+T ++W  +    Y 
Sbjct: 495 SEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH--IYP 552

Query: 432 LR---GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLT 488
           LR   GH   V  V  HP     F+GS D T RMWDI +   V++F GH   V       
Sbjct: 553 LRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPV------- 605

Query: 489 ILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRT 548
                               +TA   PDG+             L + S D  I +W++ T
Sbjct: 606 -------------------ISTAVS-PDGRW------------LSTGSEDGIINVWDIGT 633

Query: 549 GKCVRTHFGHVE-GIWDI--AADNFRIVSGAHDKTVKVWDLQ 587
           GK ++   GH +  ++ +  + +   +VSG  D +V+VWDL+
Sbjct: 634 GKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 67/124 (54%), Gaps = 7/124 (5%)

Query: 313 FKGHMDGV--LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV--KAIYFDGQ 368
           F GH++ V  +S   N   +FTGS D T  +WD+ TG  VR   GH   V   A+  DG+
Sbjct: 556 FAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGR 615

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHVE 425
            L TGS D +I VW+  TG  +    GH  + +   SY K   ++VSG AD +V+VW ++
Sbjct: 616 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

Query: 426 SRTC 429
             T 
Sbjct: 676 RSTA 679

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 77/175 (44%), Gaps = 17/175 (9%)

Query: 315 GHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKL 370
           GH   V S  F  + + L + S D TV +W + T   +    GH   V  + F   G   
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYF 533

Query: 371 ITGSLDRMIRVWNYVTGACVAAYP-----GHSDSV--LSVDSYKKIIVSGSADKTVKVWH 423
            T S D+  R+W     +C   YP     GH + V  +S       + +GS DKT ++W 
Sbjct: 534 ATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWD 588

Query: 424 VESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           + +     L  GHT  V +  + P      +GS+D  I +WDI +   +K  RGH
Sbjct: 589 IGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 643

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 84/209 (40%), Gaps = 44/209 (21%)

Query: 395 GHSDSVLSVDSY--KKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTC 451
           GHS +V S       K ++S S DKTV++W +++  +  + +GH   V  V   P     
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYF 533

Query: 452 FSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTA 511
            + S D T R+W       +++F GH+  V  V                           
Sbjct: 534 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDCV--------------------------- 566

Query: 512 QDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAA--DN 569
              P+G            +++ + S D T ++W++ TG  VR   GH   +   A   D 
Sbjct: 567 SFHPNG------------TYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDG 614

Query: 570 FRIVSGAHDKTVKVWDLQSGKCIHTFDSH 598
             + +G+ D  + VWD+ +GK +     H
Sbjct: 615 RWLSTGSEDGIINVWDIGTGKRLKQMRGH 643

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/215 (19%), Positives = 75/215 (34%), Gaps = 55/215 (25%)

Query: 409 IIVSGSADKTVKVWHV--------------ESRTCYTLRGHTEWVGTVKLHPKSFTCFSG 454
           +  +G  D  +K+W +              E     TL GH+  V +    P +    S 
Sbjct: 435 LAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSA 494

Query: 455 SDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDP 514
           S+D T+R+W + + + +  ++GH   V  V                              
Sbjct: 495 SEDKTVRLWSMDTYSSLVSYKGHNHPVWDV------------------------------ 524

Query: 515 PDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRI 572
                       P   +  + S D T +LW       +R   GH+  +       +   +
Sbjct: 525 ---------SFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYV 575

Query: 573 VSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
            +G+ DKT ++WD+ +G  +  F  H AP+    +
Sbjct: 576 FTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAV 610

>Scas_629.12
          Length = 671

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 92/202 (45%), Gaps = 31/202 (15%)

Query: 313 FKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF---DG 367
            KGH   V SL +  N   L +GS D TV IWDL TG+    L+    GV  +     DG
Sbjct: 425 LKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEY-GVTTVAVSPNDG 483

Query: 368 QKLITGSLDRMIRVWNYVTGACVAAY-------PGHSDSVLSVDSYK--KIIVSGSADKT 418
           + +  GSLDR +RVW+  TG  V           GH DSV SV   +    +VSGS DKT
Sbjct: 484 KFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKT 543

Query: 419 VKVWHVE---------------SRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
           VK+W++                S TC  T  GH ++V +V          SGS D  I  
Sbjct: 544 VKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILF 603

Query: 463 WDIRSNTCVKVFRGHVGQVQKV 484
           WD  S   + + +GH   V  V
Sbjct: 604 WDKESGNPLLMLQGHRNSVISV 625

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 81/169 (47%), Gaps = 33/169 (19%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRL-------TGHRDGVKAIYF--DGQKLITGSLDRM 378
           + +  GS D  V +WD  TG LV RL       TGHRD V ++ F  DG ++++GSLD+ 
Sbjct: 484 KFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKT 543

Query: 379 IRVWNY---------------VTGACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKV 421
           +++WN                 +  C   Y GH D VLSV + +  K I+SGS D+ +  
Sbjct: 544 VKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILF 603

Query: 422 WHVES-RTCYTLRGHTEWVGTV------KLHPKSFTCFSGSDDTTIRMW 463
           W  ES      L+GH   V +V       L PK     +GS D   R+W
Sbjct: 604 WDKESGNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 119/272 (43%), Gaps = 54/272 (19%)

Query: 360 VKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIVSGSA 415
           ++++ F  DG+ L TG+ D++IR+W+      V    GH   V S+D +   + +VSGS 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSG 449

Query: 416 DKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCF-SGSDDTTIRMWDIRSNTCVKVF 474
           D+TV++W + +  C         V TV + P       +GS D  +R+WD  S T   V 
Sbjct: 450 DRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWD--STTGFLVE 507

Query: 475 RGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLS 534
           R              LD+EN +     D   +   T     DG            + ++S
Sbjct: 508 R--------------LDSENELGTGHRDSVYSVVFTR----DG------------NEVVS 537

Query: 535 CSLDNTIKLWEVR---------------TGKCVRTHFGHVEGIWDI--AADNFRIVSGAH 577
            SLD T+KLW +R               +  C  T+ GH + +  +  + D+  I+SG+ 
Sbjct: 538 GSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSK 597

Query: 578 DKTVKVWDLQSGKCIHTFDSHQAPITCVGIGD 609
           D+ +  WD +SG  +     H+  +  V + +
Sbjct: 598 DRGILFWDKESGNPLLMLQGHRNSVISVAVAN 629

 Score = 81.3 bits (199), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 120/279 (43%), Gaps = 46/279 (16%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YF-DGQKLITGSLDRMIRVWNYV 385
             L TG+ D  + IWD+   K+V  L GH   V ++ YF +G+KL++GS DR +R+W+  
Sbjct: 400 EFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLR 459

Query: 386 TGAC---VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR--------- 433
           TG C   ++   G +   +S +   K I +GS D+ V+VW  +S T + +          
Sbjct: 460 TGQCSLTLSIEYGVTTVAVSPND-GKFIAAGSLDRAVRVW--DSTTGFLVERLDSENELG 516

Query: 434 -GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDT 492
            GH + V +V          SGS D T+++W++R +          G       +T +  
Sbjct: 517 TGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGH 576

Query: 493 ENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCV 552
           ++ V            TT+QD                 ++LS S D  I  W+  +G  +
Sbjct: 577 KDFVL---------SVTTSQD---------------DKYILSGSKDRGILFWDKESGNPL 612

Query: 553 RTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKC 591
               GH   +  +A  N   +   ++    V+   SG C
Sbjct: 613 LMLQGHRNSVISVAVANGSALGPKYN----VFATGSGDC 647

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 94/236 (39%), Gaps = 65/236 (27%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE 425
           DGQ L TG  ++  +++    G  +A      DSV S D+      SGS   T    ++ 
Sbjct: 339 DGQFLATG-CNKTTQIYRVSDGELIAKL--SDDSVTSPDTSSA--TSGSTPSTD--LYIR 391

Query: 426 SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVL 485
           S  C++  G  E++ T            G++D  IR+WDI+    V V +GH   V  + 
Sbjct: 392 S-VCFSPDG--EFLAT------------GAEDKLIRIWDIQERKIVMVLKGHEQDVYSL- 435

Query: 486 PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWE 545
                                                 D  P    L+S S D T+++W+
Sbjct: 436 --------------------------------------DYFPNGEKLVSGSGDRTVRIWD 457

Query: 546 VRTGKCVRTHFGHVEGIWDIAA---DNFRIVSGAHDKTVKVWDLQSGKCIHTFDSH 598
           +RTG+C  T      G+  +A    D   I +G+ D+ V+VWD  +G  +   DS 
Sbjct: 458 LRTGQCSLT-LSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSE 512

>Scas_695.15
          Length = 327

 Score = 85.5 bits (210), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 126/303 (41%), Gaps = 22/303 (7%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVWNYVTG 387
           +L +  YD T+  W+  TG   R +      V  +   + +KL+  +  + +R+++  T 
Sbjct: 24  ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDIRTT 83

Query: 388 A--CVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVK 443
               VA + GH  +V SV   +  K +V+ S D T+KVW V S +      H   V  V 
Sbjct: 84  NPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 143

Query: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVF-----RGHVGQVQKVLPLTILDTENLVTD 498
           +HP      S   D TI++WD+  N C            +  +      ++L   N   D
Sbjct: 144 IHPNQGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGD 203

Query: 499 RTSDPPRNEATTAQDPPDGQLSALDDSLPYP------SHLLSCSLDNTIKLWEVRTGK-- 550
                  N    +   P  + SA  D +          H+ +CS D T K+W V   +  
Sbjct: 204 CYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDD 263

Query: 551 --CVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVG 606
                T  GH   +WD A  AD+  +V+ + D  V++WDL + + +  +  H     CV 
Sbjct: 264 FNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 323

Query: 607 IGD 609
           + D
Sbjct: 324 LND 326

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 87.8 bits (216), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 124/281 (44%), Gaps = 55/281 (19%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTG 387
           + T  Y   V +W+  T   VR +      V+A  F  +K  +I GS D  IRV+NY TG
Sbjct: 28  VLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTG 87

Query: 388 ACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCY--TLRGHTEWVGTVK 443
             V  +  H D +  ++V   K  ++SGS D TVK+W+ E+      T  GH  +V  V 
Sbjct: 88  EKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVA 147

Query: 444 LHPKSFTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD 502
            +PK  + F SG  D T+++W +  +T                                 
Sbjct: 148 FNPKDPSTFASGCLDRTVKVWSLGQST--------------------------------- 174

Query: 503 PPRNEATTAQDPPDGQLSALDDSLPYPS--HLLSCSLDNTIKLWEVRTGKCVRTHFGHVE 560
            P    TT Q+     +    D  P P   ++++ S D TIK+W+ +T  CV T  GH+ 
Sbjct: 175 -PNFTLTTGQERGVNYV----DYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMS 229

Query: 561 GIWDIAADNFR-----IVSGAHDKTVKVWDLQSGKCIHTFD 596
              +++   F      I+SG+ D T+K+W+  + K   T +
Sbjct: 230 ---NVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLN 267

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 64/132 (48%), Gaps = 10/132 (7%)

Query: 302 NWRKGTAHIQEFKGHMDGVLSLQFNYR---LLFTGSYDSTVAIWDLATGKLVRRLT-GHR 357
           NW    A  Q F+GH   V+ + FN +      +G  D TV +W L        LT G  
Sbjct: 125 NWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQE 184

Query: 358 DGVKAIYF----DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK--IIV 411
            GV  + +    D   +IT S D  I++W+Y T +CVA   GH  +V     +    II+
Sbjct: 185 RGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIII 244

Query: 412 SGSADKTVKVWH 423
           SGS D T+K+W+
Sbjct: 245 SGSEDGTLKIWN 256

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 84.7 bits (208), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 121/304 (39%), Gaps = 28/304 (9%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRM-IRVWNYVTG 387
           +L +  YD T+  W+  TG   R +      V  +     K    +   + +R+++  + 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKKYLAAAGHLHVRLYDIRSN 63

Query: 388 AC--VAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVK 443
               V+++ GH  +V S+      + +VS S D T+KVW V S +      H   V  V 
Sbjct: 64  NPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVA 123

Query: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDP 503
           +HP      S   D  IR+WD+  N C           +   PL  L   +  +   +  
Sbjct: 124 IHPNQGELISCDQDGNIRIWDLGENQCTNQLTP-----EDNTPLQSLSVASDGSMLVAGN 178

Query: 504 PRNEATTAQDPPDGQLSALDDSLPYPS---------------HLLSCSLDNTIKLWEVRT 548
            +      + P     S L+    + S               HL +CS D+T ++W +  
Sbjct: 179 NKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIED 238

Query: 549 GKCVRTHF-GHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
              + T   GH   +WD A  AD+  +V+   D  V++WDL + + +  +  H     CV
Sbjct: 239 NFELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAVCV 298

Query: 606 GIGD 609
            + D
Sbjct: 299 ALND 302

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 85/225 (37%), Gaps = 58/225 (25%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK--AIYF 365
           +  F+GH   V S+ F    R + + S D T+ +WD+ +   V+R   H   V   AI+ 
Sbjct: 68  VSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPS-VQRNYKHNAPVNEVAIHP 126

Query: 366 DGQKLITGSLDRMIRVWNYVTGAC----------------------------------VA 391
           +  +LI+   D  IR+W+     C                                  V 
Sbjct: 127 NQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVW 186

Query: 392 AYPGHSDS-----VLSVDSYKKII------------VSGSADKTVKVWHVESRTCY--TL 432
             P H+D+     V    S+ K I             + SAD T +VW++E       TL
Sbjct: 187 KMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTL 246

Query: 433 RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
            GH  WV        S    +   D  +R+WD+ ++  V+ + GH
Sbjct: 247 DGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGH 291

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/342 (21%), Positives = 138/342 (40%), Gaps = 81/342 (23%)

Query: 286 TRPWKVIYRERFKVES-NWRKGTAHIQEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIW 342
           +RPW ++      ++  ++R GT  +  F+GH   V ++ F+    +  +   D+++ +W
Sbjct: 22  SRPWALVALFSSTIQLWDYRMGTL-LHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVW 80

Query: 343 DLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSV 400
            L T + +  LTGH D V+ ++F  +   +I+ S D+ +R+WN+     +A   GH+  V
Sbjct: 81  SLETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFV 140

Query: 401 LSVDSYK--KIIVSGSADKTVKVWHV-------------------------------ESR 427
           +    ++   ++VS S D+TV+VW +                               + +
Sbjct: 141 MCAQFHQTEDLVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCK 200

Query: 428 TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC--VKVFRGHVGQVQKVL 485
             + L GHT  V     HP      +G DD  +++W + SN    V   RGH   V  V+
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVV 260

Query: 486 PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWE 545
                                        PD  L            +LS + D T+++W+
Sbjct: 261 F---------------------------HPDQNL------------ILSVAEDKTLRIWD 281

Query: 546 VRTGKCVRTHFGHVEGIWDIAAD-NFRIVSGAHDKTVKVWDL 586
           +     V+      +  W I +  N  +   AHD  + ++ L
Sbjct: 282 LDKRTPVKQFKRENDRFWLIRSHPNMSLFGAAHDSGIMIFKL 323

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 121/290 (41%), Gaps = 42/290 (14%)

Query: 348 KLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDS 405
           KL+ +        K I F   +   +       I++W+Y  G  +  + GH   V +VD 
Sbjct: 2   KLLTKFESKSTRAKGIAFHPSRPWALVALFSSTIQLWDYRMGTLLHRFEGHEGPVRAVDF 61

Query: 406 Y--KKIIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
           +  + I VS   D ++KVW +E+  C YTL GH ++V TV  H +     S SDD T+R+
Sbjct: 62  HPTQPIFVSAGDDASIKVWSLETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRI 121

Query: 463 WDIRSNTCVKVFRGH--------VGQVQKVLPLTILDTENLVTDRTSDPPRNEA---TTA 511
           W+ ++   +    GH          Q + ++    LD    V D +    ++ A   T+ 
Sbjct: 122 WNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASLDETVRVWDISGLRKKHSAPGVTSY 181

Query: 512 QDPPDGQLSALDDSL----------------------PYPSHLLSCSLDNTIKLWEVRTG 549
           +D    Q + LD +                       P    +++   D  +KLW + + 
Sbjct: 182 EDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSN 241

Query: 550 KC--VRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTF 595
           K   V T  GH   +  +    D   I+S A DKT+++WDL     +  F
Sbjct: 242 KAWEVDTCRGHTNNVDCVVFHPDQNLILSVAEDKTLRIWDLDKRTPVKQF 291

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 62/180 (34%), Gaps = 57/180 (31%)

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTS 501
           +  HP           +TI++WD R  T +  F GH G V+ V                 
Sbjct: 17  IAFHPSRPWALVALFSSTIQLWDYRMGTLLHRFEGHEGPVRAV----------------- 59

Query: 502 DPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKC---------- 551
                                 D  P     +S   D +IK+W + T +C          
Sbjct: 60  ----------------------DFHPTQPIFVSAGDDASIKVWSLETNRCLYTLTGHLDY 97

Query: 552 VRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSE 611
           VRT F H E  W        ++S + D+TV++W+ Q+ K +     H   + C     +E
Sbjct: 98  VRTVFFHSELPW--------VISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTE 149

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 127/279 (45%), Gaps = 51/279 (18%)

Query: 356 HRDGVKAIYFD---GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---I 409
           H + + A+ FD   G    +   DR+++VW+   G  V   PGH  +V  +   KK   +
Sbjct: 334 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNM 393

Query: 410 IVSGSADKTVKVWHVE-SRTCYT----LRGHTEWVGT-----VKLHPKSFTCFS------ 453
           +++GS D T+K+W +  SR  Y     L+  TE + T      +LH    T  S      
Sbjct: 394 LITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEAL 453

Query: 454 --GSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTA 511
             GS D  I  WD+ +  C++       Q+  +   T  D +         P R+    A
Sbjct: 454 VSGSRDKKIFHWDLTTGKCIQ-------QLDLIFTPTHSDIKM--------PARSLNNGA 498

Query: 512 -----QDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA 566
                + P  G L        Y S L + + D  ++LW++R GK VR   GH +GI  + 
Sbjct: 499 CLLGTEAPMIGALQC------YNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLK 552

Query: 567 ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
            D+ ++V+G+ D +V++WDL++   +    ++  P++ +
Sbjct: 553 FDSEKLVTGSMDNSVRIWDLRTSSILDVI-AYDLPVSSL 590

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 109/256 (42%), Gaps = 62/256 (24%)

Query: 288 PWKVI----YRERFKVESNWRKGTAHIQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVA 340
           PW  +    Y++R     +   G   + E  GH+  V  +Q    NY +L TGS D+T+ 
Sbjct: 346 PWGTLCSSSYQDRIVKVWDLNHGI-QVGELPGHLATVNCMQIDKKNYNMLITGSKDATLK 404

Query: 341 IWDLATGK-------------------LVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRV 381
           +WDL   +                    +     H+D + A+ FD + L++GS D+ I  
Sbjct: 405 LWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFH 464

Query: 382 WNYVTGACVAAY-----PGHSDSVLSVDS--------------------YKKIIVSGSAD 416
           W+  TG C+        P HSD  +   S                    Y   + +G+ D
Sbjct: 465 WDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKD 524

Query: 417 KTVKVWHVE-SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFR 475
             V++W +   +    L GHT+ + ++K   +     +GS D ++R+WD+R+++ + V  
Sbjct: 525 GIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLV--TGSMDNSVRIWDLRTSSILDV-- 580

Query: 476 GHVGQVQKVLPLTILD 491
                +   LP++ LD
Sbjct: 581 -----IAYDLPVSSLD 591

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 61/104 (58%), Gaps = 1/104 (0%)

Query: 322 SLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRV 381
           +LQ     L TG+ D  V +WDL  GK VR L GH DG+ ++ FD +KL+TGS+D  +R+
Sbjct: 510 ALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRI 569

Query: 382 WNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE 425
           W+  T + +     +   V S+D   K+I  G+ +  V V+++E
Sbjct: 570 WDLRTSSILDVI-AYDLPVSSLDFDGKLITVGANEGGVNVFNME 612

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/321 (20%), Positives = 121/321 (37%), Gaps = 91/321 (28%)

Query: 316 HMDGVLSLQFN--YRLLFTGSY-DSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--- 369
           H + + +L F+  +  L + SY D  V +WDL  G  V  L GH   V  +  D +    
Sbjct: 334 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNM 393

Query: 370 LITGSLDRMIRVWNY-------------------VTGACVAAYPGHSDSVLSVDSYKKII 410
           LITGS D  +++W+                    +   C+  +  H D + ++    + +
Sbjct: 394 LITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEAL 453

Query: 411 VSGSADKTVKVWHVESRTCY-------------------TLRGHTEWVGTVKLHPKSFTC 451
           VSGS DK +  W + +  C                    +L      +GT      +  C
Sbjct: 454 VSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQC 513

Query: 452 F-----SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRN 506
           +     +G+ D  +R+WD+R    V++  GH   +  +      D+E LVT         
Sbjct: 514 YNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLK----FDSEKLVT--------- 560

Query: 507 EATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA 566
                                        S+DN++++W++RT   +     +   +  + 
Sbjct: 561 ----------------------------GSMDNSVRIWDLRTSSILDV-IAYDLPVSSLD 591

Query: 567 ADNFRIVSGAHDKTVKVWDLQ 587
            D   I  GA++  V V++++
Sbjct: 592 FDGKLITVGANEGGVNVFNME 612

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 64/121 (52%), Gaps = 9/121 (7%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
           ++  +GH DG+ SL+F+   L TGS D++V IWDL T  ++  +  +   V ++ FDG+ 
Sbjct: 538 VRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSIL-DVIAYDLPVSSLDFDGKL 596

Query: 370 LITGSLDRMIRVWNYVTGA-CVAAYPGHS---DSV---LSVDSYKK-IIVSGSADKTVKV 421
           +  G+ +  + V+N       +   P HS   D +   +++  YK   +++G  D  + V
Sbjct: 597 ITVGANEGGVNVFNMERDEHWMTPEPPHSLDGDELSRRIAIVKYKDGFLINGHNDGDINV 656

Query: 422 W 422
           W
Sbjct: 657 W 657

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 104/250 (41%), Gaps = 52/250 (20%)

Query: 395 GHSDSVLSVDS-YKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFTCF 452
           G+S + L  D+ +  +  S   D+ VKVW +        L GH   V  +++  K++   
Sbjct: 335 GNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNML 394

Query: 453 -SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTA 511
            +GS D T+++WD+  N   +++  H    +K        TE +VT     P  +     
Sbjct: 395 ITGSKDATLKLWDL--NLSREIYLDHSPLKEK--------TEEIVT-----PCIHNFELH 439

Query: 512 QDPPDGQLSALD-DSLPYPSHLLSCSLDNTIKLWEVRTGKCVR--------THFG----- 557
           +D    +++AL  DS      L+S S D  I  W++ TGKC++        TH       
Sbjct: 440 KD----EITALSFDS----EALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPA 491

Query: 558 ------------HVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
                           I  +   N  + +G  D  V++WDL+ GK +   + H   IT +
Sbjct: 492 RSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSL 551

Query: 606 GIGDSEFVSG 615
                + V+G
Sbjct: 552 KFDSEKLVTG 561

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 57/137 (41%), Gaps = 26/137 (18%)

Query: 505 RNEATTAQDPPDGQ----LSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVE 560
           RN        P G+    ++ALD   P+ +   S   D  +K+W++  G  V    GH+ 
Sbjct: 320 RNTTAFRMTIPHGEHGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLA 379

Query: 561 GI--WDIAADNFR-IVSGAHDKTVKVWDLQSGK-------------------CIHTFDSH 598
            +    I   N+  +++G+ D T+K+WDL   +                   CIH F+ H
Sbjct: 380 TVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELH 439

Query: 599 QAPITCVGIGDSEFVSG 615
           +  IT +       VSG
Sbjct: 440 KDEITALSFDSEALVSG 456

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 127/281 (45%), Gaps = 55/281 (19%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTG 387
           + T  Y   V IW+  T + VR +      V+A  F  +K  ++ GS D  +RV+NY TG
Sbjct: 28  VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNTG 87

Query: 388 ACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCY--TLRGHTEWVGTVK 443
             VA +  H D +  ++V   K  I++GS D TVK+W+ E+      T +GH  +V  V 
Sbjct: 88  EKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVA 147

Query: 444 LHPKSFTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD 502
            +PK    F SG  D  +++W +  +T    F  H GQ + V         N V      
Sbjct: 148 FNPKDPNVFASGCLDHKVKVWSLGQST--PNFTLHTGQEKGV---------NYV------ 190

Query: 503 PPRNEATTAQDPPDGQLSALDDSLPYPS--HLLSCSLDNTIKLWEVRTGKCVRTHFGHVE 560
                                D  P P   ++++ S D T+K+++ +T  CV T  GH+ 
Sbjct: 191 ---------------------DYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMS 229

Query: 561 GIWDIAADNFR-----IVSGAHDKTVKVWDLQSGKCIHTFD 596
              +++   F      I+SG+ D TVK+W+  + K   T +
Sbjct: 230 ---NVSFAVFHPTLPIIISGSEDGTVKLWNSSTYKLEKTLN 267

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 64/132 (48%), Gaps = 10/132 (7%)

Query: 302 NWRKGTAHIQEFKGHMDGVLSLQFNYR---LLFTGSYDSTVAIWDLATGKLVRRL-TGHR 357
           NW    +  Q FKGH   V+ + FN +   +  +G  D  V +W L        L TG  
Sbjct: 125 NWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQE 184

Query: 358 DGVKAIYF----DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK--IIV 411
            GV  + +    D   +IT S D  +++++Y T +CVA   GH  +V     +    II+
Sbjct: 185 KGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPTLPIII 244

Query: 412 SGSADKTVKVWH 423
           SGS D TVK+W+
Sbjct: 245 SGSEDGTVKLWN 256

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 101/235 (42%), Gaps = 49/235 (20%)

Query: 379 IRVWNYVTGACVAAYPGHSDSVLSVDSY---KKIIVSGSADKTVKVWHVES-RTCYTLRG 434
           + +WNY T   V +    +D+ +    +   K  IV GS D  V+V++  +         
Sbjct: 37  VEIWNYETQQEVRSIQV-TDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNTGEKVADFVA 95

Query: 435 HTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN-TCVKVFRGHVGQVQKVLPLTILDTE 493
           H +++ ++ +HP      +GSDD T+++W+  ++ +  + F+GH               E
Sbjct: 96  HPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGH---------------E 140

Query: 494 NLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV-RTGKCV 552
           + V              A +P D            P+   S  LD+ +K+W + ++    
Sbjct: 141 HFV-----------MCVAFNPKD------------PNVFASGCLDHKVKVWSLGQSTPNF 177

Query: 553 RTHFGHVEGI----WDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPIT 603
             H G  +G+    +    D   +++ + D TVK++D Q+  C+ T + H + ++
Sbjct: 178 TLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVS 232

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 125/272 (45%), Gaps = 46/272 (16%)

Query: 364 YFDGQKLI-TGSLDRMIRVWNYVTGA----CVAAYPGHSDSVLSVDSYKK----IIVSGS 414
           + D   L+ T S D  I V+++ +       + ++  H  +V S  +++K    ++ S S
Sbjct: 183 FIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTVSSQKTWQKDNDVLLASSS 242

Query: 415 ADKTVKVWHV-ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKV 473
            D TVKVW V +SR   +   H+EWV ++ +  +     SGS D+T+R+    S   + V
Sbjct: 243 RDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDEYI--LSGSLDSTLRLTHWPSGNGLSV 300

Query: 474 FRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL 533
             GH   +++VL +   D++       + P R++   +   P          L +  +  
Sbjct: 301 GTGHEFPIERVLIIPFSDSK-----ICTSPYRDQNEHSAFAP----------LRF-KYCA 344

Query: 534 SCSLDNTIKLWEV-----------------RTGKCVRTHFGHVEGIWDIAADNFRIVSGA 576
           S + DNTIK+WEV                  T KCV T  GH   + D+      + S +
Sbjct: 345 SAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKDLKLRGDHLFSCS 404

Query: 577 HDKTVKVWDLQSGKCIHTFDS-HQAPITCVGI 607
            D+T+K WDL +G C+ T+ S H   I C+ I
Sbjct: 405 DDETIKCWDLNTGNCVKTWSSIHNNFINCIDI 436

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 96/213 (45%), Gaps = 51/213 (23%)

Query: 310 IQEFKGHMDGVLSLQFNYR-----LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIY 364
           I+ F  H D  +S Q  ++     LL + S D+TV +W +   + ++  + H + VK+I 
Sbjct: 214 IRSFNAH-DSTVSSQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSID 272

Query: 365 FDGQKLITGSLDRMIRVWNYVTGACVAAYPGH------------SDSVLSVDSYK----- 407
              + +++GSLD  +R+ ++ +G  ++   GH            SDS +    Y+     
Sbjct: 273 VLDEYILSGSLDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDSKICTSPYRDQNEH 332

Query: 408 --------KIIVSGSADKTVKVWHV--------------ESRTCY----TLRGHTEWVGT 441
                   K   S + D T+K+W V               + T +    TLRGHT WV  
Sbjct: 333 SAFAPLRFKYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKD 392

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVF 474
           +KL       FS SDD TI+ WD+ +  CVK +
Sbjct: 393 LKLRGDHL--FSCSDDETIKCWDLNTGNCVKTW 423

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 73/183 (39%), Gaps = 33/183 (18%)

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC-VKVFRGHVGQVQKVLPLTILDTENLVT 497
           V  +KLHP     + G+D   +  +DI + T  + V   H   +  +  +   + E  + 
Sbjct: 126 VTAIKLHPSLAIVYVGTDTGRLIAYDILNYTIPLAVTTAHSKAITSIEVIEAHNFEEFI- 184

Query: 498 DRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFG 557
               D     +TT++D    Q++  D S             NT +L      K +R+   
Sbjct: 185 ----DSTTLVSTTSKD---AQINVYDHS------------SNTGEL------KLIRSFNA 219

Query: 558 HVEGI-----WDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEF 612
           H   +     W    ++  + S + D TVKVW +   +C+ +F  H   +  + + D   
Sbjct: 220 HDSTVSSQKTWQ-KDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDEYI 278

Query: 613 VSG 615
           +SG
Sbjct: 279 LSG 281

>Kwal_23.6429
          Length = 750

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 118/270 (43%), Gaps = 53/270 (19%)

Query: 360 VKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK--IIVSGSA 415
           ++++ F  DG+ L TG+ D++IR+W+  T   V    GH   + S+D +     +VSGS 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 532

Query: 416 DKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFS-GSDDTTIRMWDIRSNTCVKVF 474
           D+TV++W + +  C       + V TV + P      + GS D T+R+WD  S T   V 
Sbjct: 533 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWD--SETGFLVE 590

Query: 475 RGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLS 534
           R              LD+EN +     D   +   T     DG              ++S
Sbjct: 591 R--------------LDSENELGTGHKDSVYSVVFTR----DGH------------GVVS 620

Query: 535 CSLDNTIKLWEVR------------TGKCVRTHFGHVEGIWDIAA---DNFRIVSGAHDK 579
            SLD ++KLW +R            T     T+ GH + +  +A    D F I+SG+ D+
Sbjct: 621 GSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEF-ILSGSKDR 679

Query: 580 TVKVWDLQSGKCIHTFDSHQAPITCVGIGD 609
            V  WD  SG  +     H+  +  V + +
Sbjct: 680 GVLFWDTPSGNPLLMLQGHRNSVISVAVAN 709

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 82/164 (50%), Gaps = 36/164 (21%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YF-DGQKLITGSLDRMIRVWNYV 385
           + L TG+ D  + IWDLAT ++V  L GH   + ++ YF  G KL++GS DR +R+W+  
Sbjct: 483 KFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 542

Query: 386 TGAC------------VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR 433
           TG C            VA  PG            K+I +GS D+TV++W  +S T + + 
Sbjct: 543 TGQCSLTLSIEDGVTTVAVSPGDG----------KLIAAGSLDRTVRIW--DSETGFLVE 590

Query: 434 ----------GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
                     GH + V +V          SGS D ++++W++RS
Sbjct: 591 RLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRS 634

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 93/204 (45%), Gaps = 32/204 (15%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           +   +GH   + SL +  +   L +GS D TV IWDL TG+    L+   DGV  +    
Sbjct: 505 VMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLS-IEDGVTTVAVSP 563

Query: 366 -DGQKLITGSLDRMIRVWNYVTGACVAAY-------PGHSDSVLSV----DSYKKIIVSG 413
            DG+ +  GSLDR +R+W+  TG  V           GH DSV SV    D +   +VSG
Sbjct: 564 GDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHG--VVSG 621

Query: 414 SADKTVKVWHVESRTC-------------YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTI 460
           S D++VK+W++ S                 T  GH ++V +V          SGS D  +
Sbjct: 622 SLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGV 681

Query: 461 RMWDIRSNTCVKVFRGHVGQVQKV 484
             WD  S   + + +GH   V  V
Sbjct: 682 LFWDTPSGNPLLMLQGHRNSVISV 705

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 125/287 (43%), Gaps = 65/287 (22%)

Query: 316 HMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITG 373
           H   V  ++F++    L TG  + T  ++ ++TG+L+ RL+           D     +G
Sbjct: 399 HSSVVCCVRFSHDGEFLATGC-NKTTQVYKVSTGELIARLSE----------DASSAPSG 447

Query: 374 SLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESR-TCY 430
           + D      N      VA        + SV      K + +G+ DK +++W + +R    
Sbjct: 448 A-DASATSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVM 506

Query: 431 TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTIL 490
           TL+GH + + ++   P      SGS D T+R+WD+R+  C              L L+I 
Sbjct: 507 TLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQC-------------SLTLSI- 552

Query: 491 DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGK 550
             E+ VT           T A  P DG+L A            + SLD T+++W+  TG 
Sbjct: 553 --EDGVT-----------TVAVSPGDGKLIA------------AGSLDRTVRIWDSETGF 587

Query: 551 CV-------RTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQS 588
            V           GH + ++ +    D   +VSG+ D++VK+W+L+S
Sbjct: 588 LVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRS 634

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 93/237 (39%), Gaps = 56/237 (23%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE 425
           DG+ L TG  ++  +V+   TG  +A     + S  S            AD +    + +
Sbjct: 411 DGEFLATG-CNKTTQVYKVSTGELIARLSEDASSAPS-----------GADASATSENAK 458

Query: 426 SRTCYTLRGHTE-WVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
           +         ++ ++ +V   P      +G++D  IR+WD+ +   V   +GH   +  +
Sbjct: 459 ASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSL 518

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                                                  D  P    L+S S D T+++W
Sbjct: 519 ---------------------------------------DYFPSGDKLVSGSGDRTVRIW 539

Query: 545 EVRTGKCVRTHFGHVEGIWDIA---ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSH 598
           ++RTG+C  T     +G+  +A    D   I +G+ D+TV++WD ++G  +   DS 
Sbjct: 540 DLRTGQCSLT-LSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSE 595

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 55/93 (59%), Gaps = 9/93 (9%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF----RIVSGAHDKTVKVWDLQ 587
           L + + D  I++W++ T + V T  GH + I+ +  D F    ++VSG+ D+TV++WDL+
Sbjct: 485 LATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSL--DYFPSGDKLVSGSGDRTVRIWDLR 542

Query: 588 SGKCIHTFDSHQAPITCVGI--GDSEFVSGDEL 618
           +G+C  T  S +  +T V +  GD + ++   L
Sbjct: 543 TGQCSLTL-SIEDGVTTVAVSPGDGKLIAAGSL 574

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 46/118 (38%), Gaps = 11/118 (9%)

Query: 277 VASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQF--NYRLLFTGS 334
           V S +  R  + W +        E       + +  + GH D VLS+    N   + +GS
Sbjct: 618 VVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVT-YTGHKDFVLSVATTQNDEFILSGS 676

Query: 335 YDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--------LITGSLDRMIRVWNY 384
            D  V  WD  +G  +  L GHR+ V ++                TGS D   R+W Y
Sbjct: 677 KDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKY 734

>Kwal_26.7570
          Length = 218

 Score = 80.9 bits (198), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 72/147 (48%), Gaps = 12/147 (8%)

Query: 313 FKGHMDGVLSLQFNY---RLLFTGSYDSTVAIWDLA-----TGKLVRRLTGHRDGVK--A 362
            +GH   V SL  +     LL +GS D ++  W L       G  VR   GH   V+   
Sbjct: 13  LEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCT 72

Query: 363 IYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVK 420
           +  DG+  ++ S D+ +R+W   TG C+  + GH   VLSV  D     IVS S DKTVK
Sbjct: 73  VTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVK 132

Query: 421 VWHVESRTCYTLRGHTEWVGTVKLHPK 447
           VW+       TL GH +WV  V++ P 
Sbjct: 133 VWNTLGECMVTLLGHNDWVSQVRVAPN 159

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 82/189 (43%), Gaps = 48/189 (25%)

Query: 431 TLRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMW-----DIRSNTCVKVFRGHVGQVQKV 484
           TL GH  WV ++   P +     SGS D ++  W     D +    V+ FRGH       
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGH------- 64

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                    ++V D T  P            DG+            + LS S D T++LW
Sbjct: 65  --------SHIVQDCTVTP------------DGE------------YALSASWDKTVRLW 92

Query: 545 EVRTGKCVRTHFGHVEGIWDIAADN--FRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPI 602
           E+ TGKC++   GH   +  +  D    +IVS + DKTVKVW+   G+C+ T   H   +
Sbjct: 93  ELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTL-GECMVTLLGHNDWV 151

Query: 603 TCVGIGDSE 611
           + V +  +E
Sbjct: 152 SQVRVAPNE 160

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 82/206 (39%), Gaps = 57/206 (27%)

Query: 395 GHSDSVLSVDSYK---KIIVSGSADKTVKVWHVESR------TCYTLRGHTEWVGTVKLH 445
           GH+  V S+ +      +++SGS DK++  W +            + RGH+  V    + 
Sbjct: 15  GHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVT 74

Query: 446 PKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPR 505
           P      S S D T+R+W++ +  C++ F GH      VL +TI        DR +    
Sbjct: 75  PDGEYALSASWDKTVRLWELATGKCIQRFVGHKSD---VLSVTI--------DRRA---- 119

Query: 506 NEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI 565
                                   S ++S S D T+K+W    G+C+ T  GH + +  +
Sbjct: 120 ------------------------SQIVSASRDKTVKVWNT-LGECMVTLLGHNDWVSQV 154

Query: 566 AA--------DNFRIVSGAHDKTVKV 583
                     +   ++S   DK VKV
Sbjct: 155 RVAPNESPEDETVTVISAGMDKVVKV 180

 Score = 35.0 bits (79), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 11/82 (13%)

Query: 310 IQEFKGHMDGVLSLQFNYRL--LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           IQ F GH   VLS+  + R   + + S D TV +W+   G+ +  L GH D V  +    
Sbjct: 100 IQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWN-TLGECMVTLLGHNDWVSQVRVAP 158

Query: 366 ------DGQKLITGSLDRMIRV 381
                 +   +I+  +D++++V
Sbjct: 159 NESPEDETVTVISAGMDKVVKV 180

>Scas_624.11
          Length = 1205

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 77/342 (22%), Positives = 130/342 (38%), Gaps = 81/342 (23%)

Query: 286 TRPWKVIYRERFKVES-NWRKGTAHIQEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIW 342
           +RPW ++      ++  ++R GT  +  F+ H   V S+ F+    +  +G  D T+ +W
Sbjct: 22  SRPWVLVALFSSTIQLWDYRMGTL-LHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVW 80

Query: 343 DLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSV 400
            L T K +  L GH D ++ ++F  +   +I+ S D+ IR+WN+     +A   GH+  V
Sbjct: 81  SLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFV 140

Query: 401 LSVDSY--KKIIVSGSADKTVKVWHVESR------------------------------- 427
           +    +    ++VS S D+T++VW +                                  
Sbjct: 141 MCAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCV 200

Query: 428 TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC--VKVFRGHVGQVQKVL 485
             + L GHT  V     HP      SGSDD  +++W   S     V   RGH   V  V+
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVI 260

Query: 486 PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWE 545
                                                    P    +LS   D T+++W+
Sbjct: 261 ---------------------------------------FHPTQKFILSVGEDKTLRIWD 281

Query: 546 VRTGKCVRTHFGHVEGIWDIAAD-NFRIVSGAHDKTVKVWDL 586
           +     V+      +  W IA+  N  +   AHD  + V+ L
Sbjct: 282 LDKRIPVKQFKRENDRFWLIASHPNINLFGAAHDAGIMVFKL 323

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 112/273 (41%), Gaps = 30/273 (10%)

Query: 348 KLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDS 405
           K++ +        K I F   +  ++       I++W+Y  G  +  +  H   V SVD 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDF 61

Query: 406 Y--KKIIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
           +  + I VSG  D T+KVW +E+  C YTL GH +++ TV  H +     S SDD TIR+
Sbjct: 62  HPTQPIFVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRI 121

Query: 463 WDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRN----EATTAQDPPDGQ 518
           W+ ++   +    GH      V+      T++LV   + D             +    G 
Sbjct: 122 WNWQNRKEIACLTGH---NHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGT 178

Query: 519 LSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHF--GHVEGI-WDIAADNF-RIVS 574
            S  DD +    +LL               G CV      GH  G+ W         IVS
Sbjct: 179 -STFDDQMAAQQNLLDGGF-----------GDCVVKFILEGHTRGVNWASFHPTLPMIVS 226

Query: 575 GAHDKTVKVWDLQSGKC--IHTFDSHQAPITCV 605
           G+ D+ VK+W   S K   + T   H   + CV
Sbjct: 227 GSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCV 259

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 119/269 (44%), Gaps = 51/269 (18%)

Query: 360 VKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK--IIVSGSA 415
           ++++ F  DG+ L TG+ DR+IR+W+      V    GH   + S+D +     +VSGS 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 416 DKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCF-SGSDDTTIRMWDIRSNTCVKVF 474
           D+TV++W + +  C       + V TV + P       +GS D  +R+WD  S T   V 
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD--SETGFLVE 563

Query: 475 RGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLS 534
           R              LD+EN       D   +   T     DGQ             ++S
Sbjct: 564 R--------------LDSENESGTGHKDSVYSVVFTR----DGQ------------SVVS 593

Query: 535 CSLDNTIKLWEVR------------TGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKT 580
            SLD ++KLW ++            +G C  T+ GH + +  +A   ++  I+SG+ D+ 
Sbjct: 594 GSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRG 653

Query: 581 VKVWDLQSGKCIHTFDSHQAPITCVGIGD 609
           V  WD +SG  +     H+  +  V + +
Sbjct: 654 VLFWDKKSGNPLLMLQGHRNSVISVAVAN 682

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 116/301 (38%), Gaps = 95/301 (31%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YF-DGQKLITGSLDRMIRVWNYV 385
           + L TG+ D  + IWD+   K+V  L GH   + ++ YF  G KL++GS DR +R+W+  
Sbjct: 456 KFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 515

Query: 386 TGAC------------VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR 433
           TG C            VA  PG            K I +GS D+ V+VW  +S T + + 
Sbjct: 516 TGQCSLTLSIEDGVTTVAVSPGDG----------KYIAAGSLDRAVRVW--DSETGFLVE 563

Query: 434 ----------GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIR------------SNTCV 471
                     GH + V +V       +  SGS D ++++W+++            S TC 
Sbjct: 564 RLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 623

Query: 472 KVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSH 531
             + GH   V  V                       ATT  D                 +
Sbjct: 624 VTYIGHKDFVLSV-----------------------ATTQND----------------EY 644

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR--------IVSGAHDKTVKV 583
           +LS S D  +  W+ ++G  +    GH   +  +A  N            +G+ D   ++
Sbjct: 645 ILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARI 704

Query: 584 W 584
           W
Sbjct: 705 W 705

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 102/232 (43%), Gaps = 63/232 (27%)

Query: 408 KIIVSGSADKTVKVWHVESR-TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIR 466
           K + +G+ D+ +++W +E+R     L+GH + + ++   P      SGS D T+R+WD+R
Sbjct: 456 KFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 515

Query: 467 SNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSL 526
           +  C              L L+I   E+ VT           T A  P DG+        
Sbjct: 516 TGQC-------------SLTLSI---EDGVT-----------TVAVSPGDGK-------- 540

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCV-------RTHFGHVEGIWDIA--ADNFRIVSGAH 577
               ++ + SLD  +++W+  TG  V        +  GH + ++ +    D   +VSG+ 
Sbjct: 541 ----YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSL 596

Query: 578 DKTVKVWDLQ------------SGKCIHTFDSHQAPITCVGI--GDSEFVSG 615
           D++VK+W+LQ            SG C  T+  H+  +  V     D   +SG
Sbjct: 597 DRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 648

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 49/118 (41%), Gaps = 11/118 (9%)

Query: 277 VASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQF--NYRLLFTGS 334
           V S +  R  + W +              GT  +  + GH D VLS+    N   + +GS
Sbjct: 591 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVT-YIGHKDFVLSVATTQNDEYILSGS 649

Query: 335 YDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-DGQKL-------ITGSLDRMIRVWNY 384
            D  V  WD  +G  +  L GHR+ V ++   +G  L        TGS D   R+W Y
Sbjct: 650 KDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKY 707

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 103/257 (40%), Gaps = 48/257 (18%)

Query: 349 LVRRLTGHRDGVKAIYFD---GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSV 403
           L R + GH   V+ I  D    +   TGS D+ I++WN  +G        H  +V  L++
Sbjct: 107 LTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAI 166

Query: 404 DSYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
            +    + S S DKTVK W +E  T      GH   V TV +HP      +   D+ +++
Sbjct: 167 SNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKV 226

Query: 463 WDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSAL 522
           WDIR+   V    GH G + KV                                      
Sbjct: 227 WDIRTRLPVMTLPGHKGPITKV-------------------------------------- 248

Query: 523 DDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKT 580
              LP    ++S S+D +I+LW++  GK ++    H   + DI+     F   S   +  
Sbjct: 249 -RCLPVDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDISVHPSEFSFASACTND- 306

Query: 581 VKVWDLQSGKCIHTFDS 597
           ++ W L  G+ +  F S
Sbjct: 307 IRSWLLPKGELLTNFVS 323

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 77/158 (48%), Gaps = 5/158 (3%)

Query: 332 TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGAC 389
           TGS D T+ IW+LA+GKL   L  H   V+ +    +   + + S D+ ++ W+      
Sbjct: 133 TGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTA 192

Query: 390 VAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHP 446
           +  Y GH   V +VD +    ++V+   D  VKVW + +R    TL GH   +  V+  P
Sbjct: 193 IRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLP 252

Query: 447 KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
                 S S D +IR+WD+ +   +KV   H   V+ +
Sbjct: 253 VDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDI 290

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 90/206 (43%), Gaps = 42/206 (20%)

Query: 410 IVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN 468
             +GS DKT+K+W++ S +   TL+ H   V  + +  +    FS S+D T++ WD+  N
Sbjct: 131 FATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKN 190

Query: 469 TCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPY 528
           T ++ + GH+  V  V                                       D  P 
Sbjct: 191 TAIRNYHGHLSGVHTV---------------------------------------DIHPT 211

Query: 529 PSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDL 586
              +++   D+ +K+W++RT   V T  GH   I  +     + +++S + D ++++WDL
Sbjct: 212 VDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDL 271

Query: 587 QSGKCIHTFDSHQAPITCVGIGDSEF 612
            +GK +     HQ  +  + +  SEF
Sbjct: 272 VAGKSMKVLTHHQRTVRDISVHPSEF 297

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 69/151 (45%), Gaps = 12/151 (7%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKA--IYFDGQKLITGSLDRM 378
           L++   +  +F+ S D TV  WDL     +R   GH  GV    I+     ++T   D +
Sbjct: 164 LAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSV 223

Query: 379 IRVWNYVTGACVAAYPGHSDSV-----LSVDSYKKIIVSGSADKTVKVWH-VESRTCYTL 432
           ++VW+  T   V   PGH   +     L VD     ++S S D ++++W  V  ++   L
Sbjct: 224 VKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQ---VISSSVDASIRLWDLVAGKSMKVL 280

Query: 433 RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
             H   V  + +HP  F+ F+ +    IR W
Sbjct: 281 THHQRTVRDISVHPSEFS-FASACTNDIRSW 310

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%)

Query: 550 KCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGD 609
           + +  H G V  I     DN    +G++DKT+K+W+L SGK   T  +H   +  + I +
Sbjct: 109 RVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISN 168

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/342 (22%), Positives = 132/342 (38%), Gaps = 81/342 (23%)

Query: 286 TRPWKVIYRERFKVES-NWRKGTAHIQEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIW 342
           +RPW ++      ++  ++R GT  +  F+ H   V  L F+    +  +   D T+ +W
Sbjct: 22  SRPWVLVALFSSTIQLWDYRMGTL-LHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVW 80

Query: 343 DLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSV 400
            L T K +  LTGH D V+ ++F  +   +I+ S D+ IR+WN+     +A   GH+  V
Sbjct: 81  SLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFV 140

Query: 401 LSVDSY--KKIIVSGSADKTVKVWHVESR------------------------------- 427
           +    +    +IVS S D+T+++W +                                  
Sbjct: 141 MCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCV 200

Query: 428 TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC--VKVFRGHVGQVQKVL 485
             + L GHT  V     HP      SGSDD  +++W + +     V   RGH   V  V+
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVI 260

Query: 486 PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWE 545
                                                    P+ + ++S   D T+++W+
Sbjct: 261 ---------------------------------------FHPHQNLIISVGEDKTLRVWD 281

Query: 546 VRTGKCVRTHFGHVEGIWDIAAD-NFRIVSGAHDKTVKVWDL 586
           +     V+      +  W IAA  +  +   AHD  + V+ L
Sbjct: 282 LDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKL 323

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 119/291 (40%), Gaps = 44/291 (15%)

Query: 348 KLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDS 405
           K++ +        K I F   +  ++       I++W+Y  G  +  +  H   V  +D 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDF 61

Query: 406 Y--KKIIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
           +  + I VS   D T+KVW +++  C YTL GH ++V TV  H +     S SDD TIR+
Sbjct: 62  HPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRI 121

Query: 463 WDIRSNTCVKVFRGH-----VGQVQKVLPLTI---LDTENLVTDRTSDPPRNEA---TTA 511
           W+ ++   +    GH       Q      L +   LD    + D +    R+ A   ++ 
Sbjct: 122 WNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSF 181

Query: 512 QDPPDGQLSALDDSL----------------------PYPSHLLSCSLDNTIKLWEVRTG 549
           ++    Q + LD SL                      P    ++S S D  +KLW +   
Sbjct: 182 EEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSAT 241

Query: 550 KC-----VRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTF 595
           K       R H  +V+ +      N  I+S   DKT++VWDL     +  F
Sbjct: 242 KAWEVDTCRGHTNNVDSVIFHPHQNL-IISVGEDKTLRVWDLDKRTPVKQF 291

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 59/173 (34%), Gaps = 57/173 (32%)

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTS 501
           +  HP           +TI++WD R  T +  F  H G V+ +                 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL----------------- 59

Query: 502 DPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKC---------- 551
                                 D  P     +S   D TIK+W + T KC          
Sbjct: 60  ----------------------DFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDY 97

Query: 552 VRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITC 604
           VRT F H E  W        I+S + D+T+++W+ Q+ K I     H   + C
Sbjct: 98  VRTVFFHRELPW--------IISASDDQTIRIWNWQNRKEIACLTGHNHFVMC 142

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 93/199 (46%), Gaps = 28/199 (14%)

Query: 313 FKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF---DG 367
            KGH   + SL +  +   L +GS D TV IWDL TG+    L+   DGV  +     DG
Sbjct: 593 LKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLS-IEDGVTTVAVSPGDG 651

Query: 368 QKLITGSLDRMIRVWNYVTGACVAAY-------PGHSDSVLSVDSYK--KIIVSGSADKT 418
           + +  GSLDR +RVW+  TG  V           GH DSV SV   +    +VSGS D++
Sbjct: 652 KFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRS 711

Query: 419 VKVWHVE------------SRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           VK+W++             S TC  T  GH ++V +V          SGS D  +  WD 
Sbjct: 712 VKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDK 771

Query: 466 RSNTCVKVFRGHVGQVQKV 484
            S   + + +GH   V  V
Sbjct: 772 VSGNPLLMLQGHRNSVISV 790

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 84/322 (26%), Positives = 137/322 (42%), Gaps = 75/322 (23%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRL------TGHRDG-----------------VKAIY 364
             L TG  + T  I+ ++ G+LV R       T   DG                 ++++ 
Sbjct: 504 EFLATGC-NKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDLYIRSVC 562

Query: 365 F--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVK 420
           F  DG+ L TG+ D++IR+W+      V    GH   + S+D +     +VSGS D+TV+
Sbjct: 563 FSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVR 622

Query: 421 VWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFS-GSDDTTIRMWDIRSNTCVKVFRGHVG 479
           +W +++  C       + V TV + P      + GS D  +R+WD  S+T   V R    
Sbjct: 623 IWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD--SDTGFLVER---- 676

Query: 480 QVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDN 539
                     LD+EN +     D   +   T     DG            + ++S SLD 
Sbjct: 677 ----------LDSENELGTGHKDSVYSVVFTR----DG------------NGVVSGSLDR 710

Query: 540 TIKLWEVR------------TGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVWD 585
           ++KLW +R            +G C  T+ GH + +  +A   D+  I+SG+ D+ V  WD
Sbjct: 711 SVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWD 770

Query: 586 LQSGKCIHTFDSHQAPITCVGI 607
             SG  +     H+  +  V +
Sbjct: 771 KVSGNPLLMLQGHRNSVISVAV 792

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 119/301 (39%), Gaps = 95/301 (31%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YF-DGQKLITGSLDRMIRVWNYV 385
           + L TG+ D  + IWD+   K+V  L GH   + ++ YF  G KL++GS DR +R+W+  
Sbjct: 568 KFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLK 627

Query: 386 TGAC------------VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR 433
           TG C            VA  PG            K I +GS D+ V+VW  +S T + + 
Sbjct: 628 TGQCTLTLSIEDGVTTVAVSPGDG----------KFIAAGSLDRAVRVW--DSDTGFLVE 675

Query: 434 ----------GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIR------------SNTCV 471
                     GH + V +V          SGS D ++++W++R            S TC 
Sbjct: 676 RLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCE 735

Query: 472 KVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSH 531
             + GH     K   L++  TE                             DD      +
Sbjct: 736 VTYTGH-----KDFVLSVATTE-----------------------------DD-----EY 756

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAAD-------NFRI-VSGAHDKTVKV 583
           +LS S D  +  W+  +G  +    GH   +  +A +       N+ I  +G+ D   ++
Sbjct: 757 ILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARI 816

Query: 584 W 584
           W
Sbjct: 817 W 817

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 65/179 (36%), Gaps = 74/179 (41%)

Query: 318 DGVLSLQF---NYRLLFTGSYDSTVAIWDLATGKLVRRL-------TGHRDGVKAIYF-- 365
           DGV ++     + + +  GS D  V +WD  TG LV RL       TGH+D V ++ F  
Sbjct: 639 DGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTR 698

Query: 366 DGQKLITGSLDRMIRVWNY------------VTGACVAAYPGHSD--------------- 398
           DG  +++GSLDR +++WN              +G C   Y GH D               
Sbjct: 699 DGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYIL 758

Query: 399 ---------------------------SVLSV--------DSYKKIIVSGSADKTVKVW 422
                                      SV+SV             I  +GS D   ++W
Sbjct: 759 SGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIW 817

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 51/119 (42%), Gaps = 11/119 (9%)

Query: 277 VASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQF--NYRLLFTGS 334
           V S +  R  + W +        +     GT  +  + GH D VLS+    +   + +GS
Sbjct: 703 VVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEV-TYTGHKDFVLSVATTEDDEYILSGS 761

Query: 335 YDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD-GQKL-------ITGSLDRMIRVWNYV 385
            D  V  WD  +G  +  L GHR+ V ++  + G  L        TGS D   R+W Y+
Sbjct: 762 KDRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWKYI 820

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 82.0 bits (201), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 126/299 (42%), Gaps = 18/299 (6%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVWNYVTG 387
           +L +  YD T+  W+  TG   R +      V  +   + +KL+  +  + +R+++  T 
Sbjct: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63

Query: 388 AC--VAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVK 443
               VA++ GH  +V SV   +  + +V+ S D T+KVW V S +      H   V  V 
Sbjct: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123

Query: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPL----TILDTENLVTDR 499
           +HP      S   D  IR+WD+  N C            + L +    ++L   N   + 
Sbjct: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNC 183

Query: 500 TSDPPRNEATTAQDPPDGQLSALDDSLPY------PSHLLSCSLDNTIKLWEVRTGKCVR 553
                 N    +   P  +  A    +          HL +CS D+T ++W +     + 
Sbjct: 184 YVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLE 243

Query: 554 THF-GHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGD 609
           T   GH   +WD A  AD+  +V+ + D  V++WDL + + +  +  H     CV + D
Sbjct: 244 TTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 103/266 (38%), Gaps = 53/266 (19%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG 367
           +  F+GH   V S+ F  + R + T S D T+ +WD+ +  + R    +    + +    
Sbjct: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127

Query: 368 Q-KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVL---SVDSYKKIIVSGSADKTVKVWH 423
           Q +LI+   D  IR+W+     C        D+ L   S+ S   ++ + +      VW 
Sbjct: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187

Query: 424 VESRT-------CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKV-FR 475
           + + T           R H+ ++  + L        + S D T R+W I  +  ++    
Sbjct: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247

Query: 476 GHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSC 535
           GH   V                                  D   SA  DS    ++L++ 
Sbjct: 248 GHQRWVW---------------------------------DCAFSA--DS----AYLVTA 268

Query: 536 SLDNTIKLWEVRTGKCVRTHFGHVEG 561
           S D+ ++LW++ T + VR + GH +G
Sbjct: 269 SSDHYVRLWDLSTREIVRQYGGHHKG 294

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 9/92 (9%)

Query: 532 LLSCSLDNTIKLWEVRTGK-----CVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDL 586
           LL+ +    ++L+++RT           H G+V  +     DN  +V+ + D T+KVWD+
Sbjct: 46  LLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSV-SFQQDNRWMVTSSEDGTIKVWDV 104

Query: 587 QSGKCIHTFDSHQAPITCVGI--GDSEFVSGD 616
           +S      +  H AP+  V I     E +S D
Sbjct: 105 RSPSIPRNY-KHNAPVNEVVIHPNQGELISCD 135

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 84.3 bits (207), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 117/271 (43%), Gaps = 45/271 (16%)

Query: 335 YDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAA 392
           Y     IW+  T   VR ++     V+A  F  +K  +I GS D  IRV+NY TG  V  
Sbjct: 33  YSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNTGEKVVD 92

Query: 393 YPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCY--TLRGHTEWVGTVKLHPKS 448
           +  H D +  L+V   +  ++S S D TVK+W+ E       T  GH  +V +V  +PK 
Sbjct: 93  FEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKD 152

Query: 449 FTCFSGS-DDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNE 507
              F+ +  D T+++W +   T     R H+ +             N V          +
Sbjct: 153 PNTFATACLDHTVKIWSLGQETSNFTLRAHLEK-----------GVNFV----------D 191

Query: 508 ATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAA 567
               QD P               +L++ S D T+K+W+ +T  CV T  GH+  +     
Sbjct: 192 YYPFQDKP---------------YLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVY 236

Query: 568 DNFR--IVSGAHDKTVKVWDLQSGKCIHTFD 596
                 I+SG+ D TVK+W+  + K   T +
Sbjct: 237 HPMLPIIISGSEDGTVKIWNSNTYKLERTLN 267

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 67/133 (50%), Gaps = 12/133 (9%)

Query: 302 NWRKGTAHIQEFKGHMDGVLSLQFNYR---LLFTGSYDSTVAIWDLATGKLVRRLTGHRD 358
           NW K  A  Q F+GH   V+S+ FN +      T   D TV IW L        L  H +
Sbjct: 125 NWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLE 184

Query: 359 -GVKAIYF----DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK---KII 410
            GV  + +    D   LIT S DR ++VW+Y T +CVA   GH  +V S   Y     II
Sbjct: 185 KGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNV-SYAVYHPMLPII 243

Query: 411 VSGSADKTVKVWH 423
           +SGS D TVK+W+
Sbjct: 244 ISGSEDGTVKIWN 256

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 108/242 (44%), Gaps = 19/242 (7%)

Query: 242 PNCGWGLPLLHMKRARFIEPPAESKPGQKGAGNPPV-ASETTTRKTRPWKVIYRERFKVE 300
           P+  W L  L+  RA       +++         PV A +   RK+  W ++  + FK+ 
Sbjct: 23  PSEPWVLITLYSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKS--WIIVGSDDFKIR 80

Query: 301 S-NWRKGTAHIQEFKGHMDGV--LSLQFNYRLLFTGSYDSTVAIWDLATG-KLVRRLTGH 356
             N+  G   + +F+ H D +  L++      + + S D TV +W+      L +   GH
Sbjct: 81  VFNYNTG-EKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGH 139

Query: 357 RDGVKAIYF---DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSD-SVLSVDSY----KK 408
              V ++ F   D     T  LD  +++W+            H +  V  VD Y    K 
Sbjct: 140 EHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKP 199

Query: 409 IIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
            +++ S D+TVKVW  ++++C  TL GH   V     HP      SGS+D T+++W+  S
Sbjct: 200 YLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWN--S 257

Query: 468 NT 469
           NT
Sbjct: 258 NT 259

>Kwal_56.24526
          Length = 1210

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/342 (22%), Positives = 135/342 (39%), Gaps = 81/342 (23%)

Query: 286 TRPWKVIYRERFKVES-NWRKGTAHIQEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIW 342
           +RPW ++      ++  ++R GT  + +F+ H   V  + F+    L  +   D T+ +W
Sbjct: 22  SRPWVLVALFSSSIQLWDYRMGTL-LHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVW 80

Query: 343 DLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSV 400
            L T K +  L GH D V+ ++F  +   +I+ S D+ IR+WN+     +A   GH+  V
Sbjct: 81  SLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFV 140

Query: 401 LSVDSY--KKIIVSGSADKTVKVWHV-------ESRTCYT-------------------- 431
           +  D +  + ++VS S D+TV+VW +        + + YT                    
Sbjct: 141 MCADFHPTEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCV 200

Query: 432 ----LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC--VKVFRGHVGQVQKVL 485
               L GH+  V     HP      SG DD  +++W + S     V   RGH   V  V+
Sbjct: 201 VKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVI 260

Query: 486 PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWE 545
                                                    P+ + ++S   D T+++W+
Sbjct: 261 ---------------------------------------FHPHQNLIISVGEDKTVRVWD 281

Query: 546 VRTGKCVRTHFGHVEGIWDIAAD-NFRIVSGAHDKTVKVWDL 586
           +     V+      +  W + A  N  +   AHD  + V+ L
Sbjct: 282 LDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKL 323

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/261 (26%), Positives = 108/261 (41%), Gaps = 48/261 (18%)

Query: 379 IRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKTVKVWHVESRTC-YTLRGH 435
           I++W+Y  G  +  +  H   V  +D +  + + VS   D T+KVW ++++ C +TL GH
Sbjct: 35  IQLWDYRMGTLLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGH 94

Query: 436 TEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENL 495
            ++V TV  H +     S SDD TIR+W+ ++   +    GH      V+      TE+L
Sbjct: 95  LDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGH---NHFVMCADFHPTEDL 151

Query: 496 VTDRTSDP-----------PRNEAT---TAQDPPDGQLSALDDSL--------------- 526
           V   + D             R+ A    T +D    Q + LD                  
Sbjct: 152 VVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRG 211

Query: 527 -------PYPSHLLSCSLDNTIKLWEVRTGKC-----VRTHFGHVEGIWDIAADNFRIVS 574
                  P    ++S   D  +KLW + + K       R H  +V+ +      N  I+S
Sbjct: 212 VNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNL-IIS 270

Query: 575 GAHDKTVKVWDLQSGKCIHTF 595
              DKTV+VWDL     +  F
Sbjct: 271 VGEDKTVRVWDLDKRTPVKQF 291

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 61/180 (33%), Gaps = 57/180 (31%)

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTS 501
           +  HP           ++I++WD R  T +  F  H G V+ +                 
Sbjct: 17  LAFHPSRPWVLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGI----------------- 59

Query: 502 DPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKC---------- 551
                                 D  P     +S   D TIK+W + T KC          
Sbjct: 60  ----------------------DFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDY 97

Query: 552 VRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSE 611
           VRT F H E  W        I+S + D+T+++W+ Q+ K I     H   + C     +E
Sbjct: 98  VRTVFFHRELPW--------IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTE 149

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 66/180 (36%), Gaps = 42/180 (23%)

Query: 418 TVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRG 476
           ++++W     T  +    H   V  +  HP      S  DD TI++W + +  C+    G
Sbjct: 34  SIQLWDYRMGTLLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNG 93

Query: 477 HVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCS 536
           H+  V+ V                                         LP+   ++S S
Sbjct: 94  HLDYVRTVF------------------------------------FHRELPW---IISAS 114

Query: 537 LDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVKVWDLQSGKCIHT 594
            D TI++W  +  K +    GH   +   D       +VS + D+TV+VWD+   +  H+
Sbjct: 115 DDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRVWDISGLRKRHS 174

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 81.3 bits (199), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 121/304 (39%), Gaps = 28/304 (9%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRM-IRVWNYVTG 387
           +L +  YD T+  W+  TG   R +      V  +     K    +   + +R+++  T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRFLAAAGHLHVRLYDIRTT 63

Query: 388 AC--VAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVK 443
               V ++ GH  +V S+   +  K +VS S D T+KVW V + +      H   V  V 
Sbjct: 64  NPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVV 123

Query: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDP 503
           +HP      S   D  IR+WD+  N C      H    +   PL  L   +  +   +  
Sbjct: 124 IHPNQGELISCDQDGNIRIWDLGENQCT-----HQLTPEDDTPLQSLSIASDGSMLVAGN 178

Query: 504 PRNEATTAQDPPDGQLSALDDSLPYPS---------------HLLSCSLDNTIKLWEVRT 548
            +      Q P     + L     + S               HL +CS D+T ++W +  
Sbjct: 179 NKGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIED 238

Query: 549 GKCVRTHF-GHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
              + T   GH   +WD A  AD+  +V+   D  V++WDL + + +  +  H     CV
Sbjct: 239 NFKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298

Query: 606 GIGD 609
            + D
Sbjct: 299 ALND 302

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 81/224 (36%), Gaps = 56/224 (25%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG 367
           +  F+GH   V S+ F  + + + + S D T+ +WD+    + R    H    + +    
Sbjct: 68  VTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIHPN 127

Query: 368 Q-KLITGSLDRMIRVWNYVTGAC----------------------------------VAA 392
           Q +LI+   D  IR+W+     C                                  V  
Sbjct: 128 QGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNCYVWQ 187

Query: 393 YPGHSDS-----VLSVDSYKKII------------VSGSADKTVKVWHVES--RTCYTLR 433
            P H+D+     V    S+ K I             + SAD T +VW +E   +   TL 
Sbjct: 188 MPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFKLETTLD 247

Query: 434 GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           GH  WV        S    +   D  +R+WD+ +   V+ + GH
Sbjct: 248 GHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

 Score = 32.3 bits (72), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 38/92 (41%), Gaps = 14/92 (15%)

Query: 277 VASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQF--NYRLLFTGS 334
           +A+ +     R W +   + FK+E+             GH   V    F  +   L T  
Sbjct: 222 LATCSADHTARVWSI--EDNFKLETT----------LDGHQRWVWDCAFSADSAYLVTAC 269

Query: 335 YDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD 366
            D  V +WDL+T ++VR+  GH  G   +  +
Sbjct: 270 SDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/342 (21%), Positives = 132/342 (38%), Gaps = 81/342 (23%)

Query: 286 TRPWKVIYRERFKVES-NWRKGTAHIQEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIW 342
           +RPW ++      ++  ++R G   +  F+ H   V  + F+    L  +   D ++ +W
Sbjct: 22  SRPWVLVALFSSTIQLWDYRMGVL-LHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVW 80

Query: 343 DLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSV 400
            L+T K +  L GH D V+ ++F  +   +I+ S D+ IR+WN+     +A   GH+  V
Sbjct: 81  SLSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFV 140

Query: 401 LSVDSY--KKIIVSGSADKTVKVWHVESR------------------------------- 427
           +    +  + ++VS S D+TV++W +                                  
Sbjct: 141 MCAQFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCV 200

Query: 428 TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC--VKVFRGHVGQVQKVL 485
             + L GHT  V     HP      SGSDD  +++W + S     V   RGH   V  V+
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVI 260

Query: 486 PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWE 545
                                                    P+ + ++S   D+TI++W+
Sbjct: 261 ---------------------------------------FHPFQNLIISVGEDSTIRVWD 281

Query: 546 VRTGKCVRTHFGHVEGIWDIAAD-NFRIVSGAHDKTVKVWDL 586
           +     V+      +  W I A  N  +   AHD  + V+ L
Sbjct: 282 LDKRTPVKQFKREQDRFWSIRAHPNVNLFGAAHDSGIMVFKL 323

 Score = 75.1 bits (183), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 119/300 (39%), Gaps = 54/300 (18%)

Query: 348 KLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDS 405
           K++ +        KAI F   +  ++       I++W+Y  G  +  +  H   V  VD 
Sbjct: 2   KMLTKFESKSTRAKAIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDF 61

Query: 406 Y--KKIIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
           +  + + VS   D ++KVW + +  C +TL GH ++V TV  H +     S SDD TIR+
Sbjct: 62  HPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRI 121

Query: 463 WDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPP------------------ 504
           W+ ++   +    GH      V+      TE+LV   + D                    
Sbjct: 122 WNWQNRREIACLTGH---NHFVMCAQFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGS 178

Query: 505 ---RNEATTAQDPPDGQL------------------SALDDSLPYPSHLLSCSLDNTIKL 543
                +  T Q+  DG                    ++   +LP    ++S S D  +KL
Sbjct: 179 QSFEEQMITQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLPL---IVSGSDDRQVKL 235

Query: 544 WEVRTGKC--VRTHFGHVEGIWDIAADNFR--IVSGAHDKTVKVWDLQSGKCIHTFDSHQ 599
           W + + K   V T  GH   +  +    F+  I+S   D T++VWDL     +  F   Q
Sbjct: 236 WRMSSTKAWEVDTCRGHTNNVDSVIFHPFQNLIISVGEDSTIRVWDLDKRTPVKQFKREQ 295

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 60/180 (33%), Gaps = 57/180 (31%)

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTS 501
           +  HP           +TI++WD R    +  F  H G V+ V                 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGV----------------- 59

Query: 502 DPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKC---------- 551
                                 D  P     +S   D +IK+W + T KC          
Sbjct: 60  ----------------------DFHPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHLDY 97

Query: 552 VRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSE 611
           VRT F H E  W        I+S + D+T+++W+ Q+ + I     H   + C     +E
Sbjct: 98  VRTVFFHTELPW--------IISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTE 149

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 72/188 (38%), Gaps = 46/188 (24%)

Query: 418 TVKVWHVESRTCYTLRGHTEWVGTVK---LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVF 474
           T+++W  + R    L    E  G V+    HP      S  DD +I++W + ++ C+   
Sbjct: 34  TIQLW--DYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHKCLFTL 91

Query: 475 RGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLS 534
            GH+  V+ V       TE                                LP+   ++S
Sbjct: 92  NGHLDYVRTVF----FHTE--------------------------------LPW---IIS 112

Query: 535 CSLDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVKVWDLQSGKCI 592
            S D TI++W  +  + +    GH   +           +VS + D+TV++WD+   +  
Sbjct: 113 ASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDISGLRKR 172

Query: 593 HTFDSHQA 600
           H+    Q+
Sbjct: 173 HSAPGSQS 180

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSE--FVS-GDE 617
           ++      T+++WD + G  +H F+ H+ P+  V    ++  FVS GD+
Sbjct: 26  VLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGDD 74

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 112/283 (39%), Gaps = 51/283 (18%)

Query: 345 ATGKLVRRLTGHRDGVKAIYFD---GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV- 400
           A  KL R + GH   V+ +  D    +  ITGS D  ++VW+  TG       GH  +V 
Sbjct: 127 APWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVR 186

Query: 401 -LSVDSYKKIIVSGSADKTVKVWHVE-SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDT 458
            ++V      + S S DKTVK W +E ++      GH   V TV +HP      +   D+
Sbjct: 187 DVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDS 246

Query: 459 TIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQ 518
            I++WD+R+   V    GH G + +V                         T  DP    
Sbjct: 247 VIKLWDMRTRIPVITLVGHKGPINQV-----------------------QCTPVDP---- 279

Query: 519 LSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGA 576
                        ++S S D T++LW+V  GK ++    H   +   A     F + S  
Sbjct: 280 ------------QVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASAC 327

Query: 577 HDKTVKVWDLQSGKCIHTFDSHQAPIT---CVGIGDSEFVSGD 616
            D  ++ W L  G  +  F+S +  I     +   D  F  GD
Sbjct: 328 TDD-IRSWGLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGD 369

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 119/277 (42%), Gaps = 27/277 (9%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTG 387
             TGS D+T+ +WDLATGKL   L GH   V+ +    +   L + S D+ ++ W+    
Sbjct: 155 FITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKN 214

Query: 388 ACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKL 444
             +  Y GH   V  +S+     +I +   D  +K+W + +R    TL GH   +  V+ 
Sbjct: 215 QIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQC 274

Query: 445 HPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPP 504
            P      S S D T+R+WD+ +   +KV   H   V+      +   E  V    +D  
Sbjct: 275 TPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRAT---ALHPKEFSVASACTDDI 331

Query: 505 RNEA-------TTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGK-----CV 552
           R+         T  +    G ++ L  S+     L +   +  +  ++ ++G        
Sbjct: 332 RSWGLAEGSLLTNFESEKTGIINTL--SINQDDVLFAGGDNGVLSFYDYKSGHKYQSLAT 389

Query: 553 RTHFGHVEGIWDIAADNF-----RIVSGAHDKTVKVW 584
           R   G +EG   +    F     R+++G  DK++K+W
Sbjct: 390 REMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIW 426

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 91/201 (45%), Gaps = 14/201 (6%)

Query: 422 WHVESRTCYTLRGHTEWVGTVKLHPKSFTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
           WH   +    + GH  WV  V + P     F +GS+DTT+++WD+ +        GHV  
Sbjct: 125 WHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMT 184

Query: 481 VQKVL-----PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSH--LL 533
           V+ V      P     +E+  T +  D  +N+         G LS +     +P+   + 
Sbjct: 185 VRDVAVSDRHPYLFSVSEDK-TVKCWDLEKNQIIRDYY---GHLSGVRTVSIHPTLDLIA 240

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAAD--NFRIVSGAHDKTVKVWDLQSGKC 591
           +   D+ IKLW++RT   V T  GH   I  +     + ++VS + D TV++WD+ +GK 
Sbjct: 241 TAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKT 300

Query: 592 IHTFDSHQAPITCVGIGDSEF 612
           +     H+  +    +   EF
Sbjct: 301 MKVLTHHKRSVRATALHPKEF 321

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 78/166 (46%), Gaps = 10/166 (6%)

Query: 310 IQEFKGHMDGV--LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHR---DGVKAIY 364
           I+++ GH+ GV  +S+     L+ T   DS + +WD+ T   V  L GH+   + V+   
Sbjct: 217 IRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTP 276

Query: 365 FDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY-KKIIVSGSADKTVKVWH 423
            D Q +++ S D  +R+W+ V G  +     H  SV +   + K+  V+ +    ++ W 
Sbjct: 277 VDPQ-VVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASACTDDIRSWG 335

Query: 424 VESRTCYT--LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
           +   +  T      T  + T+ ++      F+G D+  +  +D +S
Sbjct: 336 LAEGSLLTNFESEKTGIINTLSINQDD-VLFAGGDNGVLSFYDYKS 380

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 67/182 (36%), Gaps = 48/182 (26%)

Query: 262 PAESKPGQKGAGN--------PPVASETTTRKTRPWKVIYRERFKV----ESNWRKGTAH 309
           P  +  G KG  N        P V S +T    R W V+  +  KV    + + R    H
Sbjct: 258 PVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALH 317

Query: 310 IQEFK------------GHMDGVLSLQFNYR--------------LLFTGSYDSTVAIWD 343
            +EF             G  +G L   F                 +LF G  +  ++ +D
Sbjct: 318 PKEFSVASACTDDIRSWGLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGVLSFYD 377

Query: 344 LATGK-----LVRRLTGHRDGVKAIY---FD--GQKLITGSLDRMIRVWNYVTGACVAAY 393
             +G        R + G  +G +++    FD  G +LITG  D+ I++W     A   + 
Sbjct: 378 YKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIWKQDETATKESE 437

Query: 394 PG 395
           PG
Sbjct: 438 PG 439

>Scas_603.5
          Length = 589

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 106/249 (42%), Gaps = 73/249 (29%)

Query: 396 HSDSVLSVD---SYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFTC 451
           ++D+V  +D   S K +  +G  + ++KVW +E+      L  H   V  ++LHP S T 
Sbjct: 293 YTDTVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTL 352

Query: 452 FSGSDDTTIRMWDI------------RSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDR 499
            +GS D T+++WD+              ++C+  F  H  ++                  
Sbjct: 353 ITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEI------------------ 394

Query: 500 TSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT---HF 556
           TS    NE                       +LLS S D +I+ W++ TG CV+T     
Sbjct: 395 TSVSYDNE-----------------------YLLSASRDKSIRQWDLTTGNCVQTLEATL 431

Query: 557 GH----------VEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVG 606
            H          VE +  + A    + +G+ D  +++WDL+SGK + T   HQ PIT + 
Sbjct: 432 SHNSGTNIKDSTVEALQSVGA---ALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQ 488

Query: 607 IGDSEFVSG 615
              ++ ++G
Sbjct: 489 FDSTKIITG 497

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 114/271 (42%), Gaps = 36/271 (13%)

Query: 260 EPPAESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVESNWR-KGTAHIQEFKG-HM 317
           E  A+++P    A   P           P +V++  +   E+N   K  +H+      + 
Sbjct: 235 ESAAKAEPDLTDAKLDPNIRGINNVMNDPAQVMFFHKNDKENNEDLKSGSHLGTLDSVYT 294

Query: 318 DGVLSLQFNY--RLLFT-GSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLIT 372
           D V  L F+   ++L+T G Y++++ +WDL T   V  L  H   V  +    D + LIT
Sbjct: 295 DTVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTLIT 354

Query: 373 GSLDRMIRVWNYVTG------------ACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVK 420
           GS D  +++W+                +C+  +  H+  + SV    + ++S S DK+++
Sbjct: 355 GSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSYDNEYLLSASRDKSIR 414

Query: 421 VWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCF--------SGSDDTTIRMWDIRSNTCV 471
            W + +  C  TL           +   +            +GS D  IR+WD+RS   V
Sbjct: 415 QWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGIIRLWDLRSGKVV 474

Query: 472 KVFRGHVGQVQKVLPLTIL--DTENLVTDRT 500
           +    H G      P+T L  D+  ++T  T
Sbjct: 475 RTLLKHQG------PITSLQFDSTKIITGST 499

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 56/122 (45%), Gaps = 10/122 (8%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTG---HRDG------- 359
           I  F+ H   + S+ ++   L + S D ++  WDL TG  V+ L     H  G       
Sbjct: 384 INTFEAHTAEITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDST 443

Query: 360 VKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTV 419
           V+A+   G  L TGS D +IR+W+  +G  V     H   + S+      I++GS D  +
Sbjct: 444 VEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDANI 503

Query: 420 KV 421
            V
Sbjct: 504 SV 505

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 58/104 (55%), Gaps = 5/104 (4%)

Query: 320 VLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMI 379
           V +LQ     L TGS D  + +WDL +GK+VR L  H+  + ++ FD  K+ITGS D  I
Sbjct: 444 VEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDANI 503

Query: 380 RVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKV 421
            V +  TG  +  Y  H D+ ++   ++  K++V+    K V+V
Sbjct: 504 SVSDLRTGNILETY--HCDAPINTFDFENDKLVVAADT-KDVRV 544

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 7/113 (6%)

Query: 316 HMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDG-VKAIYFDGQKLITGS 374
           H   + SLQF+   + TGS D+ +++ DL TG ++   T H D  +    F+  KL+  +
Sbjct: 480 HQGPITSLQFDSTKIITGSTDANISVSDLRTGNILE--TYHCDAPINTFDFENDKLVVAA 537

Query: 375 LDRMIRVWNYVTGA---CVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHV 424
             + +RV N   G+   C    P  S +V SV   KK+++ G ++  + +WH+
Sbjct: 538 DTKDVRVINRNNGSHWNCDIKVPDESTTV-SVKLKKKLMIEGRSNGVINLWHI 589

>Kwal_0.212
          Length = 303

 Score = 79.7 bits (195), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 120/309 (38%), Gaps = 38/309 (12%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRM-IRVWNYVTG 387
           +L +  YD T+  W+  TG   R +      V  +     K    +   + +R+++  T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63

Query: 388 AC--VAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVK 443
               V ++ GH  +V S+      K +VS S D T+KVW V + +      H   V  V 
Sbjct: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123

Query: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDP 503
           +HP      S   D  +R+WD+  N CV     H    +   PL  L   +  +   +  
Sbjct: 124 IHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAGN 178

Query: 504 PRNEATTAQDPPDGQLSALDDSLPYP--------------------SHLLSCSLDNTIKL 543
            +      Q P        D + P P                     HL +CS D+T ++
Sbjct: 179 NKGNCYVWQMP-----HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARV 233

Query: 544 WEVRTGKCVRTHF-GHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQA 600
           W +     + T    H   +WD A  AD+  +V+   D  V++WDL + + +  +  H  
Sbjct: 234 WSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHK 293

Query: 601 PITCVGIGD 609
              CV + D
Sbjct: 294 GAICVALND 302

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 15/173 (8%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK--AIYF 365
           +  F+GH   V S+ F    + + + S D T+ +WD+     V+R   H+  V    I+ 
Sbjct: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHP 126

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDS---VLSVDSYKKIIVSGSADKTVKVW 422
           +  +LI+   D  +R+W+     CV       D+    LSV S   ++V+G+      VW
Sbjct: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186

Query: 423 HVESRT-------CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN 468
            +  +T           R H +++  V L        + S D T R+W I  N
Sbjct: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 77.8 bits (190), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 120/305 (39%), Gaps = 30/305 (9%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRM-IRVWNYVTG 387
           +L +  YD T+  W+  TG   R +      V  +     K    +   + +R+++  T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAAGHLHVRMYDIRTT 63

Query: 388 AC--VAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVK 443
               V ++ GH  +V S+      K +VS S D T+KVW V S +      H   V  V 
Sbjct: 64  NPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVV 123

Query: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLV------- 496
           +HP      S   D  I++WD+  N C            + L +   D   LV       
Sbjct: 124 IHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIA-SDGSMLVAGNNKGN 182

Query: 497 ---------TDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVR 547
                    TD  S  P  +  +        L ++D       HL +CS D+T ++W V 
Sbjct: 183 CYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVD-----VKHLATCSADHTARVWSVE 237

Query: 548 TGKCVRTHF-GHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITC 604
               + T    H   +WD A  AD+  +V+   D  V++WDL + + +  +  H     C
Sbjct: 238 DNFQLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVC 297

Query: 605 VGIGD 609
           V + D
Sbjct: 298 VALND 302

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 86/227 (37%), Gaps = 62/227 (27%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK--AIYF 365
           +  F+GH   V S+ F  + + + + S D T+ +WD+ +   V+R   H   V    I+ 
Sbjct: 68  VTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPS-VQRNYKHDAPVNEVVIHP 126

Query: 366 DGQKLITGSLDRMIRVWNYVTGAC----------------------------------VA 391
           +  +LI+   D  I++W+     C                                  V 
Sbjct: 127 NQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKGNCYVW 186

Query: 392 AYPGHSDS-------------------VLSVDSYKKIIVSGSADKTVKVWHVES--RTCY 430
             P H+D+                   +LSVD   K + + SAD T +VW VE   +   
Sbjct: 187 KMPNHTDTASLKPVTKFRSHSKYITRVLLSVDV--KHLATCSADHTARVWSVEDNFQLET 244

Query: 431 TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           TL  H+ WV        S    +   D  +R+WD+ +   V+ + GH
Sbjct: 245 TLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 47/134 (35%), Gaps = 50/134 (37%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRT------------------------------------- 554
           L S   D+TI+ WE  TG C RT                                     
Sbjct: 5   LASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAAGHLHVRMYDIRTTN 64

Query: 555 ---------HFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
                    H G+V  I     DN  +VS + D T+KVWD++S      +  H AP+  V
Sbjct: 65  PNPVTSFEGHRGNVTSI-AFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNY-KHDAPVNEV 122

Query: 606 GI--GDSEFVSGDE 617
            I     E +S D+
Sbjct: 123 VIHPNQGELISCDQ 136

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 135/318 (42%), Gaps = 56/318 (17%)

Query: 325 FNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNY 384
           FNY +        T AI  +         T + +  K  Y     ++T S D  I V+ +
Sbjct: 185 FNYTIPLASLQSHTKAITSMDV-----LFTNYTNSSKKNYL---VIVTASKDLQIHVFKW 236

Query: 385 VTGAC----VAAYPGHSDSVLSVDSYKKI----IVSGSADKTVKVWHVES-RTCYTLRGH 435
           V+  C    + +  GH   V +V  ++K     I S S D+TVK+W   +  +  T + H
Sbjct: 237 VSEECKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPH 296

Query: 436 TEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENL 495
           ++WV ++ +        SGS DTT+R+    S   + V  GH   ++KV  +  ++    
Sbjct: 297 SQWVRSIDVLGDYI--ISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHFIEDSPE 354

Query: 496 VTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV--------- 546
           +  RT    R +    Q                  + +S S D TIK+WE+         
Sbjct: 355 IRFRTPSTDRYKNWGMQ------------------YCVSASRDRTIKIWEIPLPTLMAHR 396

Query: 547 --------RTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDS- 597
                      +CV T  GH+  + DI+     + S A DK+V+ WDL +G+C+H ++  
Sbjct: 397 APIPNPTDSNFRCVLTLKGHLSWVRDISIRGQYLFSCADDKSVRCWDLNTGQCLHVWEKL 456

Query: 598 HQAPITCVGIGDSEFVSG 615
           H   + C+ + D +F S 
Sbjct: 457 HTGFVNCLDL-DVDFDSN 473

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 79/198 (39%), Gaps = 52/198 (26%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHR---DGVKAIYFD 366
           ++ F+ H   V S+      + +GS+D+T+ +    +G  +   TGH    + VK I+F 
Sbjct: 290 LKTFQPHSQWVRSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHF- 348

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK----KIIVSGSADKTVKVW 422
                                  +   P       S D YK    +  VS S D+T+K+W
Sbjct: 349 -----------------------IEDSPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIW 385

Query: 423 HV------------------ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWD 464
            +                    R   TL+GH  WV  + +  +    FS +DD ++R WD
Sbjct: 386 EIPLPTLMAHRAPIPNPTDSNFRCVLTLKGHLSWVRDISIRGQYL--FSCADDKSVRCWD 443

Query: 465 IRSNTCVKVF-RGHVGQV 481
           + +  C+ V+ + H G V
Sbjct: 444 LNTGQCLHVWEKLHTGFV 461

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 60/152 (39%), Gaps = 20/152 (13%)

Query: 245 GWGLPLLHMKRARFIEPPAE------SKPGQKGAGNPPVASETTTRKTRPWKV----IYR 294
           G   P+  +K   FIE   E      S    K  G     S +  R  + W++    +  
Sbjct: 335 GHEFPIEKVKFIHFIEDSPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLMA 394

Query: 295 ERFKVESNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLV---- 350
            R  + +        +   KGH+  V  +    + LF+ + D +V  WDL TG+ +    
Sbjct: 395 HRAPIPNPTDSNFRCVLTLKGHLSWVRDISIRGQYLFSCADDKSVRCWDLNTGQCLHVWE 454

Query: 351 RRLTGHRDGVKA-IYFDG-----QKLITGSLD 376
           +  TG  + +   + FD      Q ++TG LD
Sbjct: 455 KLHTGFVNCLDLDVDFDSNVTPRQMMVTGGLD 486

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 101/240 (42%), Gaps = 41/240 (17%)

Query: 286 TRPWKVIYRERFKVES-NWRKGTAHIQEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIW 342
           +RPW ++      ++  ++R G   +  F+ H   V  + F+    L  +   D T+ +W
Sbjct: 22  SRPWVLVALFSSTIQLWDYRMGVL-LHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVW 80

Query: 343 DLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSV 400
            L + K +  L GH D V+ ++F  +   +I+ S D+ IR+WN+     +A   GH+  V
Sbjct: 81  SLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFV 140

Query: 401 LSVDSY--KKIIVSGSADKTVKVWHVESR------------------------------- 427
           +    +  + ++VS S D+TV+VW +                                  
Sbjct: 141 MCAQFHPVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCV 200

Query: 428 TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC--VKVFRGHVGQVQKVL 485
             + L GHT  V     HP      SGSDD  +++W + +     V   RGH   V  V+
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVI 260

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 116/291 (39%), Gaps = 44/291 (15%)

Query: 348 KLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDS 405
           K++ +        K I F   +  ++       I++W+Y  G  +  +  H   V  +D 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDF 61

Query: 406 Y--KKIIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
           +  + + VS   D T+KVW +ES  C +TL GH ++V TV  H +     S SDD TIR+
Sbjct: 62  HPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRI 121

Query: 463 WDIRSNTCVKVFRGH-----VGQVQKVLPLTI---LDTENLVTDRTSDPPRNEATTAQDP 514
           W+ ++   +    GH       Q   V  L +   LD    V D +    R+ A   Q  
Sbjct: 122 WNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSF 181

Query: 515 PD---GQLSALDDSL----------------------PYPSHLLSCSLDNTIKLWEVRTG 549
            +    Q + LD                         P    ++S S D  +KLW +   
Sbjct: 182 EEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSAT 241

Query: 550 KC-----VRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTF 595
           K       R H  +V+ +      N  I+S   DKTV+VWDL     I  F
Sbjct: 242 KAWEVDTCRGHTNNVDSVIFHPQQNL-IISVGEDKTVRVWDLDKRTPIKQF 291

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 90/200 (45%), Gaps = 39/200 (19%)

Query: 315 GHMDGVLSLQFNYRL--LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--L 370
           GH+D V ++ F++ L  + + S D T+ IW+    K +  LTGH   V    F   +  +
Sbjct: 93  GHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLV 152

Query: 371 ITGSLDRMIRVWNYV----------------------------TGACVAAY--PGHSDSV 400
           ++ SLD  +RVW+                               G CV  +   GH+  V
Sbjct: 153 VSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGV 212

Query: 401 --LSVDSYKKIIVSGSADKTVKVWHVESRTCY---TLRGHTEWVGTVKLHPKSFTCFSGS 455
              S      +IVSGS D+ VK+W + +   +   T RGHT  V +V  HP+     S  
Sbjct: 213 NWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQNLIISVG 272

Query: 456 DDTTIRMWDIRSNTCVKVFR 475
           +D T+R+WD+   T +K F+
Sbjct: 273 EDKTVRVWDLDKRTPIKQFK 292

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 532 LLSCSLDNTIKLWEVRTGKCV---RTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQS 588
           +L     +TI+LW+ R G  +     H G V GI D        VS   D T+KVW L+S
Sbjct: 26  VLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGI-DFHPTQPLFVSAGDDYTIKVWSLES 84

Query: 589 GKCIHTFDSH 598
            KC+ T D H
Sbjct: 85  NKCLFTLDGH 94

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 58/173 (33%), Gaps = 57/173 (32%)

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTS 501
           +  HP           +TI++WD R    +  F  H G V+ +                 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGI----------------- 59

Query: 502 DPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKC---------- 551
                                 D  P     +S   D TIK+W + + KC          
Sbjct: 60  ----------------------DFHPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDY 97

Query: 552 VRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITC 604
           VRT F H E  W        I+S + D+T+++W+ Q+ K I     H   + C
Sbjct: 98  VRTVFFHHELPW--------IISSSDDQTIRIWNWQNRKEIACLTGHNHFVMC 142

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSE--FVS-GDE 617
           ++      T+++WD + G  +H F+ H+ P+  +    ++  FVS GD+
Sbjct: 26  VLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDFHPTQPLFVSAGDD 74

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 92/205 (44%), Gaps = 22/205 (10%)

Query: 313 FKGHMDGVLSLQFNY---RLLFTGSYDSTVAIWDLAT-----GKLVRRLTGHRDGVK--A 362
            +GH   V SL  +     LL + S D T+  W L       G  V+   GH   V+   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDCT 72

Query: 363 IYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVK 420
           +  +G   ++GS D+ +R+W+  TG     + GH   V+SV  D    +I+SGS DK++K
Sbjct: 73  LTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIK 132

Query: 421 VWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
           VW ++     TL GH +WV  V++   S       DD  + +    ++  VKV      +
Sbjct: 133 VWSIKGDCLATLIGHNDWVSQVRIANSS------DDDDKVTVISAGNDKMVKVLWNSAAK 186

Query: 481 VQKVLPLTILDTENLVTDRTSDPPR 505
           V    P+  L   + V   +  P R
Sbjct: 187 V----PMYTLSAGDEVYALSFSPNR 207

 Score = 63.9 bits (154), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 90/221 (40%), Gaps = 64/221 (28%)

Query: 310 IQEFKGHMDGV--LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD- 366
           ++ FKGH   V   +L  N     +GS+D T+ +WD+ATG+  +   GH+  V ++  D 
Sbjct: 58  VKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDK 117

Query: 367 -GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV-------DSYKKIIVSGSADKT 418
               +I+GS D+ I+VW+ + G C+A   GH+D V  V       D  K  ++S   DK 
Sbjct: 118 KASMIISGSRDKSIKVWS-IKGDCLATLIGHNDWVSQVRIANSSDDDDKVTVISAGNDKM 176

Query: 419 VKV-WHVESRT-CYTLRGHTEWVGTVKLHPKSF--------------------------- 449
           VKV W+  ++   YTL    E V  +   P  +                           
Sbjct: 177 VKVLWNSAAKVPMYTLSAGDE-VYALSFSPNRYWLCAATASGIKIFSLDPQCLLDDLKPE 235

Query: 450 ----------------------TCFSGSDDTTIRMWDIRSN 468
                                 T F+G  D  IR+W + ++
Sbjct: 236 FAGYTQSAEPHAVSLAWSSDGQTLFAGYTDNVIRVWQVMTS 276

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 77/189 (40%), Gaps = 48/189 (25%)

Query: 431 TLRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMW-----DIRSNTCVKVFRGHVGQVQKV 484
           TL GH  WV ++     +     S S D T+  W     D +    VK F+GH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDC 71

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                  TEN                                   ++ LS S D T++LW
Sbjct: 72  TL-----TEN----------------------------------GAYALSGSWDKTLRLW 92

Query: 545 EVRTGKCVRTHFGHVEGIWDIAADN--FRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPI 602
           +V TG+  +T  GH   +  +A D     I+SG+ DK++KVW ++ G C+ T   H   +
Sbjct: 93  DVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWSIK-GDCLATLIGHNDWV 151

Query: 603 TCVGIGDSE 611
           + V I +S 
Sbjct: 152 SQVRIANSS 160

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 117/260 (45%), Gaps = 41/260 (15%)

Query: 347 GKLVRRLTGHRDGVKAIYFDGQKLI---TGSLDRMIRVWNYVTGACVAAYPGHSDSVLS- 402
           G+L + L  H D + ++  + Q  +   T +LD  I++W+  T  C+    GH  +V + 
Sbjct: 270 GQLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTT 329

Query: 403 --VDSYKKIIVSGSADKTVKVWHVES----------RTCY-TLRGHTEWVGTVKLHPKSF 449
             +D   +++ S   D +VKVW V++            C  T  GH + V    L     
Sbjct: 330 RFIDD-TRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSV--TALATTGN 386

Query: 450 TCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEAT 509
              SGS+D T+R WD+ S  C++     +    K++P +       V+     P  N   
Sbjct: 387 AIVSGSNDKTLRHWDLGSGKCIQSIDLTIAL--KMVPQS-------VSKLDITPSFNT-- 435

Query: 510 TAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADN 569
               P  G    +D++L      ++ + D  + LW++R G+ V +  GH   I  +    
Sbjct: 436 ----PLIGGADCIDNAL------VTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMG 485

Query: 570 FRIVSGAHDKTVKVWDLQSG 589
             +++G+ DK+ ++WDL+ G
Sbjct: 486 SELITGSMDKSTRIWDLRMG 505

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 123/310 (39%), Gaps = 78/310 (25%)

Query: 311 QEFKGHMDGVLSLQFNYRLLF---TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           +  K H D + SL  N +L     T + D+ + +WD++T + +  L+GHR  V    F  
Sbjct: 274 KTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFID 333

Query: 366 DGQKLITGSLDRMIRVW----------NYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSA 415
           D + L +   D  ++VW          N     C+A + GH DSV ++ +    IVSGS 
Sbjct: 334 DTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSN 393

Query: 416 DKTVKVWHVESRTC-------YTLRGHTEWVGTVKLHPKSFT------------CFSGSD 456
           DKT++ W + S  C         L+   + V  + + P   T              +G+ 
Sbjct: 394 DKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCIDNALVTGTK 453

Query: 457 DTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPD 516
           D  + +WD+R    V    GH G      P+T                            
Sbjct: 454 DGIVYLWDLRIGRVVGSLEGHRG------PIT---------------------------- 479

Query: 517 GQLSALDDSLPY-PSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSG 575
                   SL Y  S L++ S+D + ++W++R G  V       + +  +     ++++ 
Sbjct: 480 --------SLKYMGSELITGSMDKSTRIWDLRMG-SVAELLSFEKEVVSVEESQTQLINA 530

Query: 576 AHDKTVKVWD 585
              + VK++D
Sbjct: 531 LEGEPVKIYD 540

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 74/177 (41%), Gaps = 50/177 (28%)

Query: 431 TLRGHTEWVGTVKLHPKSFTCFSGSD-DTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTI 489
           TL+ H +++ ++ ++ +     S ++ D  I++WDI +  C+ V  GH   V        
Sbjct: 275 TLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVN------- 327

Query: 490 LDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV--- 546
                  T R  D  R  A+  +D                          ++K+W+V   
Sbjct: 328 -------TTRFIDDTRLLASAGKDA-------------------------SVKVWDVDNI 355

Query: 547 -------RTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFD 596
                      C+ T  GH + +  +A     IVSG++DKT++ WDL SGKCI + D
Sbjct: 356 VDKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSID 412

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 12/94 (12%)

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDLQS--- 588
           + +LDN IKLW++ T +C+    GH   +       D   + S   D +VKVWD+ +   
Sbjct: 298 TANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDVDNIVD 357

Query: 589 -------GKCIHTFDSHQAPITCVGIGDSEFVSG 615
                    C+ TFD H+  +T +    +  VSG
Sbjct: 358 KDGNANDNLCLATFDGHKDSVTALATTGNAIVSG 391

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV 360
           +   +GH   + SL++    L TGS D +  IWDL  G +   L+  ++ V
Sbjct: 468 VGSLEGHRGPITSLKYMGSELITGSMDKSTRIWDLRMGSVAELLSFEKEVV 518

>Kwal_26.8953
          Length = 458

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/327 (24%), Positives = 140/327 (42%), Gaps = 61/327 (18%)

Query: 329 LLFTGSYDSTVAIWDLATGKL-VRRLTGHRDGVKAIYF----DGQKLI-TGSLDRMIRVW 382
           L+F  +    +  +DL    + V  +  H  G+ +I      D Q  + T S D   +V+
Sbjct: 142 LVFAATDSGKLLCYDLMNYTMPVASVQAHMRGITSIDVHIDDDSQCFVATASKDLHCKVF 201

Query: 383 NYVTGAC--VAAYPGHSDSVLSVDSYKK----IIVSGSADKTVKVWHVES-RTCYTLRGH 435
             +      V  + GH   V  +  +K     ++ S S D T K+  V +     + + H
Sbjct: 202 RLINSELQLVRTFSGHEHIVSHIKIWKNATDTLVASCSRDLTCKIGDVSNGYFLKSFQPH 261

Query: 436 TEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQ--KVLPLTILDTE 493
            EWV ++ +  +     +GS+D T+R+    +   +    GH   V+  K++P+      
Sbjct: 262 AEWVRSLDIMGEYI--ITGSNDCTVRVSHWPTGRALSFGIGHDFPVEQVKIIPM------ 313

Query: 494 NLVTDRTSDPPRNEATTAQDPPDGQLSALD-DSLPYP-SHLLSCSLDNTIKLWEVRTGKC 551
                        E + + DP +   SA + D LP   SH++SCS DNT+++W+V   + 
Sbjct: 314 -------------ELSESDDPQNNTYSAFNKDYLPLGFSHVVSCSRDNTLRIWQVPIPRL 360

Query: 552 V----------RTHF-------GHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHT 594
           +          R HF       GH   + DI      I+S + D++V+VWDL++G+ +  
Sbjct: 361 IAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRVRGNFIISCSDDRSVRVWDLETGETVRE 420

Query: 595 F-DSHQAPITCV-----GIGDSEFVSG 615
             DSH     C+     G+     VSG
Sbjct: 421 ITDSHTGFANCIDTDCGGLNRQLLVSG 447

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 94/219 (42%), Gaps = 51/219 (23%)

Query: 310 IQEFKGHMDGVLSLQF----NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF 365
           ++ F GH   V  ++        L+ + S D T  I D++ G  ++    H + V+++  
Sbjct: 211 VRTFSGHEHIVSHIKIWKNATDTLVASCSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDI 270

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV---------------DSYKKI- 409
            G+ +ITGS D  +RV ++ TG  ++   GH   V  V               ++Y    
Sbjct: 271 MGEYIITGSNDCTVRVSHWPTGRALSFGIGHDFPVEQVKIIPMELSESDDPQNNTYSAFN 330

Query: 410 ----------IVSGSADKTVKVWHV--------------ESRTCY----TLRGHTEWVGT 441
                     +VS S D T+++W V               +R  +    TL+GH+ WV  
Sbjct: 331 KDYLPLGFSHVVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRD 390

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVK-VFRGHVG 479
           +++  +     S SDD ++R+WD+ +   V+ +   H G
Sbjct: 391 IRV--RGNFIISCSDDRSVRVWDLETGETVREITDSHTG 427

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 54/123 (43%), Gaps = 23/123 (18%)

Query: 323 LQFNYRLLFTGSYDSTVAIWDL-----------------ATGKLVRRLTGHRDGVKAIYF 365
           L   +  + + S D+T+ IW +                 A   LV+ L GH   V+ I  
Sbjct: 334 LPLGFSHVVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRV 393

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYP-GHSDSVLSVDS-----YKKIIVSGSADKTV 419
            G  +I+ S DR +RVW+  TG  V      H+     +D+      ++++VSG AD  V
Sbjct: 394 RGNFIISCSDDRSVRVWDLETGETVREITDSHTGFANCIDTDCGGLNRQLLVSGGADGKV 453

Query: 420 KVW 422
            V+
Sbjct: 454 IVY 456

 Score = 35.8 bits (81), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIY----- 364
           ++  KGH   V  ++     + + S D +V +WDL TG+ VR +T    G          
Sbjct: 378 VKTLKGHSSWVRDIRVRGNFIISCSDDRSVRVWDLETGETVREITDSHTGFANCIDTDCG 437

Query: 365 -FDGQKLITGSLDRMIRVW 382
             + Q L++G  D  + V+
Sbjct: 438 GLNRQLLVSGGADGKVIVY 456

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%)

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIH 593
           SCS D T K+ +V  G  +++   H E +  +      I++G++D TV+V    +G+ + 
Sbjct: 237 SCSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDIMGEYIITGSNDCTVRVSHWPTGRALS 296

Query: 594 TFDSHQAPITCVGIGDSEFVSGDE 617
               H  P+  V I   E    D+
Sbjct: 297 FGIGHDFPVEQVKIIPMELSESDD 320

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 112/250 (44%), Gaps = 23/250 (9%)

Query: 335 YDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAA 392
           Y   + IW+  T   VR +      V+A  F  +K  ++ GS D  +RV+NY TG  V  
Sbjct: 33  YSGRIEIWNYETQTQVRSIPLCDAPVRAGRFIARKNWVVVGSDDFKLRVYNYNTGEKVTE 92

Query: 393 YPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESR-TCY-TLRGHTEWVGTVKLHPKS 448
           +  H D +  ++V   K  +++GS D T+K+W+ E    C  T  GH  +V +V  +PK 
Sbjct: 93  FEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKD 152

Query: 449 FTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQ-VQKVLPLTILDTENLVTDRTSD---- 502
              F SG  D TI++W I  +      + H  + V  V    + D   L+T  TSD    
Sbjct: 153 PNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNYVDYYPLQDKPYLIT--TSDDGTI 210

Query: 503 ------PPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHF 556
                    N AT      +   +    +LP    ++S S D T+K+W   T K  +T  
Sbjct: 211 KVWDYQTKSNVATLEGHMANVSYAVFHPTLPI---IISGSEDGTLKIWNANTYKLEKTLN 267

Query: 557 GHVEGIWDIA 566
             +E  W IA
Sbjct: 268 IGLERSWCIA 277

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 121/268 (45%), Gaps = 29/268 (10%)

Query: 351 RRLTGHRDGVKAIYFDGQK---LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY- 406
           ++L+   D VK I F  ++   LIT    R I +WNY T   V + P   D+ +    + 
Sbjct: 7   KKLSARTDRVKGIDFHPEEPWVLITLYSGR-IEIWNYETQTQVRSIP-LCDAPVRAGRFI 64

Query: 407 --KKIIVSGSADKTVKVWHVESRTCYT-LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
             K  +V GS D  ++V++  +    T    H +++ ++ +HP      +GSDD TI++W
Sbjct: 65  ARKNWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLW 124

Query: 464 DIRSN-TCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSAL 522
           +   N  C + F GH   V  V      D  N       D      +  QD P+  L A 
Sbjct: 125 NWEKNWGCQQTFTGHEHFVMSV-AFNPKDP-NQFASGCLDHTIKVWSIGQDVPNFTLKAH 182

Query: 523 D-------DSLPYPS--HLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-- 571
           +       D  P     +L++ S D TIK+W+ +T   V T  GH+    +++   F   
Sbjct: 183 ETKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMA---NVSYAVFHPT 239

Query: 572 ---IVSGAHDKTVKVWDLQSGKCIHTFD 596
              I+SG+ D T+K+W+  + K   T +
Sbjct: 240 LPIIISGSEDGTLKIWNANTYKLEKTLN 267

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 88/181 (48%), Gaps = 17/181 (9%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTG 387
           +  GS D  + +++  TG+ V     H D +++I     K  ++TGS D  I++WN+   
Sbjct: 70  VVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKN 129

Query: 388 -ACVAAYPGHSDSVLSVDSYKKI---IVSGSADKTVKVWHV-ESRTCYTLRGH-TEWVGT 441
             C   + GH   V+SV    K      SG  D T+KVW + +    +TL+ H T+ V  
Sbjct: 130 WGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNY 189

Query: 442 VKLHP---KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV-----QKVLPLTILDTE 493
           V  +P   K +   + SDD TI++WD ++ + V    GH+  V        LP+ I  +E
Sbjct: 190 VDYYPLQDKPY-LITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAVFHPTLPIIISGSE 248

Query: 494 N 494
           +
Sbjct: 249 D 249

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 64/139 (46%), Gaps = 18/139 (12%)

Query: 302 NWRKGTAHIQEFKGHMDGVLSLQFNYR---LLFTGSYDSTVAIWDLATGKLVRRLTGHR- 357
           NW K     Q F GH   V+S+ FN +      +G  D T+ +W +        L  H  
Sbjct: 125 NWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHET 184

Query: 358 DGVKAIYF----DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK------ 407
            GV  + +    D   LIT S D  I+VW+Y T + VA   GH  +V    SY       
Sbjct: 185 KGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANV----SYAVFHPTL 240

Query: 408 KIIVSGSADKTVKVWHVES 426
            II+SGS D T+K+W+  +
Sbjct: 241 PIIISGSEDGTLKIWNANT 259

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 4/77 (5%)

Query: 527 PYPSHLLSCSLDNTIKLWE-VRTGKCVRTHFGHVEGIWDIA---ADNFRIVSGAHDKTVK 582
           P    +L+ S D TIKLW   +   C +T  GH   +  +A    D  +  SG  D T+K
Sbjct: 107 PTKPFVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIK 166

Query: 583 VWDLQSGKCIHTFDSHQ 599
           VW +       T  +H+
Sbjct: 167 VWSIGQDVPNFTLKAHE 183

>Kwal_23.5351
          Length = 474

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 109/250 (43%), Gaps = 49/250 (19%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPG-HSDSVLSV--DSYKKIIVSGSADKTVKVW 422
           DG  L  GS +  +++ +  +   V +  G H D +  V   S  +++ +G AD  VK+W
Sbjct: 193 DGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIW 252

Query: 423 HVESRTC-----YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           + ++++        LRGH   V  VK HP      S S D T R+WD+   T +++  GH
Sbjct: 253 NPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGH 312

Query: 478 VGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSL 537
             +V        LD +                      DG L            L S  L
Sbjct: 313 AKEV------YCLDFQ---------------------CDGSL------------LCSAGL 333

Query: 538 DNTIKLWEVRTGKCVRTHFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDLQSGKCIHTF 595
           D+   +W++RTG+ +    GH + I+ +  + +   + +G+ D TV+VWD++      + 
Sbjct: 334 DSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSI 393

Query: 596 DSHQAPITCV 605
            +H + ++ V
Sbjct: 394 LAHNSIVSEV 403

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 79/162 (48%), Gaps = 8/162 (4%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           +Q  +GH   V  L F  +  LL +   DS   +WD+ TG+ +  L GH   +  + +  
Sbjct: 306 LQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSP 365

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVW 422
           +G  + TGS D  ++VW+       ++   H+  V  V+  K+    +VS S D+T+ V+
Sbjct: 366 NGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVF 425

Query: 423 HVESRT-CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
              S     +L+GHT+ + +V +       +S   D ++++W
Sbjct: 426 ATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIW 467

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 313 FKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD---G 367
            +GH   +  + +  N   + TGS D TV +WD+        +  H   V  + F+   G
Sbjct: 351 LEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENG 410

Query: 368 QKLITGSLDRMIRVWNYVTGACV--AAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWH 423
             L++ S DR I V  + TG+ +  A+  GH+D +LSVD  +    + S   D++VK+W 
Sbjct: 411 NFLVSSSYDRTIGV--FATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWA 468

Query: 424 VESRT 428
           +  R+
Sbjct: 469 LGVRS 473

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 109/281 (38%), Gaps = 53/281 (18%)

Query: 319 GVLSLQFNYRLLFTGSYDSTVAIWD------LATGKLVRRLTGHRDGVKAIYF--DGQKL 370
           G ++   + +LL TG  D+ V IW+          ++V  L GH   V  + F    + +
Sbjct: 229 GGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVV--LRGHEARVSKVKFHPSDRFV 286

Query: 371 ITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKTVKVWHVES-R 427
            + S D   R+W+      +    GH+  V  +D      ++ S   D    VW + + R
Sbjct: 287 ASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGR 346

Query: 428 TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPL 487
           +   L GH + +  V   P      +GS D T+++WDIR                   P 
Sbjct: 347 SLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANK---------------PS 391

Query: 488 TILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVR 547
           +IL   ++V++   +                           + L+S S D TI ++   
Sbjct: 392 SILAHNSIVSEVNFEKENG-----------------------NFLVSSSYDRTIGVFATG 428

Query: 548 TGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVKVWDL 586
           +   + +  GH + I   DI+     + S   D++VK+W L
Sbjct: 429 SWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/319 (24%), Positives = 127/319 (39%), Gaps = 32/319 (10%)

Query: 318 DGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YFDGQKLITGSLD 376
           D V SL      +++GSYD  V  ++L+ GK+ ++ +GH   ++A+ Y    +L++   D
Sbjct: 104 DWVSSLDVGSNYIYSGSYDGIVRTYNLS-GKVEKQYSGHSGPIRAVHYISSTRLVSAGND 162

Query: 377 RMIRVWNYVT-------------GACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWH 423
           R +R+W                 G  +A   GH   V+S+D  K  I+S S D TV +W 
Sbjct: 163 RTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASCDNTVSLWS 222

Query: 424 VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQK 483
              +    +    +  G V    K           T++   IR    + +F  H   V+ 
Sbjct: 223 TNYKEMTVIDPMEDLGGNVSTAAKKRRKL------TLKDGSIRRRAPLALFESHSAPVEA 276

Query: 484 VLPLTILDTENLVTDRTSDPPRNEATTAQ--DPPDGQLSALDDSLPYPSHLLSC-SLDNT 540
           V+     DT      +       +  TA+  D      S L  +     +LL+C S    
Sbjct: 277 VIFDKSDDTVGYSVSQDHTIKTWDLITAKCVDTKTTSYSLLSVAQLPKLNLLACGSSARH 336

Query: 541 IKLWEVRTGKCVRT-------HFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIH 593
           I L + R     +        H   V  +     + + I S +HD TVKVWD++S   ++
Sbjct: 337 ITLHDPRVNSSSKITQQQLVGHKNFVVALDTCPENEYMICSASHDGTVKVWDVRSNTAMY 396

Query: 594 TFDSHQAPITCVGIGDSEF 612
           T       +   G+ D  F
Sbjct: 397 TITREDKNV-VKGVNDKVF 414

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 96/241 (39%), Gaps = 47/241 (19%)

Query: 277 VASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYD 336
           + S    R  R WK    +   ++    +    +   +GH   V+S+  +   + + S D
Sbjct: 156 LVSAGNDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASCD 215

Query: 337 STVAIWD------------------------------LATGKLVRR-----LTGHRDGVK 361
           +TV++W                               L  G + RR        H   V+
Sbjct: 216 NTVSLWSTNYKEMTVIDPMEDLGGNVSTAAKKRRKLTLKDGSIRRRAPLALFESHSAPVE 275

Query: 362 AIYFDGQKLITG---SLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK--IIVSGSAD 416
           A+ FD      G   S D  I+ W+ +T  CV      S S+LSV    K  ++  GS+ 
Sbjct: 276 AVIFDKSDDTVGYSVSQDHTIKTWDLITAKCVDT-KTTSYSLLSVAQLPKLNLLACGSSA 334

Query: 417 KTVKVW--HVESRTCYT---LRGHTEWVGTVKLHPKS-FTCFSGSDDTTIRMWDIRSNTC 470
           + + +    V S +  T   L GH  +V  +   P++ +   S S D T+++WD+RSNT 
Sbjct: 335 RHITLHDPRVNSSSKITQQQLVGHKNFVVALDTCPENEYMICSASHDGTVKVWDVRSNTA 394

Query: 471 V 471
           +
Sbjct: 395 M 395

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 60/129 (46%), Gaps = 22/129 (17%)

Query: 507 EATTAQDPPDGQLSALDD-----SLPYPS-HLLSCSLDNTIKLWEVRTGKCVRTHFGHVE 560
           E T A  PP   LS+ D+     SL   S ++ S S D  ++ + + +GK  + + GH  
Sbjct: 86  EYTRAVLPP-SYLSSFDNEDWVSSLDVGSNYIYSGSYDGIVRTYNL-SGKVEKQYSGHSG 143

Query: 561 GIWDI-AADNFRIVSGAHDKTVKVW-------------DLQSGKCIHTFDSHQAPITCVG 606
            I  +    + R+VS  +D+T+++W             +++ GK +   + H+AP+  + 
Sbjct: 144 PIRAVHYISSTRLVSAGNDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSID 203

Query: 607 IGDSEFVSG 615
           +     +S 
Sbjct: 204 VSKDRILSA 212

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 126/298 (42%), Gaps = 58/298 (19%)

Query: 334 SYDSTVAIW---DLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIR-VWNYVTG 387
           S D TV +W   D   G +V    G    + ++ +D +K  L+ G  D MI  V  + T 
Sbjct: 31  SRDGTVRLWSKDDQWLGTVVYTGQGF---LNSVCYDSEKELLLFGGKDTMINGVPLFATS 87

Query: 388 ACVAAYP--GHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLH 445
                Y   GH  +V S+     +++SGS DKT KVW  E    Y L+ H   V   K+ 
Sbjct: 88  GEDPLYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWK-EGSLVYNLQAHNASVWDAKVV 146

Query: 446 PKSFTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPP 504
             S   F + S D TI++W  +++  +K F G    V +                     
Sbjct: 147 SFSENKFLTASADKTIKLW--QNDKVIKTFSGIHNDVVR--------------------- 183

Query: 505 RNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWD 564
                         L+ +DD      H +SCS D  IKL ++ TG  +RT+ GH   ++ 
Sbjct: 184 -------------HLAVVDDG-----HFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYC 225

Query: 565 IA-ADNFRIVSGAHDKTVKVWDLQSG--KCIHTFDSHQA-PITCVGIGDSEFVSGDEL 618
           I    N  IVS   D+TV++W  ++G  K + T  +     + C+  GD    S D L
Sbjct: 226 IKLLPNGDIVSCGEDRTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNL 283

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 75/160 (46%), Gaps = 21/160 (13%)

Query: 315 GHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV---KAIYFDGQKLI 371
           GH   V SL F   ++ +GS+D T  +W    G LV  L  H   V   K + F   K +
Sbjct: 97  GHQGNVCSLSFQDGVVISGSWDKTAKVW--KEGSLVYNLQAHNASVWDAKVVSFSENKFL 154

Query: 372 TGSLDRMIRVWNYVTGACVAAYPG-HSDSV--LSV--DSYKKIIVSGSADKTVKVWHVES 426
           T S D+ I++W       +  + G H+D V  L+V  D +    +S S D  +K+  V+ 
Sbjct: 155 TASADKTIKLWQ--NDKVIKTFSGIHNDVVRHLAVVDDGH---FISCSNDGLIKL--VDM 207

Query: 427 RTCYTLR---GHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
            T   LR   GH  +V  +KL P      S  +D T+R+W
Sbjct: 208 HTGDVLRTYEGHESFVYCIKLLPNG-DIVSCGEDRTVRIW 246

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 87/338 (25%), Positives = 144/338 (42%), Gaps = 65/338 (19%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YFDGQKLITGSLDRMI 379
           L +  ++R +++GSYD  V  W+++ GK+ ++ +GH   VKA+ Y    ++++   DR +
Sbjct: 109 LDVSDDFRHIYSGSYDGVVRTWNMS-GKVEKQYSGHTGAVKAVKYISNTRIVSAGNDRSL 167

Query: 380 RVW--------------------NYVTGACVAAYPGHSDSVLSVD-SYKKIIVSGSADKT 418
           R+W                    N   G  +A   GH   V+S+D +    I+S S D T
Sbjct: 168 RLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKAPVVSLDVASNSRILSASYDNT 227

Query: 419 VKVWHVESRTCY---TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFR 475
           V +W     T Y   T   H E +     + K  T        T++   IR    + +  
Sbjct: 228 VALW----STIYKEMTAIDHLEEIQNP--NNKISTAAKKRRKLTLKDGTIRRRAPLSLLE 281

Query: 476 GHVGQVQKVL----PLTI---------LDTENLVTDRTSDPPRNEATTAQDPPDGQLSAL 522
            H G V++V+      T+         + T +LVT R  D    + T+       Q+  L
Sbjct: 282 SHTGPVEQVIFDHGDNTVGYSVSQDHTIKTWDLVTARCID---TKTTSYPLLSIAQMPTL 338

Query: 523 DDSLPYPSHLLSC-SLDNTIKLWEVR-------TGKCVRTHFGHVEGIWDIAADNFRIVS 574
           +        LL+C S    I L + R       T K +  H   V G+   + + + + S
Sbjct: 339 N--------LLACGSSVRHITLHDPRVSSSAKITQKQLVGHKNFVVGLDTCSENEYLLCS 390

Query: 575 GAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEF 612
            +HD TVKVWD++S   ++T  + Q P    G+ D  F
Sbjct: 391 ASHDGTVKVWDVRSTSPMYTI-TRQDPTVEKGVNDKVF 427

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 58/131 (44%), Gaps = 31/131 (23%)

Query: 507 EATTAQDPP--------DGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGH 558
           E T A  PP        D  +SALD S  +  H+ S S D  ++ W + +GK  + + GH
Sbjct: 86  EYTRAVLPPSFLANFNNDDWVSALDVSDDF-RHIYSGSYDGVVRTWNM-SGKVEKQYSGH 143

Query: 559 VEGIWDIA-ADNFRIVSGAHDKTVKVW--------------------DLQSGKCIHTFDS 597
              +  +    N RIVS  +D+++++W                    +++ GK +   + 
Sbjct: 144 TGAVKAVKYISNTRIVSAGNDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEG 203

Query: 598 HQAPITCVGIG 608
           H+AP+  + + 
Sbjct: 204 HKAPVVSLDVA 214

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 86/246 (34%), Gaps = 80/246 (32%)

Query: 399 SVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDT 458
           S L V    + I SGS D  V+ W++  +      GHT  V  VK +  +    S  +D 
Sbjct: 107 SALDVSDDFRHIYSGSYDGVVRTWNMSGKVEKQYSGHTGAVKAVK-YISNTRIVSAGNDR 165

Query: 459 TIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQ 518
           ++R+W  +++                        +  V++ T D    E     +  DG+
Sbjct: 166 SLRLWKTKND------------------------DGSVSNNTGDENDEE-----NIEDGK 196

Query: 519 LSALDDSLPYP---------SHLLSCSLDNTIKLWE------------------------ 545
             A+ +    P         S +LS S DNT+ LW                         
Sbjct: 197 TLAILEGHKAPVVSLDVASNSRILSASYDNTVALWSTIYKEMTAIDHLEEIQNPNNKIST 256

Query: 546 ---------VRTGKCVR--------THFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQS 588
                    ++ G   R        +H G VE +     DN    S + D T+K WDL +
Sbjct: 257 AAKKRRKLTLKDGTIRRRAPLSLLESHTGPVEQVIFDHGDNTVGYSVSQDHTIKTWDLVT 316

Query: 589 GKCIHT 594
            +CI T
Sbjct: 317 ARCIDT 322

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 110/295 (37%), Gaps = 56/295 (18%)

Query: 197 ALKILGYLDCESLCNAA--RVCRRWQQMADDDKVWYHMCQQHIDRKCPNCGWGLPLLHMK 254
           A+K + Y+    + +A   R  R W+   DD  V  +   ++ D +    G  L +L   
Sbjct: 146 AVKAVKYISNTRIVSAGNDRSLRLWKTKNDDGSVSNNTGDEN-DEENIEDGKTLAILEGH 204

Query: 255 RARFIEPPAESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFK 314
           +A  +            A N  + S +       W  IY+E   ++        H++E +
Sbjct: 205 KAPVVSLDV--------ASNSRILSASYDNTVALWSTIYKEMTAID--------HLEEIQ 248

Query: 315 GHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRR-----LTGHRDGVKAIYFDGQK 369
              + + +     R L             L  G + RR     L  H   V+ + FD   
Sbjct: 249 NPNNKISTAAKKRRKL------------TLKDGTIRRRAPLSLLESHTGPVEQVIFDHGD 296

Query: 370 LITG---SLDRMIRVWNYVTGACV----AAYPGHSDSVLSVDSYK--KIIVSGSADKTV- 419
              G   S D  I+ W+ VT  C+     +YP     +LS+       ++  GS+ + + 
Sbjct: 297 NTVGYSVSQDHTIKTWDLVTARCIDTKTTSYP-----LLSIAQMPTLNLLACGSSVRHIT 351

Query: 420 ----KVWHVESRTCYTLRGHTEWV-GTVKLHPKSFTCFSGSDDTTIRMWDIRSNT 469
               +V      T   L GH  +V G        +   S S D T+++WD+RS +
Sbjct: 352 LHDPRVSSSAKITQKQLVGHKNFVVGLDTCSENEYLLCSASHDGTVKVWDVRSTS 406

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 92/214 (42%), Gaps = 27/214 (12%)

Query: 313 FKGHMDGVLS------LQFNY-RLLFTGSYDSTVAIWDLATGK--------LVRRLT--- 354
           F GH   V +      ++ NY + + T S D TV  W++   K        +V+      
Sbjct: 432 FVGHAASVSAVCLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTR 491

Query: 355 -GHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD--SYKKI 409
             H   + AI    +     T S D+  ++WN  TG  VA    H   +  V     +K 
Sbjct: 492 HAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKW 551

Query: 410 IVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN 468
           I + S DKTVK+W +ES T   TL GHT  V       K     S   D  I++WDI S 
Sbjct: 552 IATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASG 611

Query: 469 TCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD 502
            C+K   GH     ++  L++L+  +L+    +D
Sbjct: 612 DCIKNLDGH---SNRIWALSVLEDGDLIISADAD 642

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 109/286 (38%), Gaps = 67/286 (23%)

Query: 350 VRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGA----CVAAYPGHSDSVLSV 403
           V    GH D + ++    DGQ L T S D+   +W++   +      A + GH+ SV +V
Sbjct: 383 VNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAV 442

Query: 404 -------DSYKKIIVSGSADKTVKVWHVE-------------SRTCYTLRGHTEWVGTVK 443
                   +Y K I++ S D TVK W +                + YT   H + +  + 
Sbjct: 443 CLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAIS 502

Query: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDP 503
           + P      + S D T ++W++ +   V     H   +  V   +  ++E  +       
Sbjct: 503 MAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDV---SFCESEKWIA------ 553

Query: 504 PRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW 563
                                         +CS D T+K+W + +   ++T  GH   + 
Sbjct: 554 ------------------------------TCSGDKTVKIWSLESFTVLKTLEGHTNAVQ 583

Query: 564 DIAADNFR--IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
             +  N +  +VS   D  +KVWD+ SG CI   D H   I  + +
Sbjct: 584 RCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSV 629

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/180 (20%), Positives = 77/180 (42%), Gaps = 22/180 (12%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK------LITGSLDRMIRVW 382
           L+  G  D ++ + D+  G +     GH   + ++ F G+       L +G  + M +VW
Sbjct: 117 LVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAKVW 176

Query: 383 NYVTGACVAAYPGHSDSVLSVDSYKK------IIVSGSADKTVKVWHVE-----SRTCYT 431
           + VT  C      HS ++  +D  K        +++G  D  + +W        S+   T
Sbjct: 177 DLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIKGKSSKLVKT 236

Query: 432 LRGH--TEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQ--VQKVLPL 487
           +  H   E  G +  + ++F  ++   D   ++ D+  ++ VK  +  + +  +  V+P+
Sbjct: 237 IPAHLQIEACGFITHNDETF-AYTAGGDAVFQIIDLNESSVVKCTKKPIEELFITGVIPI 295

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 14/98 (14%)

Query: 528 YPSHLLSCSLDNTIKLWEVRTGK------------CVRTHFGHVEGIWDI--AADNFRIV 573
           YP ++++ S D T+K WE+   K             + T   H + I  I  A ++    
Sbjct: 452 YPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFA 511

Query: 574 SGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSE 611
           + ++DKT K+W++ +G+ + T  +H+  +  V   +SE
Sbjct: 512 TASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESE 549

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 39/90 (43%), Gaps = 16/90 (17%)

Query: 529 PSHLLSC----------SLDNTIKLWEVRTGKCVRTHFGH------VEGIWDIAADNFRI 572
           PS++++C            D +I + ++  G    +  GH      ++   ++  + + +
Sbjct: 105 PSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLL 164

Query: 573 VSGAHDKTVKVWDLQSGKCIHTFDSHQAPI 602
            SG  +   KVWDL + KC  T   H + I
Sbjct: 165 GSGDTNGMAKVWDLVTRKCKFTVQEHSSAI 194

>Kwal_27.11585
          Length = 823

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 113/296 (38%), Gaps = 68/296 (22%)

Query: 350 VRRLTGHRDGVKAI--YFDGQKLITGSLDRMIRVWNYVTGA----CVAAYPGHSDSVLSV 403
           V    GH D + ++    +G+ L T S D  + +W     +      A + GH+  V +V
Sbjct: 393 VELYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAV 452

Query: 404 -------DSYKKIIVSGSADKTVKVWHVESRTC------------YTLRGHTEWVGTVKL 444
                  +++ + I++ S D T+K W V   T             YT R H + +  + +
Sbjct: 453 GLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSI 512

Query: 445 HPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPP 504
            P      + S D T ++W++ S         H   +  V                    
Sbjct: 513 SPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDV-------------------- 552

Query: 505 RNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW- 563
               T  Q               Y   L +CS D TIK+W + +   V+T  GH   +  
Sbjct: 553 ----TFCQ---------------YDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQR 593

Query: 564 -DIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI--GDSEFVSGD 616
                 N +IVS   D  +KVWDL +G+CI T D+H   I  + +     EFV+ D
Sbjct: 594 CSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTAD 649

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 117/306 (38%), Gaps = 72/306 (23%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATG----KLVRRLTGHRDGVKAI 363
           ++ ++GH D + SL    N   L T S D TV +W L       K   R TGH   V A+
Sbjct: 393 VELYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAV 452

Query: 364 YFDG-------QKLITGSLDRMIRVWNY---------VTGACVAAYP--GHSDSV--LSV 403
                      + +IT S D  I+ W+          +    V+ Y    H   +  LS+
Sbjct: 453 GLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSI 512

Query: 404 DSYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTE--WVGTVKLHPKSFTCFSGSDDTTI 460
                +  + S DKT K+W+V+S     TL  H    W  T   + K     SG  D TI
Sbjct: 513 SPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSG--DKTI 570

Query: 461 RMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLS 520
           ++W + S + VK   GH   VQ                R S   RN+             
Sbjct: 571 KVWSLESMSVVKTLEGHTNAVQ----------------RCSFINRNK------------- 601

Query: 521 ALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHD 578
                      ++S   D  IK+W++ TG+C+RT   H   IW   + +D    V+   D
Sbjct: 602 ----------QIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADAD 651

Query: 579 KTVKVW 584
              + W
Sbjct: 652 GVFQFW 657

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQ------KLITGSLDRMIRVW 382
           L+  G  D +V + D+  G +     GH   + ++ F G+      +L +G    M++VW
Sbjct: 115 LVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVW 174

Query: 383 NYVTGACVAAYPGHSDSVLSVD 404
           + V   C+     H+ +V  +D
Sbjct: 175 DLVRRNCIHTIQEHAAAVRGLD 196

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDS-VLSVDSYKKIIVSGSADKTVKVWHV 424
           +G+ L   S  +++R++   +   + +    S   V+  DS   ++  G  D +V V  +
Sbjct: 71  NGEYLCFVSQAQLLRIYKLSSKKIIRSMKVSSPVYVMDCDSSSTLVALGGTDGSVTVVDI 130

Query: 425 ES-RTCYTLRGHTEWVGTVKLHPKS----FTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           E+    ++ +GH   + +VK H +     +   SG     +++WD+    C+   + H  
Sbjct: 131 ENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAA 190

Query: 480 QVQ 482
            V+
Sbjct: 191 AVR 193

 Score = 36.2 bits (82), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 6/71 (8%)

Query: 538 DNTIKLWEVRTGKCVRTHFGHVEGIWDI------AADNFRIVSGAHDKTVKVWDLQSGKC 591
           D ++ + ++  G    +  GH   I  +      +   +R+ SG     VKVWDL    C
Sbjct: 122 DGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNC 181

Query: 592 IHTFDSHQAPI 602
           IHT   H A +
Sbjct: 182 IHTIQEHAAAV 192

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 81/161 (50%), Gaps = 15/161 (9%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYV 385
           + + +GS D TV I  +  G+ +RRL GH   V +I ++  G  L + S+D  I+ W+ +
Sbjct: 82  KCIASGSEDFTVEITHIIYGR-IRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVL 140

Query: 386 TGACVAAYPGHSDSVLSVDSYK---KIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGT 441
           +G  +     HSD+V+S+D  K    I+ SGS D  ++++  ES  C  TL    +W+  
Sbjct: 141 SGTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAE 200

Query: 442 VKLHPKSFTCFS--------GSDDTTIRMWDIRSNTCVKVF 474
             + P S   FS         S D  +++W+    T V+ F
Sbjct: 201 DGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTF 241

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 126/283 (44%), Gaps = 58/283 (20%)

Query: 336 DSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAY 393
           ++ + ++++++ K+++  T H++ +  + +  D + + +GS D  + + + + G  +   
Sbjct: 48  NTDMLVYEISSSKMMKLTTTHKECINCLCWSPDSKCIASGSEDFTVEITHIIYGR-IRRL 106

Query: 394 PGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPK--S 448
            GH+  V+S+  ++   I+ S S D+++K WHV S T   T+  H++ V ++ + PK  S
Sbjct: 107 MGHTAPVISICYNNKGNILCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDI-PKFDS 165

Query: 449 FTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQK--VLPLTILDTENLVTDRTSDPPRN 506
               SGS D  IR++D  S  C+K        + +  V+P++                  
Sbjct: 166 SILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAEDGVVPIS------------------ 207

Query: 507 EATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHF---------- 556
              T +   +G+             LL  SLDN +KLWE   G  VRT            
Sbjct: 208 ---TVKFSRNGKF------------LLVKSLDNVVKLWEYTRGTVVRTFLWPHQETKAKL 252

Query: 557 ---GHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFD 596
                +E I+    D   ++SG    ++ VW++ S   +   D
Sbjct: 253 KYNCGLELIYPQGKDPL-VISGNDSGSMCVWNVYSKNLVQKID 294

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 14/101 (13%)

Query: 306 GTAHIQEFKGHMDGVLSL---QFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRD---- 358
           GTA ++    H D V+S+   +F+  +L +GSYD  + I+D  +G  ++ LT  +D    
Sbjct: 142 GTA-LKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAE 200

Query: 359 ----GVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAY 393
                +  + F  +G+ L+  SLD ++++W Y  G  V  +
Sbjct: 201 DGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTF 241

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/330 (23%), Positives = 145/330 (43%), Gaps = 45/330 (13%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDLATGKL-VRRLTGHRDGVKAIYF----DGQKLI-TGS 374
           + L  +  + F  +    V  +DL    + +     H  GV ++      +G  LI T S
Sbjct: 126 IKLHPSLPIAFLATDQGKVVAYDLFNRSMPLHSTQAHMKGVTSLAVMEAENGSLLISTTS 185

Query: 375 LDRMIRVWNYVTGACVAAYPGHS--DSVLSVDSYKK-----IIVSGSADKTVKVWHVESR 427
            D   ++W++   A        S  + ++S   + +     ++ + S D TVKVW  +S 
Sbjct: 186 KDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKVWDTKSG 245

Query: 428 TCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLP 486
            C  + + H +WV T++LH       +GS+D TIR+    S   + +   H   +++VL 
Sbjct: 246 WCIKSFQPHNQWVRTLELHGDYV--ITGSNDATIRLSHWPSGNGLSMAVMHEFPIERVL- 302

Query: 487 LTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV 546
                   ++  R +   + EA   Q   + +    D S     + +SCS DN I LW++
Sbjct: 303 --------IIPMRANTAQKTEADDDQVELEYRKYDPDYSPLGFKYCISCSRDNLIVLWKI 354

Query: 547 RTGKCV----------RTHF-------GHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSG 589
              K +          +T+F       GH   + DI      + S + D++++ WDL +G
Sbjct: 355 PLPKFIPHRPPQPNLLQTNFEKVHVFKGHTSWVRDIKVRGRHLFSCSDDRSIRCWDLVTG 414

Query: 590 KCIHTF-DSHQAPITCVGIGDSEFVSGDEL 618
           +C+  + ++    I C+ + DS+ VS D+L
Sbjct: 415 QCLKVWPEASHGFINCLSV-DSD-VSNDKL 442

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 113/266 (42%), Gaps = 31/266 (11%)

Query: 314 KGHMDGVLSLQF----NYRLLF-TGSYDSTVAIW---DLATGKLVRRLTGHRDGVKAIYF 365
           + HM GV SL      N  LL  T S D    IW   D A  +L+R L+ H   V    F
Sbjct: 160 QAHMKGVTSLAVMEAENGSLLISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCF 219

Query: 366 --DGQKLI--TGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKV 421
              G  L+  T S D  ++VW+  +G C+ ++  H+  V +++ +   +++GS D T+++
Sbjct: 220 LRSGSDLLLATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRL 279

Query: 422 WHVESRTCYTLRGHTEW----VGTVKLHPKSFTCFSGSDDTT---IRMWD-----IRSNT 469
            H  S    ++    E+    V  + +   +       DD      R +D     +    
Sbjct: 280 SHWPSGNGLSMAVMHEFPIERVLIIPMRANTAQKTEADDDQVELEYRKYDPDYSPLGFKY 339

Query: 470 CVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ-DPPDGQLSALDDSLPY 528
           C+   R ++  + K+ PL        +  R   P   +    +     G  S + D    
Sbjct: 340 CISCSRDNLIVLWKI-PL-----PKFIPHRPPQPNLLQTNFEKVHVFKGHTSWVRDIKVR 393

Query: 529 PSHLLSCSLDNTIKLWEVRTGKCVRT 554
             HL SCS D +I+ W++ TG+C++ 
Sbjct: 394 GRHLFSCSDDRSIRCWDLVTGQCLKV 419

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 52/125 (41%), Gaps = 27/125 (21%)

Query: 325 FNYRLLFTGSYDSTVAIWDLATGKL-----------------VRRLTGHRDGVKAIYFDG 367
             ++   + S D+ + +W +   K                  V    GH   V+ I   G
Sbjct: 335 LGFKYCISCSRDNLIVLWKIPLPKFIPHRPPQPNLLQTNFEKVHVFKGHTSWVRDIKVRG 394

Query: 368 QKLITGSLDRMIRVWNYVTGACVAAYPGHSD---SVLSVDS-------YKKIIVSGSADK 417
           + L + S DR IR W+ VTG C+  +P  S    + LSVDS        +++ +SGS D 
Sbjct: 395 RHLFSCSDDRSIRCWDLVTGQCLKVWPEASHGFINCLSVDSDVSNDKLLRELFLSGSIDG 454

Query: 418 TVKVW 422
              V+
Sbjct: 455 KCNVF 459

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 80/183 (43%), Gaps = 16/183 (8%)

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTEN--LV 496
           V  +KLHP     F  +D   +  +D+ + +           ++ V  L +++ EN  L+
Sbjct: 123 VTDIKLHPSLPIAFLATDQGKVVAYDLFNRS--MPLHSTQAHMKGVTSLAVMEAENGSLL 180

Query: 497 TDRTSDPPRNEATTAQDPPDGQLSALDDS----------LPYPSHLL--SCSLDNTIKLW 544
              TS   + +  +  D    QL     S          L   S LL  +CS D T+K+W
Sbjct: 181 ISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKVW 240

Query: 545 EVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITC 604
           + ++G C+++   H + +  +      +++G++D T+++    SG  +     H+ PI  
Sbjct: 241 DTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRLSHWPSGNGLSMAVMHEFPIER 300

Query: 605 VGI 607
           V I
Sbjct: 301 VLI 303

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 299 VESNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVR 351
           +++N+ K    +  FKGH   V  ++   R LF+ S D ++  WDL TG+ ++
Sbjct: 370 LQTNFEK----VHVFKGHTSWVRDIKVRGRHLFSCSDDRSIRCWDLVTGQCLK 418

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 108/260 (41%), Gaps = 19/260 (7%)

Query: 362 AIYFDGQKLITGSLDRMIRVWNYVT-GACVAAYPGHSDSVLSVDSY--KKIIVSGSADKT 418
           A++ DGQ+L TG     I+V +  T G   +    H   +  +D +     ++SG  D  
Sbjct: 179 AVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNL 238

Query: 419 VKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV 478
           VK+W + S +   LRGH   V  VK+HP      S S D T  +WD+     +++  GH 
Sbjct: 239 VKLWDMTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHS 298

Query: 479 GQVQKV--------LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPS 530
             V  +        L    LD    + D  S  P        +   G +S +D S P   
Sbjct: 299 KAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEP----IMKLEGHAGAISGVDWS-PNGY 353

Query: 531 HLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI---AADNFRIVSGAHDKTVKVWDLQ 587
            L +   D T+++W++R          H     D+     +   +VS  HD+ V +++  
Sbjct: 354 QLATAGADGTVRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNAD 413

Query: 588 SGKCIHTFDSHQAPITCVGI 607
           + + + + + H   +  V I
Sbjct: 414 NWQKLASLEGHTDRVFTVDI 433

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 84/169 (49%), Gaps = 12/169 (7%)

Query: 304 RKGTAHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK 361
           RK    +QE  GH   V ++ F  +  LL +   D+  AIWDL +G+ + +L GH   + 
Sbjct: 287 RKVELQLQE--GHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAIS 344

Query: 362 AIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK----IIVSGSA 415
            + +  +G +L T   D  +RVW+       +A   H  + L V  +KK     +VS   
Sbjct: 345 GVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDV-KFKKNNGTFLVSCGH 403

Query: 416 DKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
           D+ V +++ ++ +   +L GHT+ V TV +     T +SG  D +++ W
Sbjct: 404 DRLVNIFNADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

>Scas_713.50
          Length = 983

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 95/235 (40%), Gaps = 48/235 (20%)

Query: 369 KLITGSLDRMIRVWNYVTGACVAAY-------PGHSD---------SVLSVDSYKKIIVS 412
           ++ITG+L+  + +W+  TG   +         PG  D         + L       ++  
Sbjct: 65  QIITGALEN-VNIWDLKTGELASFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAV 123

Query: 413 GSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCV 471
           G  D  VKVW + S+T    L GH+  +  +K         SGS D+ I +WD+ S   +
Sbjct: 124 GYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGL 183

Query: 472 KVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSH 531
              R H   +  +         N VT+   +   NE              LD        
Sbjct: 184 YKLRSHKDAITGIWC-------NEVTNNNQE--ENE--------------LD-------W 213

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDL 586
           L+S S D  IK+W+++  +CV TH  H    W +A  N  +++ + D  VK W L
Sbjct: 214 LISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKFWQL 268

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 109/283 (38%), Gaps = 67/283 (23%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-----DGQKLITGSLDRMIRVWN 383
           L+  G+    + ++DLA+   +  +    D   AI+      DG++LITGS D+ ++ WN
Sbjct: 482 LVIIGTRAGELQLFDLASSTQIANIEEAHDA--AIWSLDLTSDGKRLITGSADKSVKFWN 539

Query: 384 Y------VTGACVAAYPGH----------SDSVLSV--DSYKKIIVSGSADKTVKVWHVE 425
           +      V G      P            SD +LSV      K +     D TVKV+ ++
Sbjct: 540 FQLEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLD 599

Query: 426 SRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
           S   + +L GH   V ++ +   S    + S D  I++W +    C K    H   +  V
Sbjct: 600 SMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 659

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                                                    +P   +  SCS D  IK W
Sbjct: 660 ---------------------------------------KFVPESHNFFSCSKDGIIKYW 680

Query: 545 EVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVKVWD 585
           +    +C++    H   +W   IA D   +VS +HD ++++W+
Sbjct: 681 DGDKFECIQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWE 723

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 87/195 (44%), Gaps = 21/195 (10%)

Query: 308 AHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDL---------ATGKLVRRLTGHRD 358
           A+I+E        L L  + + L TGS D +V  W+           + K V +L  H D
Sbjct: 504 ANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHD 563

Query: 359 GVKAIYFD---------GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD-SY-K 407
               +  D          + L    LD  ++V+   +     +  GH   VLS+D S+  
Sbjct: 564 TTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDS 623

Query: 408 KIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIR 466
           K+I++ SADK +K+W ++   C+ +L  H + +  VK  P+S   FS S D  I+ WD  
Sbjct: 624 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGD 683

Query: 467 SNTCVKVFRGHVGQV 481
              C++    H  +V
Sbjct: 684 KFECIQKLAAHQSEV 698

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 70/311 (22%), Positives = 132/311 (42%), Gaps = 33/311 (10%)

Query: 312 EFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
           E +G    + S+    + +LL T S + ++ IW+L T   +R               G  
Sbjct: 424 ELQGQRTDIRSIDISDDNKLLATAS-NGSLKIWNLKTKLCIRTFECGYALTCKFLPGGML 482

Query: 370 LITGSLDRMIRVWNYVTGACVAAYP-GHSDSVLSVD--SYKKIIVSGSADKTVKVWHVES 426
           +I G+    +++++  +   +A     H  ++ S+D  S  K +++GSADK+VK W+ + 
Sbjct: 483 VIIGTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQL 542

Query: 427 RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLP 486
                     ++V  + LH           DTT+ + D        +    V    K L 
Sbjct: 543 EQELVPGTSDKFVPKLGLH----------HDTTLELSD-------DILSVRVSPEDKFLA 585

Query: 487 LTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL-SCSLDNTIKLWE 545
           +++LD  N V     D  +   +        +L  L   + + S ++ + S D  IK+W 
Sbjct: 586 VSLLD--NTVKVFFLDSMKFFLSLY----GHKLPVLSIDISFDSKMIITSSADKNIKIWG 639

Query: 546 VRTGKCVRTHFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPIT 603
           +  G C ++ F H + I ++    ++    S + D  +K WD    +CI    +HQ+ + 
Sbjct: 640 LDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQSEVW 699

Query: 604 CVGIG-DSEFV 613
            + I  D+ FV
Sbjct: 700 ALAIANDASFV 710

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 69/151 (45%), Gaps = 16/151 (10%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYVT 386
           LL  G  D  V +WDL +  ++  L GH   + A+ FD  G +LI+GS D  I VW+ V+
Sbjct: 120 LLAVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVS 179

Query: 387 GACVAAYPGHSDSVLSV-----------DSYKKIIVSGSADKTVKVWHVESRTCYTLRGH 435
              +     H D++  +           ++    ++S S D  +K+W ++ + C  +  H
Sbjct: 180 EVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQC--VETH 237

Query: 436 TEWVGTV-KLHPKSFTCFSGSDDTTIRMWDI 465
               G    L  ++    + S D+ ++ W +
Sbjct: 238 IAHTGECWSLAVRNDLVITTSSDSQVKFWQL 268

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 72/154 (46%), Gaps = 7/154 (4%)

Query: 318 DGVLSLQFN--YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI--YFDGQKLITG 373
           D +LS++ +   + L     D+TV ++ L + K    L GH+  V +I   FD + +IT 
Sbjct: 570 DDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITS 629

Query: 374 SLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI--IVSGSADKTVKVWHVESRTCY- 430
           S D+ I++W    G C  +   H DS+++V    +     S S D  +K W  +   C  
Sbjct: 630 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQ 689

Query: 431 TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWD 464
            L  H   V  + +   +    S S D +IR+W+
Sbjct: 690 KLAAHQSEVWALAIANDASFVVSSSHDHSIRIWE 723

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 61/125 (48%), Gaps = 13/125 (10%)

Query: 313 FKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIY-----F 365
             GH   + +L+F+     L +GS DS + +WDL +   + +L  H+D +  I+      
Sbjct: 144 LNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTN 203

Query: 366 DGQK------LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTV 419
           + Q+      LI+ S D +I++W+     CV  +  H+    S+     ++++ S+D  V
Sbjct: 204 NNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQV 263

Query: 420 KVWHV 424
           K W +
Sbjct: 264 KFWQL 268

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 76/179 (42%), Gaps = 29/179 (16%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLT-------GHRDG-----VKAIYFDGQK----LITG 373
           + TG+ ++ V IWDL TG+L   L        G  D       +  +    K    L  G
Sbjct: 66  IITGALEN-VNIWDLKTGELASFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVG 124

Query: 374 SLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRT-CY 430
             D +++VW+  +   +    GHS ++  L  D+    ++SGS D  + VW + S    Y
Sbjct: 125 YNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLY 184

Query: 431 TLRGHTE-----WVGTVKLHPKSFT----CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
            LR H +     W   V  + +         S S D  I++WD++   CV+    H G+
Sbjct: 185 KLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGE 243

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 538 DNTIKLWEVRTGKCVRTHFGHVEGIWDIAADN--FRIVSGAHDKTVKVWDLQSGKCIHTF 595
           D  +K+W++ +   +    GH   I  +  D    R++SG+ D  + VWDL S   ++  
Sbjct: 127 DGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKL 186

Query: 596 DSHQAPITCV 605
            SH+  IT +
Sbjct: 187 RSHKDAITGI 196

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 43/80 (53%), Gaps = 11/80 (13%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCV---RTHFGHVEGIW--DIAADNFR------IVSGAHD 578
           + L+S S D+ I +W++ +   +   R+H   + GIW  ++  +N        ++S + D
Sbjct: 161 TRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKD 220

Query: 579 KTVKVWDLQSGKCIHTFDSH 598
             +K+WDL+  +C+ T  +H
Sbjct: 221 GLIKIWDLKIQQCVETHIAH 240

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 119/287 (41%), Gaps = 31/287 (10%)

Query: 350 VRR----LTGHRDGVKAIYF-DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD 404
           VRR    L GHR  ++++   D  KL++ + +  ++VWN  T  C+  +         + 
Sbjct: 372 VRRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYALCSQML 431

Query: 405 SYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
               ++V G+    ++++ + S T   T   HT  + ++ L        +GS D + + W
Sbjct: 432 PGGLLVVVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFW 491

Query: 464 DIRSNTCVKVFRG----HVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPP---- 515
           D       ++  G    ++ Q++ V   T+  T++++  + S   R  A +  D      
Sbjct: 492 DFE--VVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVF 549

Query: 516 -----DGQLSALDDSLPYPS--------HLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI 562
                   LS     LP  S         L++ S D  IK+W V  G C ++ F H + I
Sbjct: 550 FFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSI 609

Query: 563 WDI--AADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
             +   AD     S   D  VK WD     CI   + HQ+ + C+ +
Sbjct: 610 MSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCIAV 656

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 137/330 (41%), Gaps = 61/330 (18%)

Query: 310 IQEFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG 367
           + +F GH  GV  L+ +     L +GS DS + IWDL     + +L  H+D +  I+ D 
Sbjct: 108 LMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDH 167

Query: 368 QK--LITGSLDRMIRVWNYVTGA-CVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWH- 423
               LI+ + D +I+VW+   G  CV  +  H+    S+   +++I++ S D   K+W  
Sbjct: 168 NMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWEL 227

Query: 424 ---------VESRTCYTLRGHTEWVGTVKLHPKSFTCFS--GSDDTTIRMWDIRSNTCVK 472
                    +  R  +        V T  +   + T F    ++D TI ++ IR    + 
Sbjct: 228 DLEKSNGEKISERGTFETESKQRGVSTEFITAPNGTRFFYIQNNDKTIEIFRIRPEEEI- 286

Query: 473 VFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPD-----GQLSALDDSLP 527
             R  + + +K L             R       E   A +P D        S +  S  
Sbjct: 287 --RKALNRREKRL-------------RDKGASEEEIQEAVNPNDISVLFHSFSTVRSSYK 331

Query: 528 YPS-----------HLLSCSLDNTIKLWEVRTGK-----CVRTHFGHVEG------IWDI 565
             S            ++  + +NTI+ +++   K      VR +   ++G        DI
Sbjct: 332 IKSSNWIQASNSKLEVVLTTSNNTIESYQIPYSKRDAEPPVRRYNVELQGHRTDIRSMDI 391

Query: 566 AADNFRIVSGAHDKTVKVWDLQSGKCIHTF 595
            +D+ +++S A +  +KVW+L + KCI TF
Sbjct: 392 -SDDGKLLSTASNGELKVWNLTTKKCIRTF 420

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 107/279 (38%), Gaps = 62/279 (22%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNY-- 384
           L+  G+    + ++DLA+  L+     H   + ++    +G++L+TGS D+  + W++  
Sbjct: 436 LVVVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEV 495

Query: 385 ----VTGACVAAYPGH----------SDSVLSV--DSYKKIIVSGSADKTVKVWHVESRT 428
               V G      P            +D +L+V   S  + +     D TVKV+  +S  
Sbjct: 496 VEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLK 555

Query: 429 CY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPL 487
            Y +L GH   V ++     S    + S D  I++W +    C K    H   +  V   
Sbjct: 556 FYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSV--- 612

Query: 488 TILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVR 547
                            R EA T                    +  SC  D  +K W+  
Sbjct: 613 -----------------RFEADT-------------------HNFFSCGKDGAVKRWDGD 636

Query: 548 TGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVW 584
              C++   GH   +W IA   D   +VS +HD +++VW
Sbjct: 637 KFDCIQKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVW 675

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 73/155 (47%), Gaps = 11/155 (7%)

Query: 318 DGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITG 373
           D +L+++ +   R L     D+TV ++   + K    L GH+  V +I F  D + LIT 
Sbjct: 523 DDILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITS 582

Query: 374 SLDRMIRVWNYVTGACVAAYPGHSDSVLSV----DSYKKIIVSGSADKTVKVWHVESRTC 429
           S D+ I++W    G C  +   H DS++SV    D++     S   D  VK W  +   C
Sbjct: 583 SADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTHN--FFSCGKDGAVKRWDGDKFDC 640

Query: 430 Y-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
              L GH   V  + + P   T  S S D +IR+W
Sbjct: 641 IQKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVW 675

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 90/233 (38%), Gaps = 55/233 (23%)

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVS-------------GSA 415
           KLITG+L+  I++W   T        G     +  +  K  +V+             G  
Sbjct: 35  KLITGALEN-IQIWTLKTNEVEVLTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYE 93

Query: 416 DKTVKVWHVESRTCYT-LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVF 474
           D  +KVW + S++      GH   V  ++L  +     SGS D+ + +WD+     +   
Sbjct: 94  DGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKL 153

Query: 475 RGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLS 534
           R H   +  +                                     +D ++ +   L+S
Sbjct: 154 RSHKDAITGIW------------------------------------IDHNMDW---LIS 174

Query: 535 CSLDNTIKLWEVRTG-KCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDL 586
            + D  IK+W+++ G +CV TH  H    W +A D   I++ + D   K+W+L
Sbjct: 175 VAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWEL 227

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 80/182 (43%), Gaps = 21/182 (11%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWD------LATG---------KLVRRLTGH-RDGVKAIY 364
           L L  N + L TGS D +   WD      L  G         KLV   T    D + A+ 
Sbjct: 470 LDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVK 529

Query: 365 FDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKTVK 420
              +   L    LD  ++V+ + +     +  GH   VLS+D     K++++ SADK +K
Sbjct: 530 ISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIK 589

Query: 421 VWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           +W V+   C+ ++  H + + +V+    +   FS   D  ++ WD     C++   GH  
Sbjct: 590 IWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQS 649

Query: 480 QV 481
           +V
Sbjct: 650 EV 651

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYVT 386
           LL  G  D  + +WDL +  ++ +  GH+ GV  +  D  G +L++GS D  + +W+ V 
Sbjct: 87  LLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVG 146

Query: 387 GACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES 426
              +     H D++  + +D     ++S + D  +KVW +++
Sbjct: 147 EVGLMKLRSHKDAITGIWIDHNMDWLISVAKDGLIKVWDLKA 188

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 538 DNTIKLWEVRTGKCVRTHFGHVEGIWDIAADN--FRIVSGAHDKTVKVWDLQSGKCIHTF 595
           D  IK+W++ +   +    GH  G+  +  D+   R+VSG+ D  + +WDL     +   
Sbjct: 94  DGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKL 153

Query: 596 DSHQAPITCVGI 607
            SH+  IT + I
Sbjct: 154 RSHKDAITGIWI 165

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 4/44 (9%)

Query: 575 GAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSE---FVSG 615
           G  D  +KVWDL S   +  F+ H++ +T + + DSE    VSG
Sbjct: 91  GYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRL-DSEGTRLVSG 133

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 115/289 (39%), Gaps = 79/289 (27%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-----DGQKLITGSLDRMIRVWN 383
           L+  G+ +  + ++DLA+  L+  +    D   AI+      DG++L+TGS D+ ++ W+
Sbjct: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDA--AIWSLDLTSDGKRLVTGSADKTVKFWD 501

Query: 384 Y-VTGACVAAYPG-----------HSDSVLSV------------DSYKKIIVSGSADKTV 419
           + V  + V   PG           H D+ L +            D Y  I +    D TV
Sbjct: 502 FKVENSLV---PGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISL---LDNTV 555

Query: 420 KVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV 478
           KV+ ++S   Y +L GH   V ++ +   S    + S D  I++W +    C K    H 
Sbjct: 556 KVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQ 615

Query: 479 GQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLD 538
             +  V                                         LP   +  SCS D
Sbjct: 616 DSIMNV---------------------------------------KFLPQSHNFFSCSKD 636

Query: 539 NTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVKVWD 585
             +K W+    +C++  + H   +W   +A D   +VS +HD ++++W+
Sbjct: 637 AVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWE 685

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 89/233 (38%), Gaps = 56/233 (24%)

Query: 369 KLITGSLDRMIRVWNYVTGACVAAY-----PGHSD---------SVLSVDSYKKIIVSGS 414
           +LIT +L+  + +W+  TG  V+       PG SD         + L       ++  G 
Sbjct: 40  QLITSALED-VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGY 98

Query: 415 ADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKV 473
           AD  +KVW + S+T      GH   +  ++         SGS D+ I +WD+     +  
Sbjct: 99  ADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYK 158

Query: 474 FRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL 533
            R H                                  +D   G     +D       L+
Sbjct: 159 LRSH----------------------------------KDSITGFWCQGED------WLI 178

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDL 586
           S S D  IKLW+++T +C+ TH  H    W +A  +  +++   D  VK+W L
Sbjct: 179 STSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKL 231

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 138/316 (43%), Gaps = 37/316 (11%)

Query: 309 HIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD 366
           H  E +G    V S+    + +LL T S + ++ IW++ T K +R               
Sbjct: 383 HTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNIKTHKCIRTFECGYALTCKFLPG 441

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYP-GHSDSVLSVD--SYKKIIVSGSADKTVKVWH 423
           G  +I G+ +  +++++  + + +      H  ++ S+D  S  K +V+GSADKTVK W 
Sbjct: 442 GLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD 501

Query: 424 VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQK 483
            +           +++  +KLH           DTT+ + D     CV+V         +
Sbjct: 502 FKVENSLVPGTKNKFLPVLKLHH----------DTTLELTD--DILCVRV-----SPDDR 544

Query: 484 VLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL-SCSLDNTIK 542
            L +++LD  N V     D  +   +        +L  L   + + S ++ + S D  IK
Sbjct: 545 YLAISLLD--NTVKVFFLDSMKFYLSLYGH----KLPVLSIDISFDSKMIITSSADKNIK 598

Query: 543 LWEVRTGKCVRTHFGHVEGIWDIA----ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSH 598
           +W +  G C ++ F H + I ++     + NF   S + D  VK WD +  +CI    +H
Sbjct: 599 IWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNF--FSCSKDAVVKYWDGEKFECIQKLYAH 656

Query: 599 QAPITCVGIG-DSEFV 613
           Q+ +  + +  D  FV
Sbjct: 657 QSEVWALAVATDGGFV 672

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 73/159 (45%), Gaps = 18/159 (11%)

Query: 339 VAIWDLATGKLVRRLT-----GHRDGVKA-----IYFDGQK----LITGSLDRMIRVWNY 384
           V IWD+ TG LV +L+     G  D   A      Y +  K    L  G  D +I+VW+ 
Sbjct: 49  VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDL 108

Query: 385 VTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGT 441
           ++   +  + GH  ++  L  D     ++SGS D  + VW +      Y LR H + +  
Sbjct: 109 MSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITG 168

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
                + +   S S D  I++WD++++ C++    H G+
Sbjct: 169 FWCQGEDW-LISTSKDGMIKLWDLKTHQCIETHIAHTGE 206

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 74/169 (43%), Gaps = 18/169 (10%)

Query: 273 GNPPVASETTTRKTRPWKVIYRERFKVESNWRKGTAH-------------IQEFKGHMDG 319
           G PP AS+   R  +P +  Y E  K       G A              +  F GH   
Sbjct: 66  GLPPGASDA--RGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAA 123

Query: 320 VLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK-LITGSLD 376
           +  LQF+     L +GS DS + +WDL     + +L  H+D +   +  G+  LI+ S D
Sbjct: 124 ITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLISTSKD 183

Query: 377 RMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE 425
            MI++W+  T  C+  +  H+     +     ++++   D  VK+W ++
Sbjct: 184 GMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLD 232

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 80/184 (43%), Gaps = 16/184 (8%)

Query: 297 FKVESNWRKGTAH--IQEFKGHMDGVLSLQFNY---------RLLFTGSYDSTVAIWDLA 345
           FKVE++   GT +  +   K H D  L L  +          R L     D+TV ++ L 
Sbjct: 502 FKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLD 561

Query: 346 TGKLVRRLTGHRDGVKAI--YFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV 403
           + K    L GH+  V +I   FD + +IT S D+ I++W    G C  +   H DS+++V
Sbjct: 562 SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 621

Query: 404 DSYKKI--IVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTI 460
               +     S S D  VK W  E   C   L  H   V  + +        S S D +I
Sbjct: 622 KFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSI 681

Query: 461 RMWD 464
           R+W+
Sbjct: 682 RIWE 685

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 65/165 (39%), Gaps = 46/165 (27%)

Query: 454 GSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQD 513
           G  D  I++WD+ S T +  F GH   +      T+L  +   T                
Sbjct: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAI------TLLQFDGTGT---------------- 134

Query: 514 PPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKC----VRTHFGHVEGIWDIAADN 569
                             L+S S D+ I +W++  G+     +R+H   + G W    D 
Sbjct: 135 -----------------RLISGSKDSNIIVWDL-VGEVGLYKLRSHKDSITGFWCQGED- 175

Query: 570 FRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVS 614
             ++S + D  +K+WDL++ +CI T  +H      + + D   ++
Sbjct: 176 -WLISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLIT 219

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 15/91 (16%)

Query: 529 PSHLLSCSLDNTIKLWEVRTGKCV-RTHFGHVEGIWDIAA-------------DNFRIVS 574
           P  L++ +L++ + +W+++TG  V +   G   G  D                D   +  
Sbjct: 38  PGQLITSALED-VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAV 96

Query: 575 GAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
           G  D  +KVWDL S   +  F+ H+A IT +
Sbjct: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLL 127

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 67/139 (48%), Gaps = 18/139 (12%)

Query: 302 NWRKGTAHIQEFKGHMDGVLSLQFNYR---LLFTGSYDSTVAIWDLATGKLVRRLTGHRD 358
           NW K  A  Q F+GH   V+ + FN +      +   D TV IW L        +T H  
Sbjct: 7   NWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHET 66

Query: 359 -GVKAIYF----DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK------ 407
            GV  + +    D   LIT S DR +++W+Y T +CVA   GH  +V    SY       
Sbjct: 67  RGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANV----SYAIFHPSL 122

Query: 408 KIIVSGSADKTVKVWHVES 426
            II+SGS D TVK+W+  +
Sbjct: 123 PIIISGSEDGTVKIWNANT 141

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 78/198 (39%), Gaps = 49/198 (24%)

Query: 379 IRVWNYVTG-ACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHVESRT-CYTLR 433
           I++WN+    A    + GH   V+ V    K      S   D TVK+W +  ++  +T+ 
Sbjct: 3   IKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMT 62

Query: 434 GH-TEWVGTVKLHP---KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTI 489
            H T  V  V  +P   K +   + SDD ++++WD ++ +CV    GH+  V   +    
Sbjct: 63  AHETRGVNFVDYYPLQDKPY-LITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAI---- 117

Query: 490 LDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTG 549
                                              SLP    ++S S D T+K+W   T 
Sbjct: 118 --------------------------------FHPSLPI---IISGSEDGTVKIWNANTY 142

Query: 550 KCVRTHFGHVEGIWDIAA 567
           K  +T    +E  W +AA
Sbjct: 143 KLEKTLNLGLERSWCVAA 160

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 77/186 (41%), Gaps = 45/186 (24%)

Query: 418 TVKVWHVESRTCY--TLRGHTEWVGTVKLHPKSFTCF-SGSDDTTIRMWDIRSNTCVKVF 474
           T+K+W+ E       T  GH  +V  V  +PK    F S   D T+++W +         
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL--------- 52

Query: 475 RGHVGQVQKVLPLTILDTE--NLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHL 532
               GQ      +T  +T   N V          +    QD P               +L
Sbjct: 53  ----GQQSPNFTMTAHETRGVNFV----------DYYPLQDKP---------------YL 83

Query: 533 LSCSLDNTIKLWEVRTGKCVRTHFGHVEGI-WDIAADNFRIV-SGAHDKTVKVWDLQSGK 590
           ++ S D ++K+W+ +T  CV T  GH+  + + I   +  I+ SG+ D TVK+W+  + K
Sbjct: 84  ITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSEDGTVKIWNANTYK 143

Query: 591 CIHTFD 596
              T +
Sbjct: 144 LEKTLN 149

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 529 PSHLLSCSLDNTIKLWEVRTGKCVRTHFGH-VEGI----WDIAADNFRIVSGAHDKTVKV 583
           P+   S  LD+T+K+W +       T   H   G+    +    D   +++ + D++VK+
Sbjct: 35  PNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKI 94

Query: 584 WDLQSGKCIHTFDSHQAPIT 603
           WD Q+  C+ T + H A ++
Sbjct: 95  WDYQTKSCVATLEGHMANVS 114

>Kwal_26.8975
          Length = 445

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 85/346 (24%), Positives = 144/346 (41%), Gaps = 65/346 (18%)

Query: 308 AHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YFD 366
           ++++ F    D V +L      + +GSYD  V  W+L +GK+ ++  GH   V+A+ Y  
Sbjct: 94  SYLKSFNNE-DWVSALDVGGDKIVSGSYDGIVRTWNL-SGKVEKQYAGHSGAVRAVKYIS 151

Query: 367 GQKLITGSLDRMIRVW----------------NYVTGACVAAYPGHSDSVLSVDSYKKII 410
             +L++G+ DR +R+W                +   G  +A    H   V++VD     I
Sbjct: 152 STRLVSGANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRI 211

Query: 411 VSGSADKTVKVW---HVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
           +SGS D ++  W   H E      +      V +     +      GS         +R 
Sbjct: 212 ISGSYDNSIGFWSTNHKEMTAVDPMDALGSNVSSAAKKRRRLALKDGS---------VRR 262

Query: 468 NTCVKVFRGHVGQVQKVL----PLTI---------LDTENLVTDRTSDPPRNEATTAQDP 514
            + + +   H   V++VL      T+         + T +LVT R  D    ++T+    
Sbjct: 263 RSPLALLESHTAPVEEVLFDFADKTVGYSVSQDHTIKTWDLVTARCVD---TKSTSYSLL 319

Query: 515 PDGQLSALDDSLPYPSHLLSC-SLDNTIKLWEVRTGKCVRTHFGHVEG--IWDIAADN-- 569
              QL  L+        LL+C S    I L + R G   +     + G   + +A D   
Sbjct: 320 SLAQLPQLN--------LLACGSSARHITLHDPRVGSSTKITQQQLNGHKNFVVALDTCP 371

Query: 570 ---FRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEF 612
              + + SG+HD TVKVWD++S   ++T  + +A +   GI D  F
Sbjct: 372 EMEYMLCSGSHDGTVKVWDVRSSAPMYTI-TREAEV-VKGINDKVF 415

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 126/310 (40%), Gaps = 45/310 (14%)

Query: 311 QEFKGHMDGVLSLQF-NYRLLFTGSYDSTVAIW----------------DLATGKLVRRL 353
           +++ GH   V ++++ +   L +G+ D T+ +W                D+  GK +  L
Sbjct: 135 KQYAGHSGAVRAVKYISSTRLVSGANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAIL 194

Query: 354 TGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSG 413
             H+  V  +   G ++I+GS D  I  W+       A  P        +D+    + S 
Sbjct: 195 EAHKAPVVTVDVSGDRIISGSYDNSIGFWSTNHKEMTAVDP--------MDALGSNVSSA 246

Query: 414 SADK---TVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFTC-FSGSDDTTIRMWDIRSN 468
           +  +    +K   V  R+    L  HT  V  V       T  +S S D TI+ WD+ + 
Sbjct: 247 AKKRRRLALKDGSVRRRSPLALLESHTAPVEEVLFDFADKTVGYSVSQDHTIKTWDLVTA 306

Query: 469 TCV--KVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATT--AQDPPDGQ---LSA 521
            CV  K     +  + ++  L +L   +     T   PR  ++T   Q   +G    + A
Sbjct: 307 RCVDTKSTSYSLLSLAQLPQLNLLACGSSARHITLHDPRVGSSTKITQQQLNGHKNFVVA 366

Query: 522 LDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT---HFGHVEGIWDIAAD-----NFRIV 573
           LD        L S S D T+K+W+VR+   + T       V+GI D   D        I+
Sbjct: 367 LDTCPEMEYMLCSGSHDGTVKVWDVRSSAPMYTITREAEVVKGINDKVFDVKWAKGLGII 426

Query: 574 SGAHDKTVKV 583
           SG  DK +++
Sbjct: 427 SGGQDKKIQI 436

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 51/101 (50%), Gaps = 18/101 (17%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA-ADNFRIVSGAHDKTVKVW------ 584
           ++S S D  ++ W + +GK  + + GH   +  +    + R+VSGA+D+T+++W      
Sbjct: 115 IVSGSYDGIVRTWNL-SGKVEKQYAGHSGAVRAVKYISSTRLVSGANDRTLRLWKTKNDE 173

Query: 585 ----------DLQSGKCIHTFDSHQAPITCVGIGDSEFVSG 615
                     D++ GK +   ++H+AP+  V +     +SG
Sbjct: 174 LKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIISG 214

>Scas_558.3
          Length = 725

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 80/165 (48%), Gaps = 11/165 (6%)

Query: 315 GHMDGVLSLQFNY-RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV---KAIYFDGQKL 370
           GH   V +L + +   + +GS+D+T  +W    G L   L GH+  V   K I  +    
Sbjct: 100 GHHSNVCALSYKHMSAIISGSWDTTAKVW--INGALQWSLEGHQASVWDAKIISVEENTF 157

Query: 371 ITGSLDRMIRVWNYVTGACVAAYPG-HSDSV--LSVDSYKKIIVSGSADKTVKVWHVESR 427
           IT S DR +++W       +  + G HSD +  + V S  K I + S D T+K+  ++  
Sbjct: 158 ITASADRTVKLWK--ENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKISDLDGN 215

Query: 428 TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVK 472
               L GH  +V  VKL  +     S  +D ++R+WDI +N  +K
Sbjct: 216 IKQVLSGHESFVYNVKLSKQGDKLVSCGEDRSLRIWDINNNFNIK 260

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 100/241 (41%), Gaps = 54/241 (22%)

Query: 353 LTGHRDGVKAI-YFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV-----LSVDSY 406
           L GH   V A+ Y     +I+GS D   +VW  + GA   +  GH  SV     +SV+  
Sbjct: 98  LIGHHSNVCALSYKHMSAIISGSWDTTAKVW--INGALQWSLEGHQASVWDAKIISVE-- 153

Query: 407 KKIIVSGSADKTVKVWHVESRTCYTLRG-HTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           +   ++ SAD+TVK+W  E++   T  G H++ +  +++        + S+D TI++ D+
Sbjct: 154 ENTFITASADRTVKLWK-ENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKISDL 212

Query: 466 RSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDS 525
             N   +V  GH   V  V                                 +LS   D 
Sbjct: 213 DGN-IKQVLSGHESFVYNV---------------------------------KLSKQGD- 237

Query: 526 LPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGH-VEGIWDI-AADNFRIVSGAHDKTVKV 583
                 L+SC  D ++++W++     ++         IW +    N  IV G  D TV++
Sbjct: 238 -----KLVSCGEDRSLRIWDINNNFNIKQVIKLPAVSIWCVDTLPNGDIVVGCSDNTVRI 292

Query: 584 W 584
           +
Sbjct: 293 F 293

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 83/182 (45%), Gaps = 21/182 (11%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWD------LATG---------KLVRRLT---GHRDGVKA 362
           L L  + + L T S D TV  WD      L  G         KL+   T   G       
Sbjct: 473 LDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVK 532

Query: 363 IYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKTVK 420
           I  + + L    LD  ++V+   +     +  GH   VLS+D     K+I++ SADK +K
Sbjct: 533 ISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIK 592

Query: 421 VWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           +W ++   C+ +L  H + +  VK  P+S   FS S D T++ WD  S  C++   GH G
Sbjct: 593 IWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQG 652

Query: 480 QV 481
           +V
Sbjct: 653 EV 654

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 41/270 (15%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLT-GHRDGVKAIYF--DGQKLITGSLDRMIRVWNYV 385
           L+  G+    + ++DLA+  ++  +   H   + ++    DG++L+T S D+ ++ W++ 
Sbjct: 438 LVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDF- 496

Query: 386 TGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLH 445
                                ++ +V+G+ DK V    +   T   L G   W   VK+ 
Sbjct: 497 -------------------KVEQELVAGTLDKFVPKMKLIHDTTLDL-GEDLWC--VKIS 534

Query: 446 PKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPR 505
           P+         D T++++ + S   +K F    G    VL + I     L+   TS   +
Sbjct: 535 PEDRFLAVSLLDNTVKVFFLDS---MKFFLSLYGHKLPVLSMDISHDSKLII--TSSADK 589

Query: 506 NEATTAQDPPD--GQLSALDDS------LPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFG 557
           N      D  D    L A  DS      LP   +  SCS D T+K W+  +  C++  +G
Sbjct: 590 NIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYG 649

Query: 558 HVEGIWDIA--ADNFRIVSGAHDKTVKVWD 585
           H   +W +A  +D   +VS +HD++++VW+
Sbjct: 650 HQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 91/233 (39%), Gaps = 56/233 (24%)

Query: 369 KLITGSLDRMIRVWNYVTGACVAAY-----PGHSDS---------VLSVDSYKKIIVSGS 414
           ++ITG+L+  ++ W   TG  +        PG  D+          L       I+  G 
Sbjct: 36  QVITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGY 94

Query: 415 ADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKV 473
           AD T+K+W ++++T       H+  +  ++         SGS D TI +WD+ + T +  
Sbjct: 95  ADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCK 154

Query: 474 FRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL 533
            R H                                  +D   G     DD       L+
Sbjct: 155 LRSH----------------------------------KDAITGIWCENDD------WLI 174

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDL 586
           S S D  IKLW+++  +CV TH  H    W +A  +  +++   +  +K+W+L
Sbjct: 175 SVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWEL 227

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 79/368 (21%), Positives = 157/368 (42%), Gaps = 50/368 (13%)

Query: 273 GNPPVASETTTRKTRPWKVIY----RERFKVESNWRKGTAHIQE---------FKGHMDG 319
           G PP A +T   K  P +  Y     E F +   +  GT  I +         F  H   
Sbjct: 62  GLPPGAIDTKAEK--PAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119

Query: 320 VLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK-LITGSLD 376
           +  L+F+     L +GS D+T+ +WDL     + +L  H+D +  I+ +    LI+ S D
Sbjct: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179

Query: 377 RMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE----SRTCYTL 432
            +I++W+     CV  +  H+    S+     ++++ +A+  +K+W ++    + +    
Sbjct: 180 GLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLE 239

Query: 433 RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV-GQVQKVL--PLTI 489
           +G  E     +    SFT  +   D T   + + S+  +++FR     ++ K L      
Sbjct: 240 KGSYEKQSKQRCTELSFTTVA---DGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKR 296

Query: 490 LDTENLVTDRTSDPPRNEATTAQDPPDG------QLSALDDSLPYPS--HLLSCSLDNTI 541
              + +  +   +  RN        P        +L A   ++  PS   L+  + +NTI
Sbjct: 297 FKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTI 356

Query: 542 KLWEVRTGK-------CVRTHF----GHVEGI--WDIAADNFRIVSGAHDKTVKVWDLQS 588
           + + +   K        ++ H     GH   +   DI++D+ ++++ A +  +KVW++++
Sbjct: 357 EYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDD-KLLATASNGNLKVWNIKT 415

Query: 589 GKCIHTFD 596
             CI   D
Sbjct: 416 KTCIRNLD 423

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 79/178 (44%), Gaps = 44/178 (24%)

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTS 501
           ++ H ++F    G  D TI++WD+++ T + VF  H   +      TIL       D+T 
Sbjct: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI------TILRF-----DQTG 129

Query: 502 DPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV--RTGKC-VRTHFGH 558
                                       + L+S S D TI LW++   TG C +R+H   
Sbjct: 130 ----------------------------TRLISGSRDATIILWDLVAETGLCKLRSHKDA 161

Query: 559 VEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSGD 616
           + GIW    ++  ++S + D  +K+WD++  +C+ T  +H      + + D+  ++ +
Sbjct: 162 ITGIW--CENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITAN 217

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/257 (22%), Positives = 104/257 (40%), Gaps = 30/257 (11%)

Query: 355 GHRDGVKA--IYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVS 412
           GHR  ++A  I  D + L T S +  ++VWN  T  C+                  +++ 
Sbjct: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVIL 441

Query: 413 GSADKTVKVWHVESRTCY--TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC 470
           G+    ++++ + S T        HT  + ++ L        + S D T++ WD +    
Sbjct: 442 GTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE 501

Query: 471 VKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPS 530
           +       G + K +P        L+ D T D   +       P D  L+          
Sbjct: 502 LVA-----GTLDKFVP-----KMKLIHDTTLDLGEDLWCVKISPEDRFLAV--------- 542

Query: 531 HLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDLQS 588
                 LDNT+K++ + + K   + +GH   +   DI+ D+  I++ + DK +K+W L  
Sbjct: 543 ----SLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598

Query: 589 GKCIHTFDSHQAPITCV 605
           G C  +  +HQ  I  V
Sbjct: 599 GDCHKSLFAHQDSIMNV 615

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 120/289 (41%), Gaps = 34/289 (11%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTG 387
           +LL T S +  + +W++ T   +R L             G  +I G+    +++++  + 
Sbjct: 398 KLLATAS-NGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASS 456

Query: 388 ACVAAYP-GHSDSVLSVD--SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWV-GTV- 442
             +      H+ ++ S+D  S  K +V+ SADKTVK W          +   E V GT+ 
Sbjct: 457 TMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWD--------FKVEQELVAGTLD 508

Query: 443 KLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD 502
           K  PK       + D    +W      CVK+         + L +++LD  N V     D
Sbjct: 509 KFVPKMKLIHDTTLDLGEDLW------CVKI-----SPEDRFLAVSLLD--NTVKVFFLD 555

Query: 503 PPRNEATTAQDPPDGQLSALDDSLPYPSHLL-SCSLDNTIKLWEVRTGKCVRTHFGHVEG 561
             +   +        +L  L   + + S L+ + S D  IK+W +  G C ++ F H + 
Sbjct: 556 SMKFFLSLY----GHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 611

Query: 562 IWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIG 608
           I ++    ++    S + D TVK WD  S  CI     HQ  +  + + 
Sbjct: 612 IMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS 660

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%), Gaps = 15/91 (16%)

Query: 529 PSHLLSCSLDNTIKLWEVRTGKCVRT-HFGHVEGIWDIAAD-------------NFRIVS 574
           P  +++ +L+  +K WE++TG+ ++T   G   G  D  A+              F +  
Sbjct: 34  PGQVITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAV 92

Query: 575 GAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
           G  D T+K+WD+Q+   +  F SH + IT +
Sbjct: 93  GYADGTIKIWDMQTQTVLIVFHSHSSAITIL 123

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 95/225 (42%), Gaps = 29/225 (12%)

Query: 394 PGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRG-HTEWVGTVKLHPKSFTC 451
           PGH   + + D S    +++ +++  +KVW+++++TC  +R     +    K  P     
Sbjct: 382 PGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTC--IRNLDCGYALCCKFLPGGALV 439

Query: 452 FSGSDDTTIRMWDIRSNTCVK-VFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRN-EAT 509
             G+    ++++D+ S+T ++ +   H   +   L LT  D + LVT       +  +  
Sbjct: 440 ILGTRAGQLQLFDLASSTMLENIEEAHTAAIWS-LDLTS-DGKRLVTASADKTVKFWDFK 497

Query: 510 TAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADN 569
             Q+   G    LD  +P    +   +LD    LW      CV+              D 
Sbjct: 498 VEQELVAG---TLDKFVPKMKLIHDTTLDLGEDLW------CVKIS----------PEDR 538

Query: 570 FRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIG-DSEFV 613
           F  VS   D TVKV+ L S K   +   H+ P+  + I  DS+ +
Sbjct: 539 FLAVS-LLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLI 582

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 112/283 (39%), Gaps = 67/283 (23%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-----DGQKLITGSLDRMIRVWN 383
           L+  G+ +  + ++D+A+  ++    G  D   AI+      DG+KL+TGS D+ +R W 
Sbjct: 441 LVVVGTRNGELQLFDIASSTMLDNKEGAHDA--AIWSLDLTSDGRKLVTGSADKTVRFWT 498

Query: 384 Y-VTGACVAAYPGHS---------------DSVLSV--DSYKKIIVSGSADKTVKVWHVE 425
           + V+   V+     +               D +LSV      K I     D TVKV+ ++
Sbjct: 499 FEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLD 558

Query: 426 SRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
           S   + +L GH   V ++ +   S    + S D  I++W +    C K    H   +  V
Sbjct: 559 SMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 618

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
                                                    LP   +  SCS D T+K W
Sbjct: 619 ---------------------------------------KFLPESYNFFSCSKDATVKYW 639

Query: 545 EVRTGKCVRTHFGHVEGIWDIAADN--FRIVSGAHDKTVKVWD 585
           + +  +C++    H   +W I+  N    ++S  HD +++VW+
Sbjct: 640 DGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 82/182 (45%), Gaps = 21/182 (11%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDLATGKLV-----------------RRLTGHRDGVKAI 363
           L L  + R L TGS D TV  W     ++                    L    D +  +
Sbjct: 476 LDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVV 535

Query: 364 YFDGQKLITGS-LDRMIRVWNYVTGACVAAYPGHSDSVLSVD-SY-KKIIVSGSADKTVK 420
                K I  S LD  ++V+   +     +  GH   VLS+D SY  K+IV+ SADK +K
Sbjct: 536 ISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIK 595

Query: 421 VWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           +W ++   C+ +L  H + +  VK  P+S+  FS S D T++ WD +   C++    H  
Sbjct: 596 IWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQS 655

Query: 480 QV 481
           +V
Sbjct: 656 EV 657

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 127/299 (42%), Gaps = 31/299 (10%)

Query: 322 SLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRV 381
           S+  + +LL T S + ++ IW++ T + +R               G  ++ G+ +  +++
Sbjct: 395 SISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQL 453

Query: 382 WNYVTGACVAAYPGHSDSV---LSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEW 438
           ++  +   +    G  D+    L + S  + +V+GSADKTV+ W  E             
Sbjct: 454 FDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSE---------- 503

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTD 498
           V       K+        DTT+ + D        +    +    K + +++LD  N V  
Sbjct: 504 VPVSDESNKTMPMLQLFHDTTLELDD-------DILSVVISPDDKFIAVSLLD--NTVKV 554

Query: 499 RTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL-SCSLDNTIKLWEVRTGKCVRTHFG 557
              D  +   +        +L  L   + Y S L+ +CS D  IK+W +  G C ++ F 
Sbjct: 555 FFLDSMKFFLSLY----GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFA 610

Query: 558 HVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI-GDSEFV 613
           H + I ++    +++   S + D TVK WD Q  +CI    +HQ+ +  + +  D  FV
Sbjct: 611 HQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFV 669

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 60/116 (51%), Gaps = 3/116 (2%)

Query: 313 FKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK- 369
           F GH   +  L F+     L + S DS + +WDL     + +L  H+D +  ++ + +  
Sbjct: 117 FNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENW 176

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE 425
           LI+ S D ++++W+  +  CV  +  H+    S+   + + V+ SAD  VK+W ++
Sbjct: 177 LISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLD 232

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 76/159 (47%), Gaps = 18/159 (11%)

Query: 339 VAIWDLATGKLVRRLT-----GHRDG-----VKAIYF----DGQKLITGSLDRMIRVWNY 384
           + +WD+ TG+ + +LT     G  D       +  +     +   L  G  D +I++W+ 
Sbjct: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108

Query: 385 VTGACVAAYPGHSD--SVLSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGT 441
           ++   + ++ GH    +VL+ D+    ++S S D  + VW +   +  Y LR H + +  
Sbjct: 109 ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITG 168

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
           +    +++   S S D  +++WD++S  CV+    H G+
Sbjct: 169 LWCEDENW-LISTSKDGLVKIWDLKSQQCVETHLAHTGE 206

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 93/237 (39%), Gaps = 58/237 (24%)

Query: 369 KLITGSLDRMIRVWNYVTGACVAAY-----PGHSDSVLSVDSYK---------KIIVSGS 414
           ++I G L+ ++ VW+  TG  +A       PG SD+ LS  +            ++ +G 
Sbjct: 40  QVIVGGLENIL-VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGY 98

Query: 415 ADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKV 473
           AD  +K+W + S+T   +  GH   +  +          S S D+ I +WD+   + +  
Sbjct: 99  ADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYK 158

Query: 474 FRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL 533
            R H                             +A T     D             + L+
Sbjct: 159 LRSH----------------------------KDAITGLWCED------------ENWLI 178

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVW--DLQS 588
           S S D  +K+W++++ +CV TH  H    W +       V+ + D  VK+W  DLQ+
Sbjct: 179 STSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQA 235

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 70/143 (48%), Gaps = 10/143 (6%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYVT 386
           LL  G  D  + IWDL +  ++    GH+  +  + FD  G +LI+ S D  I VW+ V 
Sbjct: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVG 152

Query: 387 GACVAAYPGHSDSVLSV-DSYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTE--WVGTV 442
            + +     H D++  +    +  ++S S D  VK+W ++S+ C  T   HT   W   +
Sbjct: 153 ESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGI 212

Query: 443 KLHPKSFTCFSGSDDTTIRMWDI 465
            +   + TC   S D+ +++W +
Sbjct: 213 -IEDMAVTC---SADSQVKLWKL 231

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 73/170 (42%), Gaps = 46/170 (27%)

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTS 501
           +K HP++    +G  D  I++WD+ S T +  F GH   +      T+L           
Sbjct: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAI------TVL----------- 127

Query: 502 DPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKC----VRTHFG 557
                              A D +    + L+S S D+ I +W++  G+     +R+H  
Sbjct: 128 -------------------AFDTT---GTRLISASKDSDIIVWDL-VGESGLYKLRSHKD 164

Query: 558 HVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
            + G+W    D   ++S + D  VK+WDL+S +C+ T  +H      +GI
Sbjct: 165 AITGLW--CEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGI 212

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 52/115 (45%), Gaps = 6/115 (5%)

Query: 315 GHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKL 370
           GH   VLS+  +Y  +L+ T S D  + IW L  G   + L  H+D +  + F  +    
Sbjct: 568 GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNF 627

Query: 371 ITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWH 423
            + S D  ++ W+     C+     H   V  +SV +    ++S   D +++VW 
Sbjct: 628 FSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 85/179 (47%), Gaps = 20/179 (11%)

Query: 310 IQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGK-LVRRLTGHRDGVKAIYF 365
           I  FKGH++G   L+F      L  +G  D+ + IWD+   + L+R   GHR  V+ I F
Sbjct: 171 IYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINF 230

Query: 366 --DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI----IVSGSADKTV 419
             DG + ++ S D+ ++VW+  TG   +    H  SV +  +Y        + G ++  +
Sbjct: 231 NSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWH--SVPNCATYHPTNNNEYIVGLSNSEI 288

Query: 420 KVWHVESRTC------YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVK 472
           +  H +SR         T   H   + ++K  P      S S+D T+R+W+ + N  +K
Sbjct: 289 R--HYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFISSSEDKTVRIWENQVNIPIK 345

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 77/183 (42%), Gaps = 14/183 (7%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           +++++GH   V  + FN       + S+D T+ +WD  TGK+  RL  H     A Y   
Sbjct: 215 LRDYRGHRKAVRDINFNSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWHSVPNCATYHPT 274

Query: 366 DGQKLITGSLDRMIRVWNYVTG---ACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVK 420
           +  + I G  +  IR ++         +  Y  H  S++S+  +      +S S DKTV+
Sbjct: 275 NNNEYIVGLSNSEIRHYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFISSSEDKTVR 334

Query: 421 VWHVESRTCYTLRGHTEWVGT--VKLHPKSFTCFSGSDDTTI---RMWDIRSNTCVKVFR 475
           +W  +          T       +++HP+     + S D  I    M         KVFR
Sbjct: 335 IWENQVNIPIKQISDTSQYSMPYLEIHPEQHYFSAQSMDNAIYSFSMKPKYKKNLKKVFR 394

Query: 476 GHV 478
           GH+
Sbjct: 395 GHL 397

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 6/96 (6%)

Query: 526 LPYPSHL-LSCSLDNTIKLWEVRTGKCV-RTHFGHVEGIWDIA--ADNFRIVSGAHDKTV 581
           LP   HL LS   DN I +W++   + + R + GH + + DI   +D    +S + D+T+
Sbjct: 187 LPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINFNSDGTEFLSVSFDQTL 246

Query: 582 KVWDLQSGKCIHTFDSHQAP--ITCVGIGDSEFVSG 615
           KVWD ++GK       H  P   T     ++E++ G
Sbjct: 247 KVWDTETGKVKSRLKWHSVPNCATYHPTNNNEYIVG 282

>Kwal_56.23920
          Length = 937

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/282 (21%), Positives = 115/282 (40%), Gaps = 67/282 (23%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIY-----FDGQKLITGSLDRMIRVWN 383
           L+  G+    + ++DLA+  L+  + G   G  AI+      DG++L+TGS D+ +  W+
Sbjct: 438 LVVLGTKTGDLHLYDLASSTLLNTIEGAHSG--AIWSLDMTTDGKRLVTGSADKTVCFWD 495

Query: 384 Y------VTGACVAAYPGH----------SDSVLSVDSY--KKIIVSGSADKTVKVWHVE 425
           +      V G      P            +D VL+V      +++     D TVKV+ ++
Sbjct: 496 FQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMD 555

Query: 426 SRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
           S   + +L GH   V ++ +   S    + S D  I++W +    C +    H   + KV
Sbjct: 556 SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKV 615

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
           +                                        +P   +  SCS D  +K W
Sbjct: 616 V---------------------------------------FVPESHNFFSCSKDALVKYW 636

Query: 545 EVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVW 584
           +    +C++    H + +W +A  +D   +VS +HD++++VW
Sbjct: 637 DGDKFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 62/115 (53%), Gaps = 3/115 (2%)

Query: 313 FKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK- 369
           F GH   +  L F+     L +GS DS + +WDL     + +L  H+D +  ++ +G++ 
Sbjct: 113 FNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEW 172

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHV 424
           LI+ S D +I+VW+     CV  +  H     S+  ++ ++++  AD  +K+W++
Sbjct: 173 LISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNL 227

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 75/155 (48%), Gaps = 11/155 (7%)

Query: 318 DGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI--YFDGQKLITG 373
           D VL+++   + RLL     D+TV ++ + + K    L GH+  V +I   FD + LIT 
Sbjct: 526 DDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITS 585

Query: 374 SLDRMIRVWNYVTGACVAAYPGHSDSVLSV----DSYKKIIVSGSADKTVKVWHVESRTC 429
           S D+ I++W    G C  +   H+DS++ V    +S+     S S D  VK W  +   C
Sbjct: 586 SADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHN--FFSCSKDALVKYWDGDKFEC 643

Query: 430 Y-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
              L  H + V T+ +        S S D +IR+W
Sbjct: 644 IQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 74/144 (51%), Gaps = 10/144 (6%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYV 385
           RLL  G  D  + IWDL +  ++    GH+  +  + FD  G +LI+GS D  I VW+ V
Sbjct: 88  RLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLV 147

Query: 386 TGACVAAYPGHSDSVLSV-DSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVG---T 441
               +     H DS+  +    ++ ++S S D  +KVW ++ + C  +  H   VG   +
Sbjct: 148 GEVGLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQC--VETHVAHVGECWS 205

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDI 465
           + +H +     +G+D+  I++W++
Sbjct: 206 MGVH-EDLVITAGADN-QIKLWNL 227

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 115/286 (40%), Gaps = 25/286 (8%)

Query: 353 LTGHRDGVKAIYFDG-QKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIV 411
           + GHR  V+AI   G  KL+  + +  +++WN  T +C+  +               ++V
Sbjct: 381 IRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGALVV 440

Query: 412 SGSADKTVKVWHVESRTCY-TLRG-HTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI---- 465
            G+    + ++ + S T   T+ G H+  + ++ +        +GS D T+  WD     
Sbjct: 441 LGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQ 500

Query: 466 --------RSNTCVKVFRGHVGQVQ------KVLPLTILDTENLVTDRTSDPPRNEATTA 511
                   + N  +K+F     ++       K+ P   L   +L+ +       +     
Sbjct: 501 EPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFF 560

Query: 512 QDPPDGQLSALDDSLPYPSHLL-SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--AD 568
                 +L  L   + + S LL + S D  IK+W +  G C R+ F H + I  +    +
Sbjct: 561 LSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPE 620

Query: 569 NFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI-GDSEFV 613
           +    S + D  VK WD    +CI    +HQ  +  + I  D  FV
Sbjct: 621 SHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLAISSDGRFV 666

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 70/160 (43%), Gaps = 26/160 (16%)

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTIL----------- 490
           ++ HP++     G +D  I++WD+ S + +  F GH   +      TIL           
Sbjct: 81  LQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAI------TILTFDQTGTRLIS 134

Query: 491 ---DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVR 547
              D++ +V D   +    +  + +D   G     ++       L+S S D  IK+W+++
Sbjct: 135 GSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEE------WLISTSKDGLIKVWDLK 188

Query: 548 TGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQ 587
             +CV TH  HV   W +      +++   D  +K+W+L 
Sbjct: 189 VQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLN 228

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
           +  G +D  +K+WDL S   + +F+ H++ IT +
Sbjct: 90  LAVGYNDGAIKIWDLLSKSVLISFNGHKSAITIL 123

>Scas_631.17
          Length = 474

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 86/194 (44%), Gaps = 15/194 (7%)

Query: 313 FKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQ 368
            +GH   V+++ F  + R + + S+D T  +WD+ +   ++   GH   V ++ F  DG 
Sbjct: 271 LQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGA 330

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV----DSYKKIIVSGSADKTVKVWHV 424
            L +G LD    VW+  TG  +    GH+  + SV    D Y   I +G  D  + +W +
Sbjct: 331 LLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYH--IATGGGDGVINIWDI 388

Query: 425 ESRTCYT-LRGHTEWVGTVKLHPKSFTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQ 482
              T  T L  H   V  V+    +  C  S   D  IR++   +   VK   GH     
Sbjct: 389 RKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKTLEGH---TD 445

Query: 483 KVLPLTILDTENLV 496
           K+L + I +   L+
Sbjct: 446 KILDVDISEDAQLI 459

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 98/244 (40%), Gaps = 49/244 (20%)

Query: 372 TGSLDRMIRVWNYVTGACVAAYP-GHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES-- 426
           TGS    I++ +  T   ++    GH   +  L+ +S    +VSG+ D  VK+   +   
Sbjct: 203 TGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFDPDV 262

Query: 427 ---RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQK 483
              +    L+GHT  V  V  HP      S S D T R+WDI S T ++   GH  +V  
Sbjct: 263 KIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYS 322

Query: 484 VLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKL 543
                 L  +N                     DG L            L S  LDN   +
Sbjct: 323 ------LSFQN---------------------DGAL------------LCSGGLDNAAIV 343

Query: 544 WEVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAP 601
           W+VRTGK +    GH + I+  D + D + I +G  D  + +WD++         +H   
Sbjct: 344 WDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNI 403

Query: 602 ITCV 605
           +T V
Sbjct: 404 VTGV 407

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 105/266 (39%), Gaps = 49/266 (18%)

Query: 330 LFTGSYDSTVAIW----DLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWN 383
           L +G+ D  V I     D+   K +  L GH   V  + F   G+ + + S D   R+W+
Sbjct: 244 LVSGADDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWD 303

Query: 384 YVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVG 440
             +   +    GH   V  LS  +   ++ SG  D    VW V + ++   L+GH + + 
Sbjct: 304 IESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIY 363

Query: 441 TVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRT 500
           +V   P  +   +G  D  I +WDIR  T       H                N+VT   
Sbjct: 364 SVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAH---------------NNIVT--- 405

Query: 501 SDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVE 560
               R + +T                     L+SC  D  I+++       V+T  GH +
Sbjct: 406 --GVRFQKSTGH------------------CLVSCGYDKQIRIYSSDNWIQVKTLEGHTD 445

Query: 561 GIWD--IAADNFRIVSGAHDKTVKVW 584
            I D  I+ D   IVS   D+++K+W
Sbjct: 446 KILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 76/162 (46%), Gaps = 8/162 (4%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           +Q  +GH   V SL F  +  LL +G  D+   +WD+ TGK +  L GH   + ++ +  
Sbjct: 310 LQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSP 369

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI---IVSGSADKTVKVW 422
           DG  + TG  D +I +W+            H++ V  V   K     +VS   DK ++++
Sbjct: 370 DGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIY 429

Query: 423 HVESRT-CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
             ++     TL GHT+ +  V +   +    S   D ++++W
Sbjct: 430 SSDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 60/124 (48%), Gaps = 9/124 (7%)

Query: 310 IQEFKGHMDGVLSLQFN---YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD 366
           I   +GH   + S+ ++   Y +  TG  D  + IWD+       RL  H + V  + F 
Sbjct: 352 IMNLQGHAKPIYSVDWSPDGYHIA-TGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQ 410

Query: 367 ---GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKV 421
              G  L++   D+ IR+++      V    GH+D +L VD  +  ++IVS   D+++K+
Sbjct: 411 KSTGHCLVSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKL 470

Query: 422 WHVE 425
           W  E
Sbjct: 471 WKQE 474

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 112/286 (39%), Gaps = 60/286 (20%)

Query: 312 EFKGHMDGVLSL-QFNYRLLFTGSYDSTVAIWDLATG-----------KLVRRLTGHRDG 359
           + KGH   V S+   N   + + S D TV +W    G           K +  L   +  
Sbjct: 7   DLKGHEQDVKSVVAINDSQVASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCYDKSS 66

Query: 360 VKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTV 419
            + +++ GQ  + G +  +           V    GH  +V S+ S    ++S S DKT 
Sbjct: 67  -QLLFYGGQDTLVGGISPLATT----DEDPVYMLIGHKGNVCSLSSKNNFVISSSWDKTA 121

Query: 420 KVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           KVWH      Y L GH+  V   K  P+     + S D TI++W    N  +K F G   
Sbjct: 122 KVWH-NGSAIYDLVGHSASVWDAKFLPEKDFFLTASADCTIKLW--HGNKLIKTFSGIHK 178

Query: 480 QVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDN 539
            V + L ++                          PDG+  A            SCS D 
Sbjct: 179 DVIRHLDIS--------------------------PDGETFA------------SCSNDG 200

Query: 540 TIKLWEVRTGKCVRTHFGHVEGIWDIA-ADNFRIVSGAHDKTVKVW 584
           T+K+ ++  G  ++T  GH   ++ +    N  +VS   D++V+VW
Sbjct: 201 TVKINDM-DGNILKTFTGHESFVYSVKFLPNGDLVSCGEDRSVRVW 245

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/335 (22%), Positives = 138/335 (41%), Gaps = 44/335 (13%)

Query: 308 AHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-D 366
           ++++ F    D V +L      + +GSYD  V  W+L +GK+ ++ +GH   V+A+ F  
Sbjct: 95  SYLKSFSNE-DWVSALDVGAERIVSGSYDGVVRTWNL-SGKIEKQYSGHTGAVRAVKFIS 152

Query: 367 GQKLITGSLDRMIRVW----------NYVTGA----CVAAYPGHSDSVLSVDSYKKIIVS 412
             +L++G  DR +R+W          + + G      +A   GH   V+SVD     I+S
Sbjct: 153 STRLVSGGNDRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRILS 212

Query: 413 GSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVK 472
            S D ++  W    +    +           L  K+ +        T++   +R    + 
Sbjct: 213 ASYDNSIGFWSTNHKDMTAVDPMDS------LGDKASSAAKKRRKLTMKDGSVRRRAPLS 266

Query: 473 VFRGHVGQVQKVLPLT-------------ILDTENLVTDRTSDPPRNEAT--TAQDPPDG 517
           +   H   V++V+  +              + T +LVT R  D      +  +  + P  
Sbjct: 267 LLESHKAPVEQVIFASNDSTVAYSVSQDHTIKTWDLVTSRCVDTKSTSYSLLSMVELPKL 326

Query: 518 QLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAH 577
           +L A   S  + + L     D++ K+    T + +  H   V  +     + + + S +H
Sbjct: 327 RLLACGSSARHIT-LHDPRADSSAKI----TQQQLLGHKNFVVALDTCPENEYMLCSASH 381

Query: 578 DKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEF 612
           D TVKVWD++S   I+T       +   GI D  F
Sbjct: 382 DGTVKVWDIRSSSSIYTITREDQSVEK-GINDKVF 415

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 92/241 (38%), Gaps = 60/241 (24%)

Query: 284 RKTRPWKVIYRERFKVESNWRKGTAH-IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIW 342
           R  R WK    +   V+       AH +   +GH   V+S+      + + SYD+++  W
Sbjct: 163 RTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRILSASYDNSIGFW 222

Query: 343 D------------------------------LATGKLVRR-----LTGHRDGVKAIYF-- 365
                                          +  G + RR     L  H+  V+ + F  
Sbjct: 223 STNHKDMTAVDPMDSLGDKASSAAKKRRKLTMKDGSVRRRAPLSLLESHKAPVEQVIFAS 282

Query: 366 -DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK--IIVSGS-------- 414
            D     + S D  I+ W+ VT  CV      S S+LS+    K  ++  GS        
Sbjct: 283 NDSTVAYSVSQDHTIKTWDLVTSRCVDT-KSTSYSLLSMVELPKLRLLACGSSARHITLH 341

Query: 415 ---ADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKS-FTCFSGSDDTTIRMWDIRSNTC 470
              AD + K+      T   L GH  +V  +   P++ +   S S D T+++WDIRS++ 
Sbjct: 342 DPRADSSAKI------TQQQLLGHKNFVVALDTCPENEYMLCSASHDGTVKVWDIRSSSS 395

Query: 471 V 471
           +
Sbjct: 396 I 396

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 62/116 (53%), Gaps = 3/116 (2%)

Query: 313 FKGHMDGVLSLQFN--YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK- 369
           F GH   +  L+F+     L +GS DS + IWDL     + +L  H+D +  I+ + +  
Sbjct: 113 FNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDW 172

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE 425
           LI+ S D +I++W+  T  CV  +  H+     +  +  ++++ S +  +K+W+++
Sbjct: 173 LISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLD 228

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 93/237 (39%), Gaps = 56/237 (23%)

Query: 369 KLITGSLDRMIRVWNYVTGACVAAY-----PGHSD---SVLSVDSY------KKIIVSGS 414
           +++TG+L+  +  W+  TG           PG  D   + L+  +Y        ++  G 
Sbjct: 36  QILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGY 94

Query: 415 ADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKV 473
           AD  +K+W + S+T      GH   +  ++  P      SGS D+ I +WD+     +  
Sbjct: 95  ADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYK 154

Query: 474 FRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL 533
            R H                                  +D   G     +D       L+
Sbjct: 155 LRSH----------------------------------KDSITGIWCENED------WLI 174

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGK 590
           S S D  IK+W+++T +CV TH  H    W +A  N  +++ + +  +K+W+L   K
Sbjct: 175 STSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDK 231

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 69/142 (48%), Gaps = 6/142 (4%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYV 385
            LL  G  D  + IWDL +  ++    GH+  +  + FD  G +LI+GS D  I +W+ V
Sbjct: 88  NLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLV 147

Query: 386 TGACVAAYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVK 443
               +     H DS+  +    +  ++S S D  +K+W ++++ C  T   HT     + 
Sbjct: 148 GEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLA 207

Query: 444 LHPKSFTCFSGSDDTTIRMWDI 465
           +H       + S ++ I++W++
Sbjct: 208 IHND--LVITTSTESQIKIWNL 227

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 76/171 (44%), Gaps = 25/171 (14%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK-----------------LIT 372
           + TG+ ++ V  WD+ TG+L + LT   DG+     D +                  L  
Sbjct: 37  ILTGALEN-VNCWDIKTGELSKILT---DGLPPGAVDAKSTKLAESTYLQYHPETNLLAV 92

Query: 373 GSLDRMIRVWNYVTGACVAAYPGHSD--SVLSVDSYKKIIVSGSADKTVKVWHVESRT-C 429
           G  D +I++W+ ++   +  + GH    +VL  D     ++SGS D  + +W +      
Sbjct: 93  GYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGL 152

Query: 430 YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
           Y LR H + +  +    + +   S S D  I++WD+++  CV+    H  +
Sbjct: 153 YKLRSHKDSITGIWCENEDW-LISTSKDGLIKIWDLKTQQCVETHMAHTSE 202

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 72/171 (42%), Gaps = 48/171 (28%)

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTS 501
           ++ HP++     G  D  I++WD+ S T +  F GH                        
Sbjct: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH------------------------ 116

Query: 502 DPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKC----VRTHFG 557
              ++  T  +  P G            + L+S S D+ I +W++  G+     +R+H  
Sbjct: 117 ---KSAITVLRFDPTG------------TRLISGSKDSDIIIWDL-VGEVGLYKLRSHKD 160

Query: 558 HVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIG 608
            + GIW    +   ++S + D  +K+WDL++ +C+ T  +H +   C G+ 
Sbjct: 161 SITGIW--CENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSE--CWGLA 207

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 78/160 (48%), Gaps = 7/160 (4%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVT 386
           L F  S    + +++  +   + +  GH D + A+ +  DG +++T + D  I++W+ V+
Sbjct: 328 LAFGSSTLGQLLVYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVS 387

Query: 387 GACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVESRTCYTLRGHTEWV--GTV 442
           G C+A +  H+ SV SV   K  +I+ S S D TVK W +     +     TE +    +
Sbjct: 388 GFCLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCL 447

Query: 443 KLHPKSFTCFSGS-DDTTIRMWDIRSNTCVKVFRGHVGQV 481
              P      +GS D+  I++W +++   +    GH G V
Sbjct: 448 AADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPV 487

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 62/127 (48%), Gaps = 8/127 (6%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTG-HRDGVKAIYFD 366
           +  F+ H   V S+QF  N +++F+ S D TV  WDL   +  R  T   R     +  D
Sbjct: 391 LATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAAD 450

Query: 367 --GQKLITGSLDRM-IRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKV 421
             G+ +  GSLD   I+VW+  TG  +    GH   V  LS      I+ S S DKT++V
Sbjct: 451 PTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTIRV 510

Query: 422 WHVESRT 428
           W +  R+
Sbjct: 511 WSIFGRS 517

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 101/225 (44%), Gaps = 26/225 (11%)

Query: 308 AHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF 365
           ++I + +GH D + +L +  +   + T + D  + IWD+ +G  +     H   V ++ F
Sbjct: 347 SYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQF 406

Query: 366 --DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSD---SVLSVDSYKKIIVSGSADK-TV 419
             +GQ + + SLD  ++ W+ +       +        S L+ D   +++ +GS D   +
Sbjct: 407 AKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDI 466

Query: 420 KVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV 478
           +VW V++ +   TL GH   V  +    ++    S S D TIR+W I             
Sbjct: 467 QVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTIRVWSI------------F 514

Query: 479 GQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALD 523
           G+ Q+V P   ++  + V D +  P   +   A    +GQLS  D
Sbjct: 515 GRSQQVEP---IEAYSDVLDISMRPDGKQ--VAVSTLNGQLSFFD 554

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 80/196 (40%), Gaps = 50/196 (25%)

Query: 419 VKVWHVESRTCYTLR--GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRG 476
           V  W  ES   Y L+  GH + +  +   P      + ++D  I++WDI S  C+  F  
Sbjct: 340 VYEWQSES---YILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEE 396

Query: 477 HVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCS 536
           H   V                           T+ Q   +GQ+            + S S
Sbjct: 397 HTSSV---------------------------TSVQFAKNGQI------------MFSSS 417

Query: 537 LDNTIKLWEVRTGKCVRTHFGHVEGIWD--IAAD--NFRIVSGAHDK-TVKVWDLQSGKC 591
           LD T+K W++   +  RT F   E I    +AAD     + +G+ D   ++VW +Q+G+ 
Sbjct: 418 LDGTVKAWDLMRFRNFRT-FTATERIQFSCLAADPTGEVVCAGSLDNYDIQVWSVQTGQL 476

Query: 592 IHTFDSHQAPITCVGI 607
           + T   H+ P++C+  
Sbjct: 477 LDTLSGHEGPVSCLSF 492

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 112/298 (37%), Gaps = 71/298 (23%)

Query: 350 VRRLTGHRDGVKAI--YFDGQKLITGSLDRMIRVWNYVTGACVAAYP-----GHSDSVLS 402
           V+   GH D + ++    DG  + T S D  + +W Y        YP     GH  SV +
Sbjct: 383 VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRY-HAKYEDFYPYTKFVGHVGSVNA 441

Query: 403 VD-------SYKKIIVSGSADKTVKVWHVESRTC-------------YTLRGHTEWVGTV 442
           V        S+ + I++ S D T+K W V   T              YT R H + +  +
Sbjct: 442 VGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAI 501

Query: 443 KLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD 502
            + P      + S D T ++W++             G+ Q  L                 
Sbjct: 502 SISPNDSLFATASYDKTCKIWNLDD-----------GEFQATLA---------------- 534

Query: 503 PPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI 562
              N      D    Q         Y   L +CS D TIK+W + +   V+T  GH   +
Sbjct: 535 ---NHKRGLWDVAFCQ---------YDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAV 582

Query: 563 W--DIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI-GDSE-FVSGD 616
                   N +++S   D  V +WDL +G+ + T D+H   I  + +  D E FV+ D
Sbjct: 583 QRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTAD 640

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 74/189 (39%), Gaps = 23/189 (12%)

Query: 328 RLLFTGSYDSTVAIWDL--------------ATGKLVRRLTGHRDGVKAIYF--DGQKLI 371
             + T S D T+  W +               T +  RR   H   + AI    +     
Sbjct: 454 EFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRR--AHEKDINAISISPNDSLFA 511

Query: 372 TGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD--SYKKIIVSGSADKTVKVWHVESRTC 429
           T S D+  ++WN   G   A    H   +  V    Y K++ + S DKT+K+W +ES   
Sbjct: 512 TASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAV 571

Query: 430 Y-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLT 488
             TL GHT  V       K+    S   D  + +WD+ +   VK    H  ++  +  + 
Sbjct: 572 VKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMN 631

Query: 489 ILDTENLVT 497
             D E+ VT
Sbjct: 632 --DGESFVT 638

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 65/136 (47%), Gaps = 7/136 (5%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRM 378
           +S+  N  L  T SYD T  IW+L  G+    L  H+ G+  + F    + L T S D+ 
Sbjct: 501 ISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKT 560

Query: 379 IRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGH 435
           I++W+  + A V    GH+++V   S  +  K ++S  AD  V +W + +  +  TL  H
Sbjct: 561 IKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAH 620

Query: 436 TE--WVGTVKLHPKSF 449
               W   V    +SF
Sbjct: 621 NNRIWALAVMNDGESF 636

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/338 (20%), Positives = 115/338 (34%), Gaps = 69/338 (20%)

Query: 277 VASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQFNYRLLF--TGS 334
           +A+ + T +  P      E F+   N       ++ ++GH D + SL      L+  T S
Sbjct: 350 LATNSPTLRIIPTPTSSEEEFENGENKETFPIEVKMYEGHTDLLNSLDATADGLWVATAS 409

Query: 335 YDSTVAIWDLATGKL----VRRLTGHRDGVKAIYFDG-------QKLITGSLDRMIRVWN 383
            D +V +W             +  GH   V A+           + +IT S D  I+ W 
Sbjct: 410 KDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWK 469

Query: 384 ------------YVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES-RT 428
                        +          H   +  +S+     +  + S DKT K+W+++    
Sbjct: 470 VPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEF 529

Query: 429 CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLT 488
             TL  H   +  V          + S D TI++W + S   VK   GH   VQ      
Sbjct: 530 QATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQ------ 583

Query: 489 ILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRT 548
                     R S   +N+                        L+S   D  + +W++ T
Sbjct: 584 ----------RCSFINKNK-----------------------QLISTGADGLVIIWDLST 610

Query: 549 GKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVW 584
           G+ V+T   H   IW +A   D    V+   D   + W
Sbjct: 611 GESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQ------KLITGSLDRMIRVW 382
           LL  G  D +V++ D+  G +   L GH   + ++ F G+      KL +G  + MI+VW
Sbjct: 115 LLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVW 174

Query: 383 NYVTGACVAAYPGHSDSVLSVD 404
           + V   C      H+ +V  +D
Sbjct: 175 DLVKRNCQCTIQEHTTAVRGLD 196

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 21/106 (19%)

Query: 528 YPSHLLSCSLDNTIKLWEV--------------RTGKCVR-THFGHVEGIWDIAADNFRI 572
           +P  +++ S D TIK W+V              +T +  R  H   +  I  I+ ++   
Sbjct: 452 WPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAI-SISPNDSLF 510

Query: 573 VSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSGDEL 618
            + ++DKT K+W+L  G+   T  +H+      G+ D  F   D+L
Sbjct: 511 ATASYDKTCKIWNLDDGEFQATLANHKR-----GLWDVAFCQYDKL 551

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 78/163 (47%), Gaps = 15/163 (9%)

Query: 332 TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYVTGAC 389
           +GS D TV I  L  G+L  +L GH   V ++ F+  G  L T S+D  I+ W+ ++G  
Sbjct: 72  SGSEDFTVEITHLEYGRL-HKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTL 130

Query: 390 VAAYPGHSDSVLSVDS---YKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLH 445
           +     HSD V+S+D+      I+ SGS D  ++++  ES  C  TL    +W     + 
Sbjct: 131 LKTMSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVV 190

Query: 446 PKSFTCFS--------GSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
           P S   FS         S D  +++WD      V+ F+   G+
Sbjct: 191 PISQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRTFKDASGE 233

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 93/217 (42%), Gaps = 43/217 (19%)

Query: 295 ERFKVE-SNWRKGTAHIQEFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVR 351
           E F VE ++   G  H  + +GH   VLS+ FN +  LL T S D ++  WD+ +G L++
Sbjct: 75  EDFTVEITHLEYGRLH--KLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLK 132

Query: 352 RLTGHRDGVKAI---YFDGQKLITGSLDRMIRVWNYVTGACVAAYPGH-----SDSVLSV 403
            ++ H D V +I     D   L +GS D +IR+++  +G C+            D V+ +
Sbjct: 133 TMSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVVPI 192

Query: 404 DSYK-----KIIVSGSADKTVKVWHV--------------ESRTCYTLRGHTEWVGTVKL 444
              K     K ++  S D  VK+W                ESR  Y+        G   L
Sbjct: 193 SQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRTFKDASGESRMKYS-------CGMDFL 245

Query: 445 HPKS----FTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           +P S         G +D  I +W+ +S    +  +G 
Sbjct: 246 YPDSEAADVMVVVGGEDGNICVWNAQSKAVAQTLKGQ 282

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 90/229 (39%), Gaps = 39/229 (17%)

Query: 410 IVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNT 469
           + SGS D TV++ H+E    + LRGH+  V +V  + K     + S D +I+ WD+ S T
Sbjct: 70  VASGSEDFTVEITHLEYGRLHKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGT 129

Query: 470 CVKVFRGHVGQVQKV-LP---------------LTILDTENLVTDRTSDPPRNEATTAQD 513
            +K    H   V  +  P               + I DTE+    +T    ++  T    
Sbjct: 130 LLKTMSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGV 189

Query: 514 PPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEG------------ 561
            P  Q+    +       LL  SLD  +KLW+   G  VRT F    G            
Sbjct: 190 VPISQVKFSRNG----KFLLVRSLDGVVKLWDFIRGCVVRT-FKDASGESRMKYSCGMDF 244

Query: 562 -IWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTF-----DSHQAPITC 604
              D  A +  +V G  D  + VW+ QS     T      DS    ++C
Sbjct: 245 LYPDSEAADVMVVVGGEDGNICVWNAQSKAVAQTLKGQHEDSPVIAVSC 293

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 104/266 (39%), Gaps = 43/266 (16%)

Query: 355 GHRDGVKAI--YFDGQKLITGSLDRMIRVWNYVTGAC----VAAYPGHSDSVLSV----- 403
           GH D + ++    DG  + T S D    VW Y   +C     A Y GHS +V +V     
Sbjct: 386 GHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNI 445

Query: 404 --DSYKKIIVSGSADKTVKVWHVESRTC-----------YTLRGHTEWVGTVKLHPKSFT 450
               Y + +++ S D T+K W +   T            YT   H + +  + + P    
Sbjct: 446 VSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSI 505

Query: 451 CFSGSDDTTIRMWDIRSNTCVKVFRGH--------VGQVQKVLPLTILDTENLVTDRTSD 502
             + S D T ++W++ +         H          Q  K+L  +         D+T  
Sbjct: 506 FATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATS-------SGDKTVK 558

Query: 503 PPRNEATTAQDPPDGQLSALD--DSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVE 560
               +  +     +G  +A+     +     L+SC  D  IK+W+  +G+C++T  GH  
Sbjct: 559 IWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNN 618

Query: 561 GIWDIAA--DNFRIVSGAHDKTVKVW 584
            +W ++   D   IVS   D   + W
Sbjct: 619 RLWALSTMNDGDMIVSADADGVFQFW 644

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 69/148 (46%), Gaps = 5/148 (3%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRM 378
           LS+  N  +  T SYD T  IW+L  G+L   L  H+ G+  + F    + L T S D+ 
Sbjct: 497 LSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKT 556

Query: 379 IRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCY-TLRGH 435
           +++W+  T + +    GH+++V   S  + +K ++S  AD  +K+W   S  C  TL GH
Sbjct: 557 VKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGH 616

Query: 436 TEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
              +  +          S   D   + W
Sbjct: 617 NNRLWALSTMNDGDMIVSADADGVFQFW 644

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 60/143 (41%), Gaps = 20/143 (13%)

Query: 339 VAIWDLATGKLVRRLTGHRDGVKAIYFDGQK----LITGSLDRMIRVWNYVTGACVAAYP 394
           + I+ L TGK+VR +   +    +   D       L  G  D  I V +   G    ++ 
Sbjct: 85  LKIFHLKTGKVVRSM---KISSPSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFK 141

Query: 395 GHSDSVLSVDSYKKI------IVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKL--- 444
           GH  ++ S+  Y ++      + SG  +  VKVW +  R C +TL+ HT  V  + +   
Sbjct: 142 GHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEV 201

Query: 445 ---HPKSFTCFSGSDDTTIRMWD 464
                 S    SG  D  I +WD
Sbjct: 202 PDNDEPSLNLLSGGRDDIINLWD 224

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 76/199 (38%), Gaps = 49/199 (24%)

Query: 433 RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC-VKVFRGHVGQVQKVLPLTILD 491
            GH + + ++          + S D T  +W    N+C   ++  ++G    V   T + 
Sbjct: 385 EGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAV---TAVG 441

Query: 492 TENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW------- 544
             N+V                            S  YP  LL+ S D TIK W       
Sbjct: 442 LPNIV----------------------------SKGYPEFLLTASNDLTIKKWIIPKPTA 473

Query: 545 --EVRTGKCVR-THFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQ 599
             +V+  K    T   H + I    ++ ++    + ++DKT K+W+L++G+   T  +H+
Sbjct: 474 SMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHK 533

Query: 600 APITCVGIGDSEFVSGDEL 618
                 G+ D  F   D+L
Sbjct: 534 R-----GLWDVSFCQYDKL 547

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
           + SG  +  VKVWDL   KC+HT   H + +  + I
Sbjct: 163 LASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDI 198

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 104/246 (42%), Gaps = 44/246 (17%)

Query: 348 KLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDS 405
           +L+  L GH   +  + +   G+ + + S D   R+W+  T   +    GH   V S+ S
Sbjct: 256 RLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSL-S 314

Query: 406 YK---KIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIR 461
           ++    ++ SG  D    +W + S +   TL GH++ + TV   P  +   +G  D  I 
Sbjct: 315 FQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIIN 374

Query: 462 MWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSA 521
           +WDIR     K   G + Q        IL   N+VT                  DG    
Sbjct: 375 VWDIR-----KRDEGQLNQ--------ILAHRNIVTQ-----------VRFSKEDG---- 406

Query: 522 LDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDK 579
                     L+SC  DN I ++   T   + +  GH + I   DI+ ++  +VSG  D+
Sbjct: 407 -------GKKLVSCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDR 459

Query: 580 TVKVWD 585
           ++K+W+
Sbjct: 460 SIKLWN 465

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 76/162 (46%), Gaps = 11/162 (6%)

Query: 314 KGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQK 369
           +GH  GV SL F  +  L+ +G  DS   +WD+ +G  V  L GH   +  + +  +G +
Sbjct: 304 EGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQ 363

Query: 370 LITGSLDRMIRVWNYVT--GACVAAYPGHSDSVLSVDSYK----KIIVSGSADKTVKVWH 423
           + TG  D +I VW+        +     H + V  V   K    K +VS   D  + V+ 
Sbjct: 364 VATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYS 423

Query: 424 VES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWD 464
            ++     +L GHT+ + ++ +   S    SG  D +I++W+
Sbjct: 424 SDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN 465

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 64/163 (39%), Gaps = 41/163 (25%)

Query: 427 RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLP 486
           R    L GH   +  VK HP      S S D T R+WD  ++  + +  GH    + V  
Sbjct: 256 RLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHD---KGVFS 312

Query: 487 LTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV 546
           L+                           DG L            + S  +D+   LW++
Sbjct: 313 LSF------------------------QCDGSL------------VCSGGMDSLSMLWDI 336

Query: 547 RTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQ 587
           R+G  V T  GH + I+ +A   + +++ +G  D  + VWD++
Sbjct: 337 RSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIR 379

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 2/82 (2%)

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVW 584
           P    + S S D T +LW+  T + +    GH +G++ ++   D   + SG  D    +W
Sbjct: 275 PSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLW 334

Query: 585 DLQSGKCIHTFDSHQAPITCVG 606
           D++SG  + T   H  PI  V 
Sbjct: 335 DIRSGSKVMTLAGHSKPIYTVA 356

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 93/219 (42%), Gaps = 41/219 (18%)

Query: 274 NPPVASETTTRKTR-----PWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQF--- 325
           +PP   +   ++T+     P KVIYR                  +KGH +G  SL+    
Sbjct: 118 HPPADVDVDFKRTQFKCYLPKKVIYR------------------YKGHHNGTTSLRLLPG 159

Query: 326 NYRLLFTGSYDSTVAIWDLATG-KLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVW 382
              L+ +G  D+TV +WD     K +R   GH   +K + F  D  + ++GS D+ +++W
Sbjct: 160 TGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQVKIW 219

Query: 383 NYVTGAC---VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRT------CYTLR 433
           +  TG     +  Y   + +     S  + +V  S+    K+ H ++R            
Sbjct: 220 DTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSS---KIKHYDTRVSEKDGLVQVYD 276

Query: 434 GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVK 472
            H   +  +K  P      S S+D T+R+W+ + N  +K
Sbjct: 277 HHLSSILAIKYFPDGSKFISSSEDKTLRIWNNQVNIPIK 315

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 6/96 (6%)

Query: 526 LPYPSHL-LSCSLDNTIKLWEV-RTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTV 581
           LP   HL LS   DNT+KLW+     KC+R   GH + I   D  +D+ + +SG++D+ V
Sbjct: 157 LPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQV 216

Query: 582 KVWDLQSGKCIHTFDSHQAPITCV--GIGDSEFVSG 615
           K+WD ++GK     +++  P +        +EFV G
Sbjct: 217 KIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVG 252

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 83/185 (44%), Gaps = 20/185 (10%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIY--F 365
           +++F GH   + +L F  +     +GSYD  V IWD  TGK+ +RL  +     A +   
Sbjct: 185 LRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPT 244

Query: 366 DGQKLITGSLDRMIRVWNYVTG---ACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVK 420
            G + + G     I+ ++         V  Y  H  S+L++  +      +S S DKT++
Sbjct: 245 SGNEFVVGLSSSKIKHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFISSSEDKTLR 304

Query: 421 VWHVE-----SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCV---K 472
           +W+ +      +   T +    ++G   +HP+     + S D+ I  + ++    +   K
Sbjct: 305 IWNNQVNIPIKQISDTTQHSMPYIG---IHPEHNYFSTQSMDSVIYSYSMKPKYKMHPNK 361

Query: 473 VFRGH 477
            F+GH
Sbjct: 362 KFKGH 366

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 66/175 (37%), Gaps = 17/175 (9%)

Query: 384 YVTGACVAAYPGHSDSVLSV---DSYKKIIVSGSADKTVKVWHV-ESRTCY-TLRGHTEW 438
           Y+    +  Y GH +   S+        +I+SG  D TVK+W     R C     GH++ 
Sbjct: 135 YLPKKVIYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKP 194

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTD 498
           + T+     S    SGS D  +++WD  +    K  R +                  V  
Sbjct: 195 IKTLDFTSDSSQFLSGSYDQQVKIWDTETGKVTK--RLNTYSTPNSAEFRPTSGNEFVVG 252

Query: 499 RTSDPPRNEATTAQDPPDGQLSALDDSL---------PYPSHLLSCSLDNTIKLW 544
            +S   ++  T   +  DG +   D  L         P  S  +S S D T+++W
Sbjct: 253 LSSSKIKHYDTRVSE-KDGLVQVYDHHLSSILAIKYFPDGSKFISSSEDKTLRIW 306

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 61/284 (21%), Positives = 110/284 (38%), Gaps = 68/284 (23%)

Query: 355 GHRDGVKAI--YFDGQKLITGSLDRMIRVWNYVTGAC----VAAYPGHSDSVLSVD---- 404
           GH D + ++    DG  L T S D  + +W Y   +        + GH+  V ++     
Sbjct: 380 GHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNV 439

Query: 405 ---SYKKIIVSGSADKTVKVW--------------HVESRTCYTLRGHTEWVGTVKLHPK 447
              ++ + +++ S D T+K W              H+   + YT R H + +  + + P 
Sbjct: 440 MNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPN 499

Query: 448 SFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNE 507
                + S D T ++W++ +           G+V                         E
Sbjct: 500 DSIFATASYDKTCKIWNVDT-----------GEV-------------------------E 523

Query: 508 ATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA- 566
           AT A         A      Y   L +CS D +I LW + +   ++T  GH   +  ++ 
Sbjct: 524 ATLANHKRGLWGVAF---CEYDWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSF 580

Query: 567 -ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGD 609
              N ++VS   D  VK+WD  +G+C+ T D+H   I  + + +
Sbjct: 581 INGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALAVAN 624

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 110/304 (36%), Gaps = 70/304 (23%)

Query: 313 FKGHMDGVLSLQFNYRLLF--TGSYDSTVAIWDL----ATGKLVRRLTGHRDGVKAIYFD 366
           ++GH D + SL      L+  T S D +V +W      ++ +   +  GH   V AI   
Sbjct: 378 YEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALP 437

Query: 367 G-------QKLITGSLDRMIRVWN-------------YVTGACVAAYPGHSDSV--LSVD 404
                   + L+T S D  I+ W              ++  A       H   +  +S+ 
Sbjct: 438 NVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMS 497

Query: 405 SYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
               I  + S DKT K+W+V++     TL  H   +  V      +   + S D +I +W
Sbjct: 498 PNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLW 557

Query: 464 DIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALD 523
            + S T +K   GH   VQ+V                                       
Sbjct: 558 SLESFTVLKTLEGHTNAVQRV--------------------------------------- 578

Query: 524 DSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTV 581
             +     L+S   D  +K+W+  TG+CVRT   H   IW +A   D   I++   D   
Sbjct: 579 SFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALAVANDGQLIITADADGVF 638

Query: 582 KVWD 585
           + W+
Sbjct: 639 QFWE 642

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 69/152 (45%), Gaps = 5/152 (3%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRM 378
           +S+  N  +  T SYD T  IW++ TG++   L  H+ G+  + F      L T S DR 
Sbjct: 494 ISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRS 553

Query: 379 IRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCY-TLRGH 435
           I +W+  +   +    GH+++V  +S  +  K +VS  AD  VK+W   +  C  TL  H
Sbjct: 554 INLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAH 613

Query: 436 TEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
              +  + +        +   D   + W+  S
Sbjct: 614 NNRIWALAVANDGQLIITADADGVFQFWEDNS 645

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 53/110 (48%), Gaps = 11/110 (10%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK------LITGSLDRMIRVW 382
           LL  G  D +V ++D+A G +   L GH   + ++ F G+       L +G  + M+++W
Sbjct: 115 LLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIW 174

Query: 383 NYVTGACVAAYPGHSDSVLSVD-----SYKKIIVSGSADKTVKVWHVESR 427
           + V   C+     H+ +V  +D       + +++SG  D  V V H + +
Sbjct: 175 DLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHHFDMK 224

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDS-VLSVDSYKKIIVSGSADKTVKVWHV 424
           DG+ L   S ++++R ++  T     +    S + VL  D    ++  G  D +V V+ +
Sbjct: 71  DGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAYVLDCDESSTLLAVGGTDGSVNVFDI 130

Query: 425 ES-RTCYTLRGHTEWVGTVKLHPK----SFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
            +    ++L+GH   + +VK + +     +   SG  +  +++WD+    C+   + H  
Sbjct: 131 ANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTA 190

Query: 480 QVQ 482
            V+
Sbjct: 191 AVR 193

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 43/95 (45%), Gaps = 16/95 (16%)

Query: 529 PSHLLSC----------SLDNTIKLWEVRTGKCVRTHFGH------VEGIWDIAADNFRI 572
           P+++L C            D ++ ++++  G    +  GH      V+   ++ +  + +
Sbjct: 103 PAYVLDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLL 162

Query: 573 VSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
            SG  +  VK+WDL   +CIHT   H A +  + I
Sbjct: 163 ASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLDI 197

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 62/152 (40%), Gaps = 18/152 (11%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK----LITGSLD 376
           L L  + R L   S +  +  +DL T +  R +   +    A   D  +    L  G  D
Sbjct: 66  LRLTPDGRYLCYASQNQLLRFYDLETKRTTRSM---KISSPAYVLDCDESSTLLAVGGTD 122

Query: 377 RMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI------IVSGSADKTVKVWHVESRTC- 429
             + V++   G    +  GH  ++ SV  Y ++      + SG  +  VK+W +  R C 
Sbjct: 123 GSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVKRRCI 182

Query: 430 YTLRGHTEWVGTVKLH----PKSFTCFSGSDD 457
           +T++ HT  V  + +      +S     G DD
Sbjct: 183 HTVQEHTAAVRGLDIRVQEGAESLLLSGGRDD 214

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 71/158 (44%), Gaps = 9/158 (5%)

Query: 315 GHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV-KAIYFDGQKLITG 373
           GH   V  L+F   LL + S+D T  IWD    KL   L  H   V  +       ++T 
Sbjct: 100 GHTGNVCGLRFQNGLLLSSSWDKTAKIWD--NNKLKYDLRNHEASVWDSTMVSDDIILTA 157

Query: 374 SLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKTVKVWHVESRTCYT 431
           S D+ I VW  + G  +       D V+    Y    I  S S D T+K+ ++E      
Sbjct: 158 SADKSIGVW--MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLEGEIKNV 215

Query: 432 LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNT 469
             GH  +V  VK H  + T FS  +D+T+R+W I  +T
Sbjct: 216 FEGHESFVYCVK-HMNN-TLFSCGEDSTVRIWSINGST 251

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 61/137 (44%), Gaps = 6/137 (4%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTG-HRDGVKAI-YFDGQKLITGSLDRMIRVWNYVT 386
           ++ T S D ++ +W    GKL+++L+  H D ++ + Y       + S D  I++ N + 
Sbjct: 153 IILTASADKSIGVW--MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLN-LE 209

Query: 387 GACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHP 446
           G     + GH   V  V      + S   D TV++W +   T   +R     V  + L P
Sbjct: 210 GEIKNVFEGHESFVYCVKHMNNTLFSCGEDSTVRIWSINGSTKQVIRIPAVSVWNLDLLP 269

Query: 447 KSFTCFSGSDDTTIRMW 463
                   SD+ TIR++
Sbjct: 270 NGDFVICCSDN-TIRIF 285

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 106/258 (41%), Gaps = 30/258 (11%)

Query: 348 KLVRRLTGHRDGVKAI-YFDGQKLITGSLDRMIRVWN-YVTGACVAAYPGHSDSVLSVDS 405
           +L   L GH   VK I   +  K+ + S D  +RVW    +G         SD  L+   
Sbjct: 3   QLSATLRGHSQDVKDITAVNDNKIASVSRDGSLRVWTRSSSGDWEDVLVYQSDKFLNAVC 62

Query: 406 YKKI---IVSGSADKTVKVWHVE------SRTCYTLRGHTEWVGTV-KLHPKSFTCFSGS 455
           Y K    +  G  D  +   H+E      +   YTL GHT   G V  L  ++    S S
Sbjct: 63  YDKTSQTVYYGGQDTLINGSHIEDVIGSSADPMYTLVGHT---GNVCGLRFQNGLLLSSS 119

Query: 456 DDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPP 515
            D T ++WD  +N      R H   V      + + +++++   ++D  ++     +   
Sbjct: 120 WDKTAKIWD--NNKLKYDLRNHEASVWD----STMVSDDIILTASAD--KSIGVWMEGKL 171

Query: 516 DGQLSALDDS----LPYPSH--LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADN 569
             +LS + D     L Y S+    SCS D TIKL  +  G+      GH   ++ +   N
Sbjct: 172 IKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLE-GEIKNVFEGHESFVYCVKHMN 230

Query: 570 FRIVSGAHDKTVKVWDLQ 587
             + S   D TV++W + 
Sbjct: 231 NTLFSCGEDSTVRIWSIN 248

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 99/225 (44%), Gaps = 26/225 (11%)

Query: 308 AHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF 365
           ++I + +GH D   SL +  +   + T + D  + +WD+A+G  +     H   V A+ F
Sbjct: 332 SYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAVTAVQF 391

Query: 366 --DGQKLITGSLDRMIRVWN---YVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADK-TV 419
              GQ L + SLD  +R W+   Y       A      + L+V+   +++ +GS D   V
Sbjct: 392 AKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDV 451

Query: 420 KVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV 478
            VW V++ +   TL GH   V  +    ++    S S D TIR+W I             
Sbjct: 452 FVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSI------------F 499

Query: 479 GQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALD 523
           G+ Q+V PL +   + L    T D      +T +    GQL+  D
Sbjct: 500 GRSQQVEPLEVF-ADILAITITPDGKHVAVSTLK----GQLTIFD 539

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 77/160 (48%), Gaps = 7/160 (4%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVT 386
           L F  S    + +++  +   + +  GH D   ++ +  DG +++T + D  I+VW+  +
Sbjct: 313 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVAS 372

Query: 387 GACVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVWHVESRTCYTLRGHTEWV--GTV 442
           G C+A +  H+ +V +V   KK  ++ S S D TV+ W +     + +   TE V    +
Sbjct: 373 GFCLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCL 432

Query: 443 KLHPKSFTCFSGSDDT-TIRMWDIRSNTCVKVFRGHVGQV 481
            + P      +GS D+  + +W +++   +    GH G V
Sbjct: 433 AVEPSGEVVSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPV 472

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 114/275 (41%), Gaps = 49/275 (17%)

Query: 322 SLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGS--LDR 377
           +   N  LL  G  +    ++++    +V++L+  ++ V  +  +  G+ L  GS  L +
Sbjct: 263 TFHINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWLAFGSSKLGQ 322

Query: 378 MIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCY-TLRG 434
           ++ V+ + + + +    GH D+   L+       +V+ + D  +KVW V S  C  T   
Sbjct: 323 LL-VYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEE 381

Query: 435 HTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTEN 494
           HT  V  V+   K    FS S D T+R WD+      +VF        + +  T L  E 
Sbjct: 382 HTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTA-----TERVQFTCLAVE- 435

Query: 495 LVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT 554
                    P  E  +A     G   + D                 + +W V+TG+ + T
Sbjct: 436 ---------PSGEVVSA-----GSTDSFD-----------------VFVWSVQTGQLLDT 464

Query: 555 HFGHVEG---IWDIAADNFRIVSGAHDKTVKVWDL 586
             GH EG       + +N  + S + DKT+++W +
Sbjct: 465 LSGH-EGPVSCLAFSMENAVLASASWDKTIRIWSI 498

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 72/193 (37%), Gaps = 50/193 (25%)

Query: 422 WHVESRTCYTLR--GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           W  ES   Y L+  GH +   ++   P      + ++D  I++WD+ S  C+  F  H  
Sbjct: 328 WQSES---YILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTS 384

Query: 480 QVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDN 539
            V                           T  Q    GQ+            L S SLD 
Sbjct: 385 AV---------------------------TAVQFAKKGQV------------LFSASLDG 405

Query: 540 TIKLWEVRTGKCVRTHFGHVEGI----WDIAADNFRIVSGAHDK-TVKVWDLQSGKCIHT 594
           T++ W++   +  R  F   E +      +      + +G+ D   V VW +Q+G+ + T
Sbjct: 406 TVRAWDLIRYRNFRV-FTATERVQFTCLAVEPSGEVVSAGSTDSFDVFVWSVQTGQLLDT 464

Query: 595 FDSHQAPITCVGI 607
              H+ P++C+  
Sbjct: 465 LSGHEGPVSCLAF 477

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 315 GHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGK---LVRRLTGHRDGVKAIYFDG-- 367
           GH   + S  +++  R L T S D T  +W + +     +   L GHRD V   YF+   
Sbjct: 144 GHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQ 203

Query: 368 QKLITGSLDRMIRVWNYVTGA 388
           +K+ T S D  +  W Y++ A
Sbjct: 204 EKIYTISKDGAVFTWEYISKA 224

>Kwal_23.6240
          Length = 913

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 96/225 (42%), Gaps = 26/225 (11%)

Query: 308 AHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF 365
           ++I + +GH D   ++ +  +   + T S D  + IWD+ +G  +     H   V A+ F
Sbjct: 332 SYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAF 391

Query: 366 D--GQKLITGSLDRMIRVWNYVTGACVAAYPGHSD---SVLSVDSYKKIIVSGSADK-TV 419
              GQ L + SLD  +R W+ V       +        + L+ D   +++ +GS D   V
Sbjct: 392 AKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAV 451

Query: 420 KVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV 478
            VW V++ +   TL GH   V  +    ++    S S D TIR+W I             
Sbjct: 452 HVWSVQTGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSI------------F 499

Query: 479 GQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALD 523
           G+ Q+V PL +      V   +  P  NE   A    DGQ+   D
Sbjct: 500 GRSQQVEPLEVYAD---VLSLSVRPDGNEVAAA--TLDGQILFFD 539

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 72/160 (45%), Gaps = 7/160 (4%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVT 386
           L F  S    + +++  +   + +  GH D   A+ +  DG +++T S D  I++W+ V+
Sbjct: 313 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVS 372

Query: 387 GACVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVWHV---ESRTCYTLRGHTEWVGT 441
           G C+  +  H+ +V ++   K+  ++ S S D TV+ W +    +   +T     ++   
Sbjct: 373 GFCLVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCL 432

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
                    C    D   + +W +++   V+   GH G V
Sbjct: 433 AADPSGEVVCAGSVDSFAVHVWSVQTGQLVETLDGHEGPV 472

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 77/196 (39%), Gaps = 50/196 (25%)

Query: 419 VKVWHVESRTCYTLR--GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRG 476
           V  W  ES   Y L+  GH +    V   P      + S+D  I++WD+ S  C+  F+ 
Sbjct: 325 VYEWQSES---YILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQE 381

Query: 477 HVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCS 536
           H   V  +                                GQ+            L S S
Sbjct: 382 HTAAVSALAF---------------------------AKRGQV------------LFSAS 402

Query: 537 LDNTIKLWEVRTGKCVRTHFGHVEGIWD--IAAD--NFRIVSGAHDK-TVKVWDLQSGKC 591
           LD T++ W++   +  RT F   E I    +AAD     + +G+ D   V VW +Q+G+ 
Sbjct: 403 LDGTVRAWDLVRYRNFRT-FTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSVQTGQL 461

Query: 592 IHTFDSHQAPITCVGI 607
           + T D H+ P++C+  
Sbjct: 462 VETLDGHEGPVSCLSF 477

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 115/278 (41%), Gaps = 53/278 (19%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGS--LD 376
           ++   N   L  G  +    +++L    L+++L+  ++ V  +  +  G+ L  GS  L 
Sbjct: 262 VTFHANSNTLVVGFNNGEFRLYELPEFTLIQQLSMGQNAVNTVCVNDSGEWLAFGSSKLG 321

Query: 377 RMIRVWNYVTGACVAAYPGHSDSVLSVDSYK---KIIVSGSADKTVKVWHVESRTCY-TL 432
           +++ V+ + + + +    GH D+  +V +Y      +V+ S D  +K+W V S  C  T 
Sbjct: 322 QLL-VYEWQSESYILKQQGHFDATNAV-TYSPDGSRVVTASEDGKIKIWDVVSGFCLVTF 379

Query: 433 RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDT 492
           + HT  V  +    +    FS S D T+R WD+      + F                  
Sbjct: 380 QEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTA---------------- 423

Query: 493 ENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDN-TIKLWEVRTGKC 551
                       R +       P G++            + + S+D+  + +W V+TG+ 
Sbjct: 424 ----------AERIQFNCLAADPSGEV------------VCAGSVDSFAVHVWSVQTGQL 461

Query: 552 VRTHFGHVEG---IWDIAADNFRIVSGAHDKTVKVWDL 586
           V T  GH EG       + +N  + S + DKT+++W +
Sbjct: 462 VETLDGH-EGPVSCLSFSQENSVLASASWDKTIRIWSI 498

>Scas_679.28
          Length = 815

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 66/121 (54%), Gaps = 7/121 (5%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-DGQKLI-TGSLDRM 378
           L++  N  +  T SYD T  IWDL  G+L   L+ H+ G+  + F    KLI T S D+ 
Sbjct: 497 LAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKT 556

Query: 379 IRVWNYVTGACVAAYPGHSDSV---LSVDSYKKIIVSGSADKTVKVWHVESRTCY-TLRG 434
           I++W+  T + +    GH+++V   + ++   +++ SG AD  +K+W   +  C  TL G
Sbjct: 557 IKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSG-ADGLIKIWDCSTGDCLKTLDG 615

Query: 435 H 435
           H
Sbjct: 616 H 616

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 98/281 (34%), Gaps = 67/281 (23%)

Query: 350 VRRLTGHRDGVKAI--YFDGQKLITGSLDRMIRVWNYVTGAC----VAAYPGHSDSVLSV 403
           V    GH D + ++    DG  + T S D    VW Y +          + GHS +V +V
Sbjct: 379 VEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAV 438

Query: 404 D-------SYKKIIVSGSADKTVKVWHVESRTC-------------YTLRGHTEWVGTVK 443
                    Y + +++ S D T+K W +   +              YT R H + +  + 
Sbjct: 439 GLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALA 498

Query: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDP 503
           + P      + S D T ++WD+ +         H   +  V                   
Sbjct: 499 ISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVA------------------ 540

Query: 504 PRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW 563
                                   Y   + +CS D TIK+W + T   ++T  GH   + 
Sbjct: 541 ---------------------FCQYDKLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQ 579

Query: 564 DIAADN--FRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPI 602
                N   ++VS   D  +K+WD  +G C+ T D H   I
Sbjct: 580 RCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRI 620

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 68/173 (39%), Gaps = 21/173 (12%)

Query: 328 RLLFTGSYDSTVAIWDL--------------ATGKLVRRLTGHRDGVKAIYFDGQKLI-- 371
             L T S D T+  W +                 +  RR   H   + A+       I  
Sbjct: 450 EFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRR--AHEKDINALAISPNDSIFA 507

Query: 372 TGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD--SYKKIIVSGSADKTVKVWHVESRTC 429
           T S D+  ++W+   G   A    H   +  V    Y K+I + S DKT+K+W +++ + 
Sbjct: 508 TASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSV 567

Query: 430 Y-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
             TL GHT  V       K     S   D  I++WD  +  C+K   GH  ++
Sbjct: 568 MKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRI 620

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 113/306 (36%), Gaps = 69/306 (22%)

Query: 309 HIQEFKGHMDGVLSLQFNYRLLF--TGSYDSTVAIWD----LATGKLVRRLTGHRDGVKA 362
           +++ ++GH D + SL      L+  T S D T  +W     +   +   +  GH   V A
Sbjct: 378 NVEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTA 437

Query: 363 IYFDG-------QKLITGSLDRMIRVWNY------VTGAC----VAAYP--GHSDSV--L 401
           +           + L+T S D  I+ W        V   C    V+ Y    H   +  L
Sbjct: 438 VGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINAL 497

Query: 402 SVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTI 460
           ++     I  + S DKT K+W +E+     TL  H   +  V          + S D TI
Sbjct: 498 AISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTI 557

Query: 461 RMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLS 520
           ++W + + + +K   GH   VQ+ + +                            + QL 
Sbjct: 558 KIWSLDTFSVMKTLEGHTNAVQRCMFI----------------------------NKQL- 588

Query: 521 ALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHD 578
                      L+S   D  IK+W+  TG C++T  GH   IW +    D   IVS   D
Sbjct: 589 ----------QLVSSGADGLIKIWDCSTGDCLKTLDGHDNRIWALTEINDGDMIVSADAD 638

Query: 579 KTVKVW 584
              + W
Sbjct: 639 GVFQFW 644

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/332 (19%), Positives = 135/332 (40%), Gaps = 64/332 (19%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK------LITGSLDRMIRVW 382
           L+  G  D ++ + D+  G +   L GH   + A+ F GQ       L +G  + M++VW
Sbjct: 120 LVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVW 179

Query: 383 NYVTGACVAAYPGHSDSVLSVDSYKKI-----IVSGSADKTVKVWHVESRTCYTLRGHTE 437
           + V   C+     HS++V  +D  +++     ++SG  D    +W+      + L+    
Sbjct: 180 DLVKRKCLHTMQEHSNAVRGLD-VREVGDEWQLISGGRDNVCTLWN------FNLKKKCT 232

Query: 438 WVGTVKLHPKSFTC-----------FSGSDDTTIRMWDIRSNTCVKVFRGHVGQ--VQKV 484
            + T+ +H +  +C           ++   D  ++   +   T +K  + H+ +  +  V
Sbjct: 233 LLKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQFISLEKATMIKKTKKHIEELFIIGV 292

Query: 485 LP---------------LTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYP 529
           LP               L ++D ++ + + +SD    E+  A +  +G ++ +    P  
Sbjct: 293 LPILENDKMYLVMSDQTLELVDIKSNLLNESSDIIEIESCIAGN--NGTIADMKFVGPNH 350

Query: 530 SHLLSCSLDNTIKLWEVRTGK------CVRTHFGHVEGI--WDIAADNFRIVSGAHDKTV 581
             L   +   T+++  V + +       V  + GH + +   D   D   + + + D T 
Sbjct: 351 DKLALATNSPTLRIIPVPSSEQEELPINVEMYEGHEDLLNSLDTTDDGLWMATASKDHTA 410

Query: 582 KVWDLQSGKCIHTFD------SHQAPITCVGI 607
            VW   S   I+ F        H A +T VG+
Sbjct: 411 IVWKYNS--IINKFQPYVKFIGHSATVTAVGL 440

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 21/106 (19%)

Query: 528 YPSHLLSCSLDNTIKLWEVRTGKCV---------------RTHFGHVEGIWDIAADNFRI 572
           YP  LL+ S D TIK W++                     R H   +  +  I+ ++   
Sbjct: 448 YPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINAL-AISPNDSIF 506

Query: 573 VSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSGDEL 618
            + ++DKT K+WDL++G+   T  +H+      G+ D  F   D+L
Sbjct: 507 ATASYDKTCKIWDLENGELTATLSNHKR-----GLWDVAFCQYDKL 547

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 78/161 (48%), Gaps = 9/161 (5%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVT 386
           L F  S    + +++  +   + +  GH D   ++ +  DG +++T S D  I+VW+  +
Sbjct: 317 LAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITS 376

Query: 387 GACVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVWH-VESRTCYTLRGHTEWV--GT 441
           G C+A +  H+ SV +V   K+  ++ S S D TV+ W  +  R   T  G TE +    
Sbjct: 377 GFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTG-TERIQFNC 435

Query: 442 VKLHPKSFTCFSGS-DDTTIRMWDIRSNTCVKVFRGHVGQV 481
           + + P      +GS D+  I +W +++   +    GH G V
Sbjct: 436 LAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPV 476

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 86/191 (45%), Gaps = 21/191 (10%)

Query: 308 AHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF 365
           ++I + +GH D   SL +  +   + T S D  + +WD+ +G  +     H   V A+ F
Sbjct: 336 SYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQF 395

Query: 366 D--GQKLITGSLDRMIRVWNYVTGACVAAYPGHSD---SVLSVDSYKKIIVSGSADK-TV 419
              GQ + + SLD  +R W+ +       + G      + L+VD   +++ +GS D   +
Sbjct: 396 AKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDI 455

Query: 420 KVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV 478
            VW V++ +    L GH   V  +    ++    S S D TIR+W I             
Sbjct: 456 HVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSI------------F 503

Query: 479 GQVQKVLPLTI 489
           G+ Q+V P+ +
Sbjct: 504 GRSQQVEPIEV 514

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 110/269 (40%), Gaps = 49/269 (18%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGS--LDRMIRVWN 383
           RLL  G       ++DL    L+++L+  ++ V  +  +  G+ L  GS  L +++ V+ 
Sbjct: 273 RLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLL-VYE 331

Query: 384 YVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVG 440
           + + + +    GH DS   L+       +V+ S D  +KVW + S  C  T   HT  V 
Sbjct: 332 WQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVT 391

Query: 441 TVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRT 500
            V+   +    FS S D T+R WD+      + F G               TE +  +  
Sbjct: 392 AVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTG---------------TERIQFNCL 436

Query: 501 SDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVE 560
           +  P  E   A     G L   D                 I +W V+TG+ +    GH E
Sbjct: 437 AVDPSGEVVCA-----GSLDNFD-----------------IHVWSVQTGQLLDALSGH-E 473

Query: 561 G---IWDIAADNFRIVSGAHDKTVKVWDL 586
           G       + +N  + S + DKT+++W +
Sbjct: 474 GPVSCLSFSQENSVLASASWDKTIRIWSI 502

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 74/192 (38%), Gaps = 48/192 (25%)

Query: 422 WHVESRTCYTLR--GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           W  ES   Y L+  GH +   ++   P      + S+D  I++WDI S  C+  F  H  
Sbjct: 332 WQSES---YILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTS 388

Query: 480 QVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDN 539
            V                           T  Q    GQ+            + S SLD 
Sbjct: 389 SV---------------------------TAVQFAKRGQV------------MFSSSLDG 409

Query: 540 TIKLWEVRTGKCVRTHFGHVEGIWD-IAAD--NFRIVSGAHDK-TVKVWDLQSGKCIHTF 595
           T++ W++   +  RT  G     ++ +A D     + +G+ D   + VW +Q+G+ +   
Sbjct: 410 TVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDAL 469

Query: 596 DSHQAPITCVGI 607
             H+ P++C+  
Sbjct: 470 SGHEGPVSCLSF 481

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 113/300 (37%), Gaps = 59/300 (19%)

Query: 315 GHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGK---LVRRLTGHRDGVKAIYF--DG 367
           GH   + SL +  + R + T S D +  IW + + +         GHRD V   +F  D 
Sbjct: 144 GHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQ 203

Query: 368 QKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESR 427
           +K+ T S D  + VW +         P   D   S D  K+       D +   W +  +
Sbjct: 204 EKIYTVSKDGAVFVWEF------TKRPSDDDDNESEDDDKQ----EEVDISKYSWRITKK 253

Query: 428 TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPL 487
             +    +   V  V  HP +     G      R++D+   T ++  +  +GQ       
Sbjct: 254 HFF--YANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQ--QLSMGQ------- 302

Query: 488 TILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVR 547
                           P N  +  Q           + L + S  L   L     ++E +
Sbjct: 303 ---------------NPVNTVSVNQ---------TGEWLAFGSSKLGQLL-----VYEWQ 333

Query: 548 TGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
           +   +    GH +    +A   D  R+V+ + D  +KVWD+ SG C+ TF+ H + +T V
Sbjct: 334 SESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAV 393

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 287 RPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDS-TVAIWDLA 345
           R W +I    F+  +    GT  IQ         L++  +  ++  GS D+  + +W + 
Sbjct: 412 RAWDLIRYRNFRTFT----GTERIQF------NCLAVDPSGEVVCAGSLDNFDIHVWSVQ 461

Query: 346 TGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWN 383
           TG+L+  L+GH   V  + F  +   L + S D+ IR+W+
Sbjct: 462 TGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWS 501

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 78/160 (48%), Gaps = 7/160 (4%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVT 386
           L F  S    + +++  +   + +  GH D +  + +  DG K++T S +  I++W+  +
Sbjct: 313 LAFGSSKLGQLIVYEWQSESYILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVAS 372

Query: 387 GACVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVWHVESRTCYTLRGHTEWV--GTV 442
           G C+A +  H+  V +V+  KK  ++ S S D TVK W +     +     TE +   ++
Sbjct: 373 GFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSL 432

Query: 443 KLHPKSFTCFSGSDDT-TIRMWDIRSNTCVKVFRGHVGQV 481
            + P      +GS+D+  I +W +++   V    GH G +
Sbjct: 433 AVDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPI 472

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 117/279 (41%), Gaps = 59/279 (21%)

Query: 308 AHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF 365
           ++I + +GH D +  L +  +   + T S++  + IWD+A+G  +     H  GV A+ F
Sbjct: 332 SYILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEF 391

Query: 366 --DGQKLITGSLDRMIRVWN---YVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADK-TV 419
              GQ L + SLD  ++ W+   Y       A      + L+VD   +++ +GS D   +
Sbjct: 392 AKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDI 451

Query: 420 KVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV 478
            VW V++ +   TL GH   +  +    ++    S S D TIR+W +             
Sbjct: 452 FVWSVQTGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVWSL------------F 499

Query: 479 GQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLD 538
           G+ Q+V P  +                ++  +    PDGQ             + + +L 
Sbjct: 500 GRSQQVEPFEVF---------------SDVLSISMKPDGQ------------QIAASTLA 532

Query: 539 NTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAH 577
             I  ++V  GK V    G+++G  D       I+SG H
Sbjct: 533 GQILFFDVAEGKQV----GNIDGKRD-------IISGRH 560

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 110/269 (40%), Gaps = 51/269 (18%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK--AIYFDGQKLITGS--LDRMIRVWNY 384
           +L  G  +    +++L    ++++L+  ++ V   AI   G+ L  GS  L ++I V+ +
Sbjct: 270 ILTVGFSNGEFRLYELPEFIMIQQLSMGQNAVNTVAINSSGEWLAFGSSKLGQLI-VYEW 328

Query: 385 VTGACVAAYPGHSDSV----LSVDSYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWV 439
            + + +    GH D++     S D  K  IV+ S +  +K+W V S  C  T   H   V
Sbjct: 329 QSESYILKQQGHFDTLNGLCYSPDGSK--IVTASHEGKIKIWDVASGFCLATFDEHAGGV 386

Query: 440 GTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDR 499
             V+   K    FS S D T++ WD+      + F                 TE +  + 
Sbjct: 387 SAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTA---------------TERIQFNS 431

Query: 500 TSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHV 559
            +  P  E   A     G   + D                 I +W V+TG+ V T  GH 
Sbjct: 432 LAVDPSGEVVCA-----GSEDSFD-----------------IFVWSVQTGQLVDTLSGHE 469

Query: 560 EGI--WDIAADNFRIVSGAHDKTVKVWDL 586
             I     + +N  + S + DKT++VW L
Sbjct: 470 GPISCLSFSNENGVLASASWDKTIRVWSL 498

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 77/198 (38%), Gaps = 50/198 (25%)

Query: 419 VKVWHVESRTCYTLR--GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRG 476
           V  W  ES   Y L+  GH + +  +   P      + S +  I++WD+ S  C+  F  
Sbjct: 325 VYEWQSES---YILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDE 381

Query: 477 HVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCS 536
           H G V  V                           +    GQ+            L S S
Sbjct: 382 HAGGVSAV---------------------------EFAKKGQV------------LFSAS 402

Query: 537 LDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAAD--NFRIVSGAHDK-TVKVWDLQSGKC 591
           LD T+K W++   +  RT F   E I    +A D     + +G+ D   + VW +Q+G+ 
Sbjct: 403 LDGTVKAWDLIRYRNFRT-FTATERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQTGQL 461

Query: 592 IHTFDSHQAPITCVGIGD 609
           + T   H+ PI+C+   +
Sbjct: 462 VDTLSGHEGPISCLSFSN 479

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 15/128 (11%)

Query: 310 IQEFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI---Y 364
           +  F GH   V+SL FN +  LLFT S D ++ IWD   G L++ ++ H + V ++    
Sbjct: 89  LHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPM 148

Query: 365 FDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSD-----SVLSVDSYK-----KIIVSGS 414
            D   L +GS D +IR+++  TG C+       D      V+ +   K     + ++  S
Sbjct: 149 NDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKS 208

Query: 415 ADKTVKVW 422
            D  VK+W
Sbjct: 209 LDGVVKIW 216

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 15/158 (9%)

Query: 332 TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYVTGAC 389
           T S D +V I  L+ G L+    GH   V ++ F+  G  L T S+D  I++W+ + G+ 
Sbjct: 72  TASDDFSVEIIHLSYG-LLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSL 130

Query: 390 VAAYPGHSDSVLSVD---SYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEW------- 438
           +     HS++V+SVD   +   I+ SGS D  ++++  E+  C  TL    +W       
Sbjct: 131 MKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVV 190

Query: 439 -VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFR 475
            +  VK    +      S D  +++WD      V+ F+
Sbjct: 191 PISQVKFSENARYLLVKSLDGVVKIWDCIGGCVVRTFQ 228

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 80/196 (40%), Gaps = 48/196 (24%)

Query: 410 IVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNT 469
           I + S D +V++ H+     +T  GHT  V ++  + K    F+ S D +I++WD  + +
Sbjct: 70  IATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGS 129

Query: 470 CVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYP 529
            +K    H                            +EA  + D P      ++DS    
Sbjct: 130 LMKTISAH----------------------------SEAVVSVDVP------MNDS---- 151

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRT-----HFGHVEGIWDIAADNFR-----IVSGAHDK 579
           S L S S D  I++++  TG C++T      +    G+  I+   F      ++  + D 
Sbjct: 152 SILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKSLDG 211

Query: 580 TVKVWDLQSGKCIHTF 595
            VK+WD   G  + TF
Sbjct: 212 VVKIWDCIGGCVVRTF 227

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (50%), Gaps = 15/128 (11%)

Query: 310 IQEFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           +    GH   V+SL +N +  LLFT S D ++ +WD+ TG +++ ++ H + V +I    
Sbjct: 89  LHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSD 148

Query: 366 -DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSD-----SVLSVDSYK-----KIIVSGS 414
            DG  L +GS D +IR+++  TG C+       D      V+ +   K     K ++  S
Sbjct: 149 NDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKS 208

Query: 415 ADKTVKVW 422
            D  VK+W
Sbjct: 209 YDGVVKIW 216

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 14/141 (9%)

Query: 349 LVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--- 403
           L+ RL GH   V ++ ++  G  L T S+D  I+VW+ +TG  +     HS+ V+S+   
Sbjct: 88  LLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLS 147

Query: 404 DSYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEW--------VGTVKLHPKSFTCFSG 454
           D+   I+ SGS D  ++++   +  C  TL    +W        +  VK    +      
Sbjct: 148 DNDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVK 207

Query: 455 SDDTTIRMWDIRSNTCVKVFR 475
           S D  +++WD  S   V+ F+
Sbjct: 208 SYDGVVKIWDSVSGDVVRTFK 228

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 82/198 (41%), Gaps = 48/198 (24%)

Query: 408 KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
           K I S S D TV V H +    + L GHT  V ++  + K    F+ S D +I++WD+ +
Sbjct: 68  KCIASCSDDFTVVVTHRQLGLLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLT 127

Query: 468 NTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLP 527
            T +K    H              +E +V+   SD             DG +        
Sbjct: 128 GTVMKTMSAH--------------SEPVVSIDLSD------------NDGSI-------- 153

Query: 528 YPSHLLSCSLDNTIKLWEVRTGKCVRT-----HFGHVEGIWDIAADNFR-----IVSGAH 577
               L S S D  I++++  TG C++T      +    G+  IA   F      ++  ++
Sbjct: 154 ----LSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSY 209

Query: 578 DKTVKVWDLQSGKCIHTF 595
           D  VK+WD  SG  + TF
Sbjct: 210 DGVVKIWDSVSGDVVRTF 227

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADN--FRIVSGAHDKTVKVWDLQSG 589
           + SCS D T+ +   + G   R   GH   +  +  +N    + + + D+++KVWD+ +G
Sbjct: 70  IASCSDDFTVVVTHRQLGLLHRL-VGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTG 128

Query: 590 KCIHTFDSHQAPITCVGIGDSE 611
             + T  +H  P+  + + D++
Sbjct: 129 TVMKTMSAHSEPVVSIDLSDND 150

 Score = 29.3 bits (64), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 46/116 (39%), Gaps = 13/116 (11%)

Query: 326 NYRLLFTGSYDSTVAIWDLATGKLVRRL--------TGHRDGVKAIYFDGQK---LITGS 374
           N + L   SYD  V IWD  +G +VR            H  G+  +Y    +   +++G 
Sbjct: 200 NTKYLLVKSYDGVVKIWDSVSGDVVRTFKPSNKKYNLTHCCGMDFMYPQSTQSPLILSGY 259

Query: 375 LDRMIRVWNYVTGA--CVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRT 428
               I  W+  T A   V        +++S+D +  ++ S S      +W   + T
Sbjct: 260 EKGEIYCWDSNTKAELQVLKIEECDSAIISIDCHNNLMCSLSLAGNCTIWKYVTET 315

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 74/158 (46%), Gaps = 23/158 (14%)

Query: 329 LLFTGSYDSTVAIW-----DLATG-----KLVRRLTGHRDGVKAIYF--DGQKLITGSLD 376
           LL  GS+DST++IW     DL  G     +L+  + GH + VK I +  DG  L T S D
Sbjct: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132

Query: 377 RMIRVWNYVTGA----CVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVW--HVESRT 428
           + + +W          C++    HS  V  V  + K  ++ S S D TV++W  + +   
Sbjct: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192

Query: 429 C-YTLRGH--TEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
           C   L GH  T W              SGSDD+T+R+W
Sbjct: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 85/198 (42%), Gaps = 27/198 (13%)

Query: 311 QEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIWDLATGK--LVRRL--TGHRDGVKAIY 364
           +  K H D V S+ F     LL TGS D  + +  L  GK  L+  L  T H+  V+++ 
Sbjct: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVA 66

Query: 365 F--DGQKLITGSLDRMIRVW-----NYVTGA-----CVAAYPGHSDSVLSVDSYKK--II 410
           +      L  GS D  I +W     +   GA      +A   GH + V  +   +   ++
Sbjct: 67  WRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLL 126

Query: 411 VSGSADKTVKVWHV----ESRTCYT-LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
            + S DK+V +W      E   C + L+ H++ V  V  H K     S S D T+R+W  
Sbjct: 127 ATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKD 186

Query: 466 RSN--TCVKVFRGHVGQV 481
             +   C  V  GH G +
Sbjct: 187 YDDDWECAAVLTGHEGTI 204

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 97/266 (36%), Gaps = 68/266 (25%)

Query: 348 KLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGA----CVAAYPGHSDSVL 401
           +L + L  H D V +I F+  +  L TGS DR I+V     G      V     H  +V 
Sbjct: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63

Query: 402 SVD--SYKKIIVSGSADKTVKVW-----------HVESRTCYTLRGHTEWVGTVKLHPKS 448
           SV    +  ++ +GS D T+ +W            +E      + GH   V  +      
Sbjct: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123

Query: 449 FTCFSGSDDTTIRMWDI----RSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPP 504
               + S D ++ +W+         C+ V + H   V+ V+  T     NL         
Sbjct: 124 CLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT---KHNL--------- 171

Query: 505 RNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTG--KCVRTHFGHVEGI 562
                                      L S S D+T+++W+      +C     GH   I
Sbjct: 172 ---------------------------LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTI 204

Query: 563 W--DIA--ADNFRIVSGAHDKTVKVW 584
           W  D +   D  R+ SG+ D TV+VW
Sbjct: 205 WCSDFSKEEDPIRLCSGSDDSTVRVW 230

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 327 YRLLFTGSYDSTVAIWDLATG--KLVRRLTGHRDGVKAIYF----DGQKLITGSLDRMIR 380
           + LL + SYD TV IW       +    LTGH   +    F    D  +L +GS D  +R
Sbjct: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228

Query: 381 VWNYV 385
           VW Y+
Sbjct: 229 VWKYI 233

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 78/331 (23%), Positives = 130/331 (39%), Gaps = 66/331 (19%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YFDGQKLITGSLDRMIRVW------ 382
           + +GSYD  V  WDL+ G + ++ +GH   ++A+ Y    +L++   DR +R+W      
Sbjct: 118 IISGSYDGIVRTWDLS-GNVQKQYSGHSGPIRAVKYISNTRLVSAGNDRTLRLWKTKNDD 176

Query: 383 -----------------NYVTGACVAAYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHV 424
                            N   G  +A   GH   V+S+D S    I+S S D ++  W  
Sbjct: 177 LKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVSDNSRILSASYDNSIGFW-- 234

Query: 425 ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWD--IRSNTCVKVFRGHVGQVQ 482
              T Y      + +  +  +P +    +      + M D  IR    + +   H   V+
Sbjct: 235 --STIYKEMTVVDPLEDIN-NPNNKISTAARKRRKLTMKDGTIRRRAPLSLLESHTAPVE 291

Query: 483 KVLPLTI-------------LDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYP 529
           +V+  +              + T +LVT R  D      T+       QLS L+      
Sbjct: 292 QVIFDSTDNTVGYSVSQDHTIKTWDLVTARCID---TRTTSYSLLSIAQLSTLN------ 342

Query: 530 SHLLSC-SLDNTIKLWEVRTGKCVRT-------HFGHVEGIWDIAADNFRIVSGAHDKTV 581
             LL+C S    I L + R G   +        H   V  +     + + + SG+HD TV
Sbjct: 343 --LLACGSSARHITLHDPRVGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTV 400

Query: 582 KVWDLQSGKCIHTFDSHQAPITCVGIGDSEF 612
           KVWD++S   ++T       +   G+ D  F
Sbjct: 401 KVWDVRSTSPMYTITREDKSVQK-GVNDKVF 430

 Score = 36.2 bits (82), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 76/196 (38%), Gaps = 33/196 (16%)

Query: 437 EWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLV 496
           +WV ++ +   S    SGS D  +R WD+  N   K + GH G ++ V  ++     +  
Sbjct: 104 DWVSSLDVGDGSKHIISGSYDGIVRTWDLSGN-VQKQYSGHSGPIRAVKYISNTRLVSAG 162

Query: 497 TDRT---------------SDPPRNEATTAQDPPDGQLSALDDSLPYP---------SHL 532
            DRT                   + +     +  DG+  A+ +    P         S +
Sbjct: 163 NDRTLRLWKTKNDDLKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVSDNSRI 222

Query: 533 LSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDK---TVKVWDLQSG 589
           LS S DN+I  W       +      V+ + DI   N +I + A  +   T+K   ++  
Sbjct: 223 LSASYDNSIGFWS-----TIYKEMTVVDPLEDINNPNNKISTAARKRRKLTMKDGTIRRR 277

Query: 590 KCIHTFDSHQAPITCV 605
             +   +SH AP+  V
Sbjct: 278 APLSLLESHTAPVEQV 293

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 75/160 (46%), Gaps = 25/160 (15%)

Query: 328 RLLFTGSYDSTVAIW-----------DLATGKLVRRLTGHRDGVKAIYF--DGQKLITGS 374
            +L  GS+DSTV+IW           DL T +L+  + GH + +K + +  DG+ L T S
Sbjct: 70  NILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCS 128

Query: 375 LDRMIRVWNYVTGA----CVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVW---HVE 425
            D+ + +W          C++    HS  V  V  ++   ++ S S D TV++W     +
Sbjct: 129 RDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDD 188

Query: 426 SRTCYTLRGH--TEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
              C  L GH  T W    +    +    SGSDD T+R+W
Sbjct: 189 WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 70/168 (41%), Gaps = 24/168 (14%)

Query: 313 FKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDL----ATGKLVRRLTGHRDGVKAIYFD 366
            +GH + +  + +++   LL T S D +V IW+        + +  L  H   VK + + 
Sbjct: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164

Query: 367 GQK--LITGSLDRMIRVWNYVTG--ACVAAYPGHSDSVLSVDSYKKI----IVSGSADKT 418
                L + S D  +R+W        C A   GH  +V S D  K      + SGS D T
Sbjct: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGT 224

Query: 419 VKVWHVES----------RTCYTLRGHTEWVGTVKLHPKSFTCFSGSD 456
           V++W +E           +     + HT  V +V   PK +   +GSD
Sbjct: 225 VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSD 272

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 102/270 (37%), Gaps = 65/270 (24%)

Query: 344 LATGKLVRRLTGHRDGVKAIYFD-GQKLITGSLDRMIRVWNYVTGACVAAY--PGHSDSV 400
           +A  KL++ L  H D   ++  + G  + TGS DR I++ +  +   +       H  +V
Sbjct: 1   MAGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV 60

Query: 401 LSVD--SYKKIIVSGSADKTVKVW-----------HVESRTCYTLRGHTEWVGTVKLHPK 447
            SV    +  I+ +GS D TV +W            +E+     + GH   +  V     
Sbjct: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120

Query: 448 SFTCFSGSDDTTIRMWDI----RSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDP 503
                + S D ++ +W+         C+ V + H   V+ V+                  
Sbjct: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI------------------ 162

Query: 504 PRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV--RTGKCVRTHFGHVEG 561
                                SLP    L S S D+T+++W+      +C     GH   
Sbjct: 163 ------------------WHQSLPL---LASSSYDDTVRIWKDCDDDWECCAVLNGHEGT 201

Query: 562 IW----DIAADNFRIVSGAHDKTVKVWDLQ 587
           +W    + +  N R+ SG+ D TV++W L+
Sbjct: 202 VWSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231

>Scas_658.1
          Length = 442

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 75/174 (43%), Gaps = 20/174 (11%)

Query: 315 GHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGK-LVRRLTGHRDGVKAIYF--DGQ 368
           GH +G  SL F   +  LL +G  D+ V +WD    + L+R   GH   + ++ F  DG 
Sbjct: 147 GHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGT 206

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI----IVSGSADKTVKVWHV 424
             I+ S D  I++W+   G        H  S  +   ++       + G A+   K++H 
Sbjct: 207 NFISSSFDHTIKIWDTEQGKVKTKL--HFKSTPNDVKFRPFNSSEFIVGFANS--KIYHY 262

Query: 425 ESRT------CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVK 472
           ++R             H   +  +K  P      S S+D T+R+WD + N  +K
Sbjct: 263 DTRISENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIWDNQVNVPIK 316

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 83/192 (43%), Gaps = 32/192 (16%)

Query: 310 IQEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIWDLATGKLVRRL--TGHRDGVKAIYF 365
           ++++KGH   + SL FN       + S+D T+ IWD   GK+  +L      + VK   F
Sbjct: 186 LRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPF 245

Query: 366 DGQKLITGSLDRMIRVWNYVT-----GACVAAYPGHSDSVLSVDSYK--KIIVSGSADKT 418
           +  + I G  +   ++++Y T        V  Y  H  S+L++  +      +S S DKT
Sbjct: 246 NSSEFIVGFANS--KIYHYDTRISENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKT 303

Query: 419 VKVW---------HVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN- 468
           V++W          +   T Y++        ++ +HP      + S D TI  + ++   
Sbjct: 304 VRIWDNQVNVPIKQISDTTQYSMP-------SIDIHPDKKNFCAQSMDNTIYTYSMKPKY 356

Query: 469 --TCVKVFRGHV 478
                K+F+G  
Sbjct: 357 RRNPNKMFKGQT 368

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 7/90 (7%)

Query: 532 LLSCSLDNTIKLWEVRTGK-CVRTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDLQS 588
           LLS   DN +K+W+    +  +R + GH + I   D   D    +S + D T+K+WD + 
Sbjct: 165 LLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQ 224

Query: 589 GKC---IHTFDSHQAPITCVGIGDSEFVSG 615
           GK    +H F S    +       SEF+ G
Sbjct: 225 GKVKTKLH-FKSTPNDVKFRPFNSSEFIVG 253

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 76/187 (40%), Gaps = 28/187 (14%)

Query: 310 IQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGK-LVRRLTGHRDGVKAIYF 365
           I E+ GH +G  SL+F      LL +G  D+ + +WD    + L+R   GH   +K + F
Sbjct: 128 IAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNF 187

Query: 366 --DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWH 423
             +G    + S D+ +++WN   G          D  L  +S    I     DK   V  
Sbjct: 188 TDNGHSFASASFDKWVKIWNTEKGII--------DKRLRFNSVPNCITFHPKDKNQLVVG 239

Query: 424 VESRTC--YTLR------------GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNT 469
           + +     Y LR             H   +  +K  P      S S+D T+R+W+ R N 
Sbjct: 240 LSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWENRINI 299

Query: 470 CVKVFRG 476
            +K   G
Sbjct: 300 PIKQISG 306

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 78/205 (38%), Gaps = 43/205 (20%)

Query: 350 VRRLTGHRDGVKAIYF---DGQKLITGSLDRMIRVWN-YVTGACVAAYPGHSDSV--LSV 403
           +    GH++G  ++ F    G  L++G  D +I++W+ Y     +  Y GHS ++  L+ 
Sbjct: 128 IAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNF 187

Query: 404 DSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFT-CFSGSDDTTIRM 462
                   S S DK VK+W+ E                +  HPK       G  ++ IR 
Sbjct: 188 TDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRH 247

Query: 463 WDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSAL 522
           +D+R          + G+VQK                             D   G + AL
Sbjct: 248 YDLR-------LSENHGEVQKY----------------------------DHHQGSILAL 272

Query: 523 DDSLPYPSHLLSCSLDNTIKLWEVR 547
               P    L+S S D T+++WE R
Sbjct: 273 K-YFPDGKKLISSSEDKTVRIWENR 296

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 46/103 (44%), Gaps = 17/103 (16%)

Query: 526 LPYPSHLL-SCSLDNTIKLWEV-RTGKCVRTHFGHVEGIWDIA-ADN-FRIVSGAHDKTV 581
           +P   HLL S   DN IKLW+     + +RT+ GH   I D+   DN     S + DK V
Sbjct: 144 IPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNFTDNGHSFASASFDKWV 203

Query: 582 KVWDLQSG------------KCIHTFDSHQAPITCVGIGDSEF 612
           K+W+ + G             CI TF         VG+ +SE 
Sbjct: 204 KIWNTEKGIIDKRLRFNSVPNCI-TFHPKDKNQLVVGLSNSEI 245

>Scas_721.7
          Length = 325

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 75/166 (45%), Gaps = 16/166 (9%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYVTG 387
           L + S D T+ I  L  G L  RL GH   V ++ ++  G  L T S+D  I++W+   G
Sbjct: 72  LASASDDFTIEITHLTHGCL-HRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHG 130

Query: 388 ACVAAYPGHSDSVLSV----DSYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEW---- 438
           A +     HS+SV+S+    D    ++ SGS D  ++++   +  C  TL    +W    
Sbjct: 131 AILKTISAHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDD 190

Query: 439 ----VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQ 480
               +  V+  P        S D  +++WD      V+ F+   G+
Sbjct: 191 GVVPISQVRFSPNGKFLLVSSFDGIVKIWDCVRGYVVRTFKPSDGE 236

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 16/129 (12%)

Query: 310 IQEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           +    GH   V+SL +N    LLFT S D ++ IWD   G +++ ++ H + V ++    
Sbjct: 91  LHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICP 150

Query: 366 --DGQKLITGSLDRMIRVWNYVTGACVAAYP-----GHSDSVLSVDSYK-----KIIVSG 413
             D   L +GS D +IR+++  TG C+            D V+ +   +     K ++  
Sbjct: 151 DRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSPNGKFLLVS 210

Query: 414 SADKTVKVW 422
           S D  VK+W
Sbjct: 211 SFDGIVKIW 219

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 79/199 (39%), Gaps = 47/199 (23%)

Query: 407 KKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIR 466
            + + S S D T+++ H+     + L GHT  V ++  +      F+ S D +I++WD  
Sbjct: 69  NQCLASASDDFTIEITHLTHGCLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTF 128

Query: 467 SNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSL 526
               +K    H    + V+ L+I             P R+ +  A               
Sbjct: 129 HGAILKTISAH---SESVVSLSIC------------PDRDSSVLA--------------- 158

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRT-----HFGHVEGIWDIAADNFR-----IVSGA 576
                  S S D  I+L++ RTG C++T      +   +G+  I+   F      ++  +
Sbjct: 159 -------SGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSPNGKFLLVSS 211

Query: 577 HDKTVKVWDLQSGKCIHTF 595
            D  VK+WD   G  + TF
Sbjct: 212 FDGIVKIWDCVRGYVVRTF 230

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 3/78 (3%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF--RIVSGAHDKTVKVWDLQSG 589
           L S S D TI++  +  G C+    GH   +  +  ++    + + + D+++K+WD   G
Sbjct: 72  LASASDDFTIEITHLTHG-CLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHG 130

Query: 590 KCIHTFDSHQAPITCVGI 607
             + T  +H   +  + I
Sbjct: 131 AILKTISAHSESVVSLSI 148

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 72/162 (44%), Gaps = 30/162 (18%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
           I  F+ H   +  L  + R L +GS D  + I+DL   K +  L  H+  + A+ F    
Sbjct: 99  IFHFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQF---- 154

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHS--DSVLSVDSYK-KIIVSGSADKTVKVWHVES 426
                                 ++P  S  D+ +S  S   K ++S S D  + VW V+ 
Sbjct: 155 ----------------------SHPASSSEDAAVSKGSKNSKWLLSASEDHKIMVWRVKD 192

Query: 427 -RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
             T  TL+GHT  V  V +HP +    S SDD +IR+W++ +
Sbjct: 193 WETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMT 234

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 61/138 (44%), Gaps = 26/138 (18%)

Query: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512
           SGS+D  IR++D++    +     H G +  +              + S P    A++++
Sbjct: 121 SGSNDEHIRIYDLQKRKELGTLLSHQGSITAL--------------QFSHP----ASSSE 162

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNF 570
           D      +A+         LLS S D+ I +W V+  + V T  GH   +   DI   N 
Sbjct: 163 D------AAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNR 216

Query: 571 RIVSGAHDKTVKVWDLQS 588
             +S + D ++++W+L +
Sbjct: 217 IAISVSDDHSIRLWNLMT 234

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 555 HF-GHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
           HF  H   I  +A     +VSG++D+ ++++DLQ  K + T  SHQ  IT +
Sbjct: 101 HFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL 152

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 48/108 (44%), Gaps = 16/108 (14%)

Query: 393 YPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKL-HPKSFT 450
           +  HS S+  +   ++ +VSGS D+ ++++ ++ R    TL  H   +  ++  HP S +
Sbjct: 102 FQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPASSS 161

Query: 451 --------------CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
                           S S+D  I +W ++    V   +GH  +V  V
Sbjct: 162 EDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDV 209

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 83/176 (47%), Gaps = 19/176 (10%)

Query: 313 FKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV-KAIYFDGQKLI 371
             GH   V +L+     L + S+D T  +W   T +  R L+GH   V  A+     + +
Sbjct: 104 LAGHSGNVCALEARDGQLVSSSWDQTARVWREGTEE--RALSGHNATVWHALALGYDRFL 161

Query: 372 TGSLDRMIRVWNYVTGA-CVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRT 428
           T S D+ I++W+   GA  +A Y  H+D V  L++        S S D +VKV  ++ +T
Sbjct: 162 TASADKTIKLWD---GARDLATYNVHTDVVRHLALAPDGHHFASCSNDGSVKVHTLDGKT 218

Query: 429 CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
             T  GH  +V  VK  P       G +D T+R+WD+          GHV QV ++
Sbjct: 219 VRTFDGHESFVYCVKYLPDGGLVSCG-EDKTVRVWDM---------SGHVRQVIRL 264

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 113/273 (41%), Gaps = 70/273 (25%)

Query: 332 TGSYDSTVAIWD-------LATGKLVRRLTGHRDGV------KAIYFDGQKLITGSLDRM 378
           +GS D TV +W        L +G ++     + + V      + ++F GQ+ + G++  +
Sbjct: 34  SGSRDGTVRVWTRDTSDSRLWSGAILHSTERYVNAVCYEENEQLVFFGGQEAVIGAVSPL 93

Query: 379 IRVWNYVTGACVAAY--PGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGH- 435
                 V     A+Y   GHS +V ++++    +VS S D+T +VW  E      L GH 
Sbjct: 94  ------VLEVQDASYLLAGHSGNVCALEARDGQLVSSSWDQTARVWR-EGTEERALSGHN 146

Query: 436 -TEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTEN 494
            T W      + +  T    S D TI++WD   +                     L T N
Sbjct: 147 ATVWHALALGYDRFLTA---SADKTIKLWDGARD---------------------LATYN 182

Query: 495 LVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT 554
           + TD      R+ A      PDG             H  SCS D ++K+     GK VRT
Sbjct: 183 VHTDVV----RHLALA----PDGH------------HFASCSNDGSVKV-HTLDGKTVRT 221

Query: 555 HFGHVEGIWDIA-ADNFRIVSGAHDKTVKVWDL 586
             GH   ++ +    +  +VS   DKTV+VWD+
Sbjct: 222 FDGHESFVYCVKYLPDGGLVSCGEDKTVRVWDM 254

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 107/274 (39%), Gaps = 66/274 (24%)

Query: 348 KLVRRLTGHRDGVKAIY-FDGQKLITGSLDRMIRVWNYVT-------GACVAAYPGHSDS 399
           +L   L GH   VK++      ++ +GS D  +RVW   T       GA + +   + ++
Sbjct: 9   ELSSSLLGHSMDVKSVVAISDTQIASGSRDGTVRVWTRDTSDSRLWSGAILHSTERYVNA 68

Query: 400 VLSVDSYKKIIVSGSADKTVK-----VWHVESRTCYTLRGHTEWVGTV-KLHPKSFTCFS 453
           V   +  ++++  G  +  +      V  V+  + Y L GH+   G V  L  +     S
Sbjct: 69  V-CYEENEQLVFFGGQEAVIGAVSPLVLEVQDAS-YLLAGHS---GNVCALEARDGQLVS 123

Query: 454 GSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQD 513
            S D T R+W  R  T  +   GH   V   L L          DR              
Sbjct: 124 SSWDQTARVW--REGTEERALSGHNATVWHALALGY--------DR-------------- 159

Query: 514 PPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFR 571
                              L+ S D TIKLW+    + + T+  H + +    +A D   
Sbjct: 160 ------------------FLTASADKTIKLWD--GARDLATYNVHTDVVRHLALAPDGHH 199

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
             S ++D +VKV  L  GK + TFD H++ + CV
Sbjct: 200 FASCSNDGSVKVHTLD-GKTVRTFDGHESFVYCV 232

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 67/158 (42%), Gaps = 8/158 (5%)

Query: 303 WRKGTAHIQEFKGHMDGVL-SLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK 361
           WR+GT   +   GH   V  +L   Y    T S D T+ +WD A  + +     H D V+
Sbjct: 133 WREGTEE-RALSGHNATVWHALALGYDRFLTASADKTIKLWDGA--RDLATYNVHTDVVR 189

Query: 362 --AIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI-IVSGSADKT 418
             A+  DG    + S D  ++V + + G  V  + GH   V  V       +VS   DKT
Sbjct: 190 HLALAPDGHHFASCSNDGSVKV-HTLDGKTVRTFDGHESFVYCVKYLPDGGLVSCGEDKT 248

Query: 419 VKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSD 456
           V+VW +       +R     + ++ + P       GSD
Sbjct: 249 VRVWDMSGHVRQVIRLCATSLWSLDVLPNGDIVVGGSD 286

>Scas_720.83d
          Length = 915

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 75/160 (46%), Gaps = 7/160 (4%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVT 386
           L F  S    + +++  +   + +  GH D   ++ +  DG +++T + D  I+VW+ V+
Sbjct: 315 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVS 374

Query: 387 GACVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVWHVESRTCYTLRGHTEWV--GTV 442
           G C+A +  H+ SV  V   K+  ++ S S D TV+ W +     +      E +    +
Sbjct: 375 GFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCL 434

Query: 443 KLHPKSFTCFSGS-DDTTIRMWDIRSNTCVKVFRGHVGQV 481
            + P      +GS D+  I +W +++   +    GH G V
Sbjct: 435 AVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPV 474

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 59/127 (46%), Gaps = 8/127 (6%)

Query: 310 IQEFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTG-HRDGVKAIYFD 366
           +  F+ H   V  +QF  R  +LF+ S D TV  WDL   +  R  T   R     +  D
Sbjct: 378 LATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVD 437

Query: 367 --GQKLITGSLDRM-IRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKV 421
             G+ +  GSLD   I VW+  TG  +    GH   V  L+      ++ S S DKTV+V
Sbjct: 438 PSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRV 497

Query: 422 WHVESRT 428
           W +  R+
Sbjct: 498 WSIFGRS 504

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 76/196 (38%), Gaps = 50/196 (25%)

Query: 419 VKVWHVESRTCYTLR--GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRG 476
           V  W  ES   Y L+  GH +   ++   P      + ++D  I++WD+ S  C+  F+ 
Sbjct: 327 VYEWQSES---YILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQE 383

Query: 477 HVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCS 536
           H   V +V                           Q    GQ+            L S S
Sbjct: 384 HTSSVTQV---------------------------QFAKRGQV------------LFSSS 404

Query: 537 LDNTIKLWEVRTGKCVRTHFGHVEGI----WDIAADNFRIVSGAHDK-TVKVWDLQSGKC 591
           LD T++ W++   +  RT F   E I      +      + +G+ D   + VW +Q+G+ 
Sbjct: 405 LDGTVRAWDLIRYRNFRT-FTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQL 463

Query: 592 IHTFDSHQAPITCVGI 607
           + T   H+ P++C+  
Sbjct: 464 LDTLSGHEGPVSCLAF 479

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 12/81 (14%)

Query: 333 GSYDS-TVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVTGAC 389
           GS D+  + +W + TG+L+  L+GH   V  + F  +   L + S D+ +RVW+      
Sbjct: 446 GSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSIF---- 501

Query: 390 VAAYPGHSDSVLSVDSYKKII 410
                G S  V   D Y  ++
Sbjct: 502 -----GRSQQVEPFDVYSDVL 517

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/114 (21%), Positives = 45/114 (39%), Gaps = 19/114 (16%)

Query: 369 KLITGSLDRMIRVW---------NYVTGACVAAYPGHSDSVLSV----DSYKKIIVSGSA 415
           KL   +  R +++W          +        + GH   +LS+    DS  + I+S S 
Sbjct: 109 KLFALATGRFLQIWKTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDS--RFIISTSK 166

Query: 416 DKTVKVWHVESR----TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           D T ++W ++S        T  GH ++V            ++ S D  + +W+ 
Sbjct: 167 DLTARIWSIDSEEKDLASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFVWEF 220

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 116/274 (42%), Gaps = 17/274 (6%)

Query: 326 NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWN 383
           N   + +GS++  V+I D  T ++ + L  H   V  I +      LITG  D +I V N
Sbjct: 223 NGNYVASGSWNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHLITVSN 282

Query: 384 YVTGACVAAYP--GHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR-GHTEW 438
              G  + +    GH   +  L V    K I + S D T ++W +E +    L+ GH++ 
Sbjct: 283 RSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKE 342

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTD 498
           +  +          +   D T  +WD+RS   V   +GH   +   +  +I D   L T 
Sbjct: 343 LYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIY-CMDWSI-DGHTLATG 400

Query: 499 RTS------DPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCV 552
                    D  +++  T        +++L        +L+S   D +I ++       V
Sbjct: 401 GGDGVITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSKDNYLKV 460

Query: 553 RTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVW 584
            +  GH + +  +DI  +N  ++SG  D++VK W
Sbjct: 461 SSLIGHADKVLTFDIDKNNKNLISGGWDRSVKHW 494

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 68/152 (44%), Gaps = 12/152 (7%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIY-----FDGQKLITGSL 375
           L+ Q +  L+ T   D T  IWDL +GK V +L GH    K IY      DG  L TG  
Sbjct: 346 LAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGH---AKTIYCMDWSIDGHTLATGGG 402

Query: 376 DRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHVESR-TCYT 431
           D +I +W+      +     H   V S+   K     ++S   D+++ V+  ++     +
Sbjct: 403 DGVITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSKDNYLKVSS 462

Query: 432 LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
           L GH + V T  +   +    SG  D +++ W
Sbjct: 463 LIGHADKVLTFDIDKNNKNLISGGWDRSVKHW 494

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVW 584
           P    + + S D+T +LW++   K +    GH + ++ +A  AD   + +   DKT  +W
Sbjct: 308 PSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIW 367

Query: 585 DLQSGKCIHTFDSHQAPITCV 605
           DL+SGK +     H   I C+
Sbjct: 368 DLRSGKAVSQLQGHAKTIYCM 388

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 316 HMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKL 370
           H   V SL+F   N   L +  YD ++ ++       V  L GH D V     D   + L
Sbjct: 423 HKSIVTSLKFDKANDHNLISSGYDRSIFVYSKDNYLKVSSLIGHADKVLTFDIDKNNKNL 482

Query: 371 ITGSLDRMIRVWNYVT 386
           I+G  DR ++ W+ V+
Sbjct: 483 ISGGWDRSVKHWSTVS 498

>Scas_692.25
          Length = 488

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 83/197 (42%), Gaps = 50/197 (25%)

Query: 324 QFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWN 383
           + N   L + S D+++ IW    G ++     H + V+ +   G  +++GS D  +R+ +
Sbjct: 246 KLNNIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLDVSGDFVLSGSQDASLRLTH 305

Query: 384 YVTGACVAAYPGHSDSV-------------------------LSVDS-YKKI----IVSG 413
           + +G  ++   GH   +                         L +DS Y+K+      S 
Sbjct: 306 WPSGNGLSIGIGHEFPIESVKFILPLSTNEKASPTINYLRKPLEIDSDYEKMSFKYCASA 365

Query: 414 SADKTVKVWHVES------------------RTCYTLRGHTEWVGTVKLHPKSFTCFSGS 455
           S D+ +K+W + +                  +   TL+GH  WV  +++  +    FS S
Sbjct: 366 SRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRI--RGNYLFSCS 423

Query: 456 DDTTIRMWDIRSNTCVK 472
           DD TIR W++ +  CVK
Sbjct: 424 DDKTIRCWNLENGECVK 440

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 100/239 (41%), Gaps = 42/239 (17%)

Query: 395 GHSDSVLSVDSYKKI----IVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSF 449
            H   V  V  ++K+    + S S D ++++W  E      +   H EWV  + +     
Sbjct: 233 NHEHIVSEVKLFRKLNNIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLDVSGD-- 290

Query: 450 TCFSGSDDTTIRMWDIRSNTCVKVFRGH---VGQVQKVLPLTILDTENLVTDRTSDPPRN 506
              SGS D ++R+    S   + +  GH   +  V+ +LPL+        T+  + P  N
Sbjct: 291 FVLSGSQDASLRLTHWPSGNGLSIGIGHEFPIESVKFILPLS--------TNEKASPTIN 342

Query: 507 EATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTG----------------- 549
                + P +        S  Y +   S S D  IK+WE+ T                  
Sbjct: 343 ---YLRKPLEIDSDYEKMSFKYCA---SASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNF 396

Query: 550 KCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTF-DSHQAPITCVGI 607
           KC+ T  GH   + D+      + S + DKT++ W+L++G+C+  + D H   +TC+ +
Sbjct: 397 KCIMTLKGHASWVKDLRIRGNYLFSCSDDKTIRCWNLENGECVKQWTDLHSGFVTCLDM 455

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 34/188 (18%), Positives = 79/188 (42%), Gaps = 38/188 (20%)

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC-VKVFRGHVGQVQKVLPLTILDTENLVT 497
           +  +KLHP+    F G+D+  +  +DI + +  +   + H+  +  +    I++ +N   
Sbjct: 139 ISAIKLHPQLPIIFIGTDNGKLYAYDIFNYSLPLDSTQAHIKGITSID--AIMEFKN--N 194

Query: 498 DRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKL--WEVRTGKCV--R 553
           ++T +P    AT+++D                          +IKL  W  +  K +  R
Sbjct: 195 NKTEEPSAIIATSSKDL-------------------------SIKLFRWSAKENKFLLFR 229

Query: 554 THFGHVEGIWDIAA----DNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGD 609
               H   + ++      +N  + S + D ++++W  + G  +++F  H   + C+ +  
Sbjct: 230 VLMNHEHIVSEVKLFRKLNNIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLDVSG 289

Query: 610 SEFVSGDE 617
              +SG +
Sbjct: 290 DFVLSGSQ 297

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 47/120 (39%), Gaps = 8/120 (6%)

Query: 248 LPLLHMKRA----RFIEPPAESKPGQKGAGNPPVASETTTRKTRPWKV----IYRERFKV 299
           LPL   ++A     ++  P E     +       AS +  R  + W++        R  V
Sbjct: 329 LPLSTNEKASPTINYLRKPLEIDSDYEKMSFKYCASASRDRLIKIWEIPTPRFVMHRPPV 388

Query: 300 ESNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDG 359
            ++       I   KGH   V  L+     LF+ S D T+  W+L  G+ V++ T    G
Sbjct: 389 PNSSNSNFKCIMTLKGHASWVKDLRIRGNYLFSCSDDKTIRCWNLENGECVKQWTDLHSG 448

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 89/162 (54%), Gaps = 11/162 (6%)

Query: 314 KGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK-- 369
           + HM+ V  + F+   +   + S D+ + IW+ + G+  R L+GH   VK+  +  +   
Sbjct: 162 QAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGL 221

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHV-- 424
           +++GS D +I+ W+  +G+CV+   G   +++S     K   ++   S DKT KV+ +  
Sbjct: 222 IVSGSKDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQ 281

Query: 425 ESRTCYTLRGHTEWVGTVKLHPKSFTCFS-GSDDTTIRMWDI 465
           +++  +++R   +++ T++ HP   T F+ G  D +I+ +D+
Sbjct: 282 QAKELFSVRDDVDYM-TLQWHPIDETVFTVGCYDGSIKHFDL 322

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 65/154 (42%), Gaps = 5/154 (3%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYV 385
           R L   +Y+   ++W  ++      +  H   V  + +   G  +++GS D  +++W   
Sbjct: 94  RRLVVATYNGEFSLWSGSSFNFESIMQAHDSAVTVMTYSHTGDWMVSGSADGELKIWQPN 153

Query: 386 TGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTV 442
                     H + V  +S     +  VS S D  +K+W+  + +    L GH   V + 
Sbjct: 154 FNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSC 213

Query: 443 KLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRG 476
             HPK     SGS D  I+ WD RS +CV    G
Sbjct: 214 DWHPKMGLIVSGSKDNLIKFWDPRSGSCVSTMLG 247

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 89/232 (38%), Gaps = 53/232 (22%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI---IVSGSADKTVKVW 422
           +G++L+  + +    +W+  +    +    H DS ++V +Y      +VSGSAD  +K+W
Sbjct: 92  EGRRLVVATYNGEFSLWSGSSFNFESIMQAH-DSAVTVMTYSHTGDWMVSGSADGELKIW 150

Query: 423 HVESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
                    + + H E V  +   P      S SDD  +++W+  +    +V  GH   V
Sbjct: 151 QPNFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDV 210

Query: 482 QKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTI 541
           +                                         D  P    ++S S DN I
Sbjct: 211 KSC---------------------------------------DWHPKMGLIVSGSKDNLI 231

Query: 542 KLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSG------AHDKTVKVWDLQ 587
           K W+ R+G CV T  G       I +  F+   G      + DKT KV+D++
Sbjct: 232 KFWDPRSGSCVSTMLGFKH---TIISTKFQPKQGNLLSVISKDKTCKVYDIR 280

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 8/74 (10%)

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-----IVSGAHDKTV 581
           P     +SCS DN +K+W    G+  R   GH    WD+ + ++      IVSG+ D  +
Sbjct: 175 PTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLI 231

Query: 582 KVWDLQSGKCIHTF 595
           K WD +SG C+ T 
Sbjct: 232 KFWDPRSGSCVSTM 245

>Scas_717.68
          Length = 908

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 91/225 (40%), Gaps = 39/225 (17%)

Query: 388 ACVAAYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHP 446
           +C   +  H+  VL +D S    +++ S D+TVK+WH+E +T      H ++V  V+ HP
Sbjct: 319 SCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378

Query: 447 KSFTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPR 505
                F SG  D  +R+W I  N     F                D ++L+T  T     
Sbjct: 379 TDDRFFISGCLDHKVRLWSILENEITFEF----------------DCQDLITSLT----- 417

Query: 506 NEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV------RTGKCVRTHFG-H 558
                   P DG+ + +     Y   LL+  L+       V      R     + H G  
Sbjct: 418 ------LSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPR 471

Query: 559 VEGI--WDIAADN-FRIVSGAHDKTVKVWDLQSGKCIHTFDSHQA 600
           V G+  +    DN  RIV  + D  ++++DL+  K +      Q+
Sbjct: 472 VTGLECFKYEPDNSLRIVVTSSDSRIRIFDLEKKKLLEYLKGFQS 516

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 77/184 (41%), Gaps = 29/184 (15%)

Query: 313 FKGHMDGVLSLQFN-YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF---DGQ 368
           FK H   VL L ++    L T S D TV +W L     ++    H+D V  + F   D +
Sbjct: 324 FKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDR 382

Query: 369 KLITGSLDRMIRVW--------------NYVTGACVAAYPGHSDSVLSVDSYKKIIVSGS 414
             I+G LD  +R+W              + +T   ++   G    V + + Y  ++++  
Sbjct: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKG 442

Query: 415 ADKTVKVWHVESRTCYTLRGHTEWVGTVKLH--PK--SFTCFSGSDDTTIRMWDIRSNTC 470
            ++ V  +HV  +             + K+H  P+     CF    D ++R+    S++ 
Sbjct: 443 LEQ-VSSFHVVDKNT-----QERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSR 496

Query: 471 VKVF 474
           +++F
Sbjct: 497 IRIF 500

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 78/164 (47%), Gaps = 12/164 (7%)

Query: 313 FKGHMDGVLSLQFNYR--LLFTGSYDSTVAIW--DLATGKLVRRLTGHRDGVKAIYFD-- 366
            + H   V  +Q+++    L +G  D T+ IW  +    K++ R   H + ++ I F   
Sbjct: 117 MQAHDSAVTVMQYSHAGDWLISGDADGTIKIWQPNFNMVKVLDR--AHTECMRDISFSYS 174

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVWHV 424
            QK +T S D ++++WN+  G       GH   V S D + K  +IVSGS D  +K+W  
Sbjct: 175 DQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDP 234

Query: 425 ES-RTCYTLRGHTEWVGTVKLHPKSFTCFS-GSDDTTIRMWDIR 466
            + R   T+ G    V   K  P      +  S D +I+++D+R
Sbjct: 235 RTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMR 278

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 88/232 (37%), Gaps = 53/232 (22%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI---IVSGSADKTVKVW 422
           +G++L+  +      +WN  +    +    H DS ++V  Y      ++SG AD T+K+W
Sbjct: 90  EGRRLVVATYSGEFSLWNGSSFNFESIMQAH-DSAVTVMQYSHAGDWLISGDADGTIKIW 148

Query: 423 HVESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
                    L R HTE +  +          + SDD  +++W+  +    +V  GH   V
Sbjct: 149 QPNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDV 208

Query: 482 QKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTI 541
           +                                         D  P    ++S S DN I
Sbjct: 209 KSC---------------------------------------DWHPKMGLIVSGSKDNLI 229

Query: 542 KLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSG------AHDKTVKVWDLQ 587
           KLW+ RTG+ V T  G       +    F+   G      + DK++K++D++
Sbjct: 230 KLWDPRTGRNVSTILGLKH---TVIKTKFQPTQGNLLAVVSKDKSIKIYDMR 278

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 64/154 (41%), Gaps = 5/154 (3%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYV 385
           R L   +Y    ++W+ ++      +  H   V  + +   G  LI+G  D  I++W   
Sbjct: 92  RRLVVATYSGEFSLWNGSSFNFESIMQAHDSAVTVMQYSHAGDWLISGDADGTIKIWQPN 151

Query: 386 TGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTV 442
                     H++ +  +S     +  V+ S D  +K+W+  + +    L GH   V + 
Sbjct: 152 FNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSC 211

Query: 443 KLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRG 476
             HPK     SGS D  I++WD R+   V    G
Sbjct: 212 DWHPKMGLIVSGSKDNLIKLWDPRTGRNVSTILG 245

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 8/69 (11%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-----IVSGAHDKTVKVWDL 586
            ++CS DN +K+W    G+  R   GH    WD+ + ++      IVSG+ D  +K+WD 
Sbjct: 178 FVTCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLIKLWDP 234

Query: 587 QSGKCIHTF 595
           ++G+ + T 
Sbjct: 235 RTGRNVSTI 243

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 2/70 (2%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDLQSG 589
           L+S   D TIK+W+            H E + DI  +  + + V+ + D  +K+W+  +G
Sbjct: 136 LISGDADGTIKIWQPNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNG 195

Query: 590 KCIHTFDSHQ 599
           +       H 
Sbjct: 196 QQERVLSGHH 205

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 44/207 (21%)

Query: 308 AHIQEFKGHMDGVLSLQFNYR----LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI 363
           +HI+   GH   V   QF  R    LL T S D  + IWD++ G  ++    H   ++++
Sbjct: 192 SHIKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSL 251

Query: 364 YFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV-----------DSYKKI--- 409
           +  G+ ++TGS D  IR+ ++ +G  ++   GH   V  V             Y+ +   
Sbjct: 252 HVHGEFVLTGSNDSAIRLTHWPSGNGLSMGIGHDFPVEKVLILIPDPQHLQPQYQPLGFQ 311

Query: 410 -IVSGSADKTVKVWHVE------------------SRTCYTLRGHTEWVGTVKLHPKSFT 450
            + S S D T+++W V                    +    L  H  WV  ++       
Sbjct: 312 HVASASRDGTIRLWKVSLPKFIPHRPPRPNPLDTTFKVIAVLTDHNSWVRDLRQFNDML- 370

Query: 451 CFSGSDDTTIRMW-----DIRSNTCVK 472
            FS SDD +++ W     ++ + TC K
Sbjct: 371 -FSCSDDGSVKCWSLDWTNLSTTTCKK 396

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 78/214 (36%), Gaps = 37/214 (17%)

Query: 410 IVSGSADKTVKVWHVESRTCY----TLRGHTEWVGTVKLHPKS--FTCFSGSDDTTIRMW 463
           + + S D   K+W +E  +      TL GH   V   +   +       + S D  +++W
Sbjct: 171 LATTSKDLNTKIWELELDSTLSHIKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIW 230

Query: 464 DIRSNTCVKVFRGHVGQVQK--VLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSA 521
           DI +  C+K F+ H   ++   V    +L   N    R +  P     +     D  +  
Sbjct: 231 DISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSNDSAIRLTHWPSGNGLSMGIGHDFPVEK 290

Query: 522 LDDSLPYPSHL------------LSCSLDNTIKLWEVR-----------------TGKCV 552
           +   +P P HL             S S D TI+LW+V                  T K +
Sbjct: 291 VLILIPDPQHLQPQYQPLGFQHVASASRDGTIRLWKVSLPKFIPHRPPRPNPLDTTFKVI 350

Query: 553 RTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDL 586
                H   + D+   N  + S + D +VK W L
Sbjct: 351 AVLTDHNSWVRDLRQFNDMLFSCSDDGSVKCWSL 384

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKC 591
           L +CS D  +K+W++  G C+++   H + I  +      +++G++D  +++    SG  
Sbjct: 218 LATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSNDSAIRLTHWPSGNG 277

Query: 592 IHTFDSHQAPITCVGI 607
           +     H  P+  V I
Sbjct: 278 LSMGIGHDFPVEKVLI 293

>Kwal_33.15591
          Length = 714

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 75/158 (47%), Gaps = 18/158 (11%)

Query: 315 GHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKL---- 370
           GH + V  L  +   + +GS+D+T  +W    G L   L GH   V    +D + L    
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASV----WDVKMLPEVG 156

Query: 371 --ITGSLDRMIRVWNYVTGACVAAYPG-HSDSV--LSVDSYKKIIVSGSADKTVKVWHVE 425
             +T S D  I++W       +  + G H+D +  + +D+  +   S S D TVK+  +E
Sbjct: 157 FYMTASADGTIKLWE--GEKVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDME 214

Query: 426 SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
            +T  TL GH  +V +VK  P      S  +D T+R+W
Sbjct: 215 GKTLKTLVGHESFVYSVKFAPNG-DVISCGEDRTVRIW 251

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 81/191 (42%), Gaps = 43/191 (22%)

Query: 395 GHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSG 454
           GH ++V  ++S +  ++SGS D T KVW  +    + L+GHT  V  VK+ P+     + 
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVWF-QGALKHELKGHTASVWDVKMLPEVGFYMTA 161

Query: 455 SDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDP 514
           S D TI++W+       KV +   G    V+    +D                       
Sbjct: 162 SADGTIKLWEGE-----KVLKTFTGLHTDVIRHIDIDASG-------------------- 196

Query: 515 PDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA-ADNFRIV 573
                              SCS D T+K+ ++  GK ++T  GH   ++ +  A N  ++
Sbjct: 197 ---------------EKFASCSNDGTVKINDME-GKTLKTLVGHESFVYSVKFAPNGDVI 240

Query: 574 SGAHDKTVKVW 584
           S   D+TV++W
Sbjct: 241 SCGEDRTVRIW 251

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 81/188 (43%), Gaps = 8/188 (4%)

Query: 353 LTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI--I 410
           L GH + V  +      +++GS D   +VW    GA      GH+ SV  V    ++   
Sbjct: 101 LIGHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASVWDVKMLPEVGFY 158

Query: 411 VSGSADKTVKVWHVESRTCYTLRG-HTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNT 469
           ++ SAD T+K+W  E +   T  G HT+ +  + +        S S+D T+++ D+   T
Sbjct: 159 MTASADGTIKLWEGE-KVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDMEGKT 217

Query: 470 CVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALD-DSLPY 528
            +K   GH   V  V      D  +   DRT    + + T  Q      +S  D D LP 
Sbjct: 218 -LKTLVGHESFVYSVKFAPNGDVISCGEDRTVRIWKADGTVKQVIRVPAVSTWDLDILPN 276

Query: 529 PSHLLSCS 536
              L+ CS
Sbjct: 277 GDILIGCS 284

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 526 LPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFG-HVEGI--WDIAADNFRIVSGAHDKTVK 582
           LP     ++ S D TIKLWE    K ++T  G H + I   DI A   +  S ++D TVK
Sbjct: 152 LPEVGFYMTASADGTIKLWEGE--KVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVK 209

Query: 583 VWDLQSGKCIHTFDSHQAPITCV 605
           + D++ GK + T   H++ +  V
Sbjct: 210 INDME-GKTLKTLVGHESFVYSV 231

>Kwal_26.8628
          Length = 422

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 105/256 (41%), Gaps = 23/256 (8%)

Query: 348 KLVRRLTGHRDGVKAI-YFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--- 403
           ++V    GH   V  + +F+   +IT S D    +W+      +A +  H   VL++   
Sbjct: 166 QIVSMFKGHTCYVSQVEFFENNSIITASGDMTCALWDIPKAKRIAEFSDHLGDVLALALP 225

Query: 404 ----DSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEW-VGTVKLHPKSFTCFSGSDDT 458
                +   I  SG +D  V +W   +R        +E  + T+K     +   +G+DD 
Sbjct: 226 PPHAQTSSPIFASGGSDGYVYIWDTRARAAAQSFFVSESDISTLKFFNNGYAIVTGADDG 285

Query: 459 TIRMWDIRSNTCVKVFR-GHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDG 517
             RM+D+RS+  V  +      Q Q   P  + ++  L  D T   P N + T +     
Sbjct: 286 VARMFDMRSDCAVASYSLSQNLQQQANSPTRLYNSSPLEYDVT---PSNASLT-KTSRSA 341

Query: 518 QLSALDD----SLPYPSH---LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI--AAD 568
             + LD+    SL +      + +C  D    +W+    + V    GH   I  +  + D
Sbjct: 342 NSTYLDNQGIVSLDFSGSGRLMHACYTDYGCVIWDTLRAEIVGKLEGHSSRISGVKTSPD 401

Query: 569 NFRIVSGAHDKTVKVW 584
              + +G+ D T+K+W
Sbjct: 402 GMAVCTGSWDATLKLW 417

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 319 GVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGS 374
           G++SL F+   RL+     D    IWD    ++V +L GH   +  +    DG  + TGS
Sbjct: 350 GIVSLDFSGSGRLMHACYTDYGCVIWDTLRAEIVGKLEGHSSRISGVKTSPDGMAVCTGS 409

Query: 375 LDRMIRVW--NYV 385
            D  +++W  NY+
Sbjct: 410 WDATLKLWSPNYM 422

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 65/149 (43%), Gaps = 5/149 (3%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYV 385
           R L   +Y    ++W+ ++      +  H   V  + +  D   +I+G  D MI++W   
Sbjct: 106 RRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPN 165

Query: 386 TGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTV 442
                     H++S+  ++  S     V+ S D  +K+W+  + +    L GH   V + 
Sbjct: 166 FSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSC 225

Query: 443 KLHPKSFTCFSGSDDTTIRMWDIRSNTCV 471
             HP+     S S D  +++WD RS  C+
Sbjct: 226 DWHPEMGLIASASKDNLVKLWDPRSGNCI 254

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 71/189 (37%), Gaps = 48/189 (25%)

Query: 410 IVSGSADKTVKVWHVESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN 468
           +V  +      +W+  S T  TL + H   V T+K    S    SG  D  I++W    +
Sbjct: 108 LVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFS 167

Query: 469 TCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPY 528
              ++   H   +                       R+ A ++ D               
Sbjct: 168 MVKEIDAAHTESI-----------------------RDMAFSSND--------------- 189

Query: 529 PSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-----IVSGAHDKTVKV 583
            S  ++CS DN +K+W    GK  R   GH    WD+ + ++      I S + D  VK+
Sbjct: 190 -SKFVTCSDDNILKIWNFSNGKQERVLSGHH---WDVKSCDWHPEMGLIASASKDNLVKL 245

Query: 584 WDLQSGKCI 592
           WD +SG CI
Sbjct: 246 WDPRSGNCI 254

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 89/177 (50%), Gaps = 12/177 (6%)

Query: 303 WRKGTAHIQEF-KGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDG 359
           W+   + ++E    H + +  + F  N     T S D+ + IW+ + GK  R L+GH   
Sbjct: 162 WQPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWD 221

Query: 360 VKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV---DSYKKIIVSGS 414
           VK+  +  +   + + S D ++++W+  +G C+++      +VL      +   ++++ S
Sbjct: 222 VKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAIS 281

Query: 415 ADKTVKVWHV--ESRTCYTLRGHTEWVGTVKLHPKSFTCFS-GSDDTTIRMWDIRSN 468
            DK+ +V+ +    +    +R  T+++ T++ HP + + F+    D +++ +D+  N
Sbjct: 282 KDKSCRVFDIRYSMKELMCVRDETDYM-TLEWHPINESMFTLACYDGSLKHFDLLQN 337

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/234 (19%), Positives = 83/234 (35%), Gaps = 57/234 (24%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK---KIIVSGSADKTVKVW 422
           +G++L+  +      +WN  +         H DS ++   Y      ++SG AD  +K+W
Sbjct: 104 EGRRLVVATYSGEFSLWNASSFTFETLMQAH-DSAVTTMKYSHDSDWMISGDADGMIKIW 162

Query: 423 HVESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
                    +   HTE +  +          + SDD  +++W+  +    +V  GH   V
Sbjct: 163 QPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDV 222

Query: 482 QKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTI 541
           +                                         D  P    + S S DN +
Sbjct: 223 KSC---------------------------------------DWHPEMGLIASASKDNLV 243

Query: 542 KLWEVRTGKCVRT--HFGHVEGIWDIAADNFRIVSG------AHDKTVKVWDLQ 587
           KLW+ R+G C+ +   F H      +    F+   G      + DK+ +V+D++
Sbjct: 244 KLWDPRSGNCISSILKFKHT-----VLKTRFQPTKGNLLMAISKDKSCRVFDIR 292

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 2/70 (2%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSG 589
           ++S   D  IK+W+            H E I D+A  +++ + V+ + D  +K+W+  +G
Sbjct: 150 MISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNG 209

Query: 590 KCIHTFDSHQ 599
           K       H 
Sbjct: 210 KQERVLSGHH 219

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 74/158 (46%), Gaps = 15/158 (9%)

Query: 332 TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGAC 389
           T S D T+ I  +  G+L  RL GH   V ++ +   G  L + S+D  I++W+ +TG  
Sbjct: 73  TASDDFTIEINHITYGRL-HRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTL 131

Query: 390 VAAYPGHSDSVLSVD---SYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLH 445
           +     HS+ V+S+D       I+ SGS D  ++++   +  C  TL    +W     + 
Sbjct: 132 LKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVV 191

Query: 446 PKSFTCFS--------GSDDTTIRMWDIRSNTCVKVFR 475
           P S   FS         S D  +++WD    + V+ F+
Sbjct: 192 PISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTFK 229

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 89/221 (40%), Gaps = 53/221 (23%)

Query: 397 SDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSD 456
           SD   S DS  + I + S D T+++ H+     + L GHT  V ++    K     S S 
Sbjct: 60  SDICWSPDS--QCIATASDDFTIEINHITYGRLHRLVGHTAPVLSLVYTSKGNLLCSASM 117

Query: 457 DTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPD 516
           D +I++WD+ + T +K    H                       S+P             
Sbjct: 118 DESIKIWDVLTGTLLKTISAH-----------------------SEP------------- 141

Query: 517 GQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT-----HFGHVEGIWDIAADNFR 571
             + ++D  +  PS L S S D  I++++  TG C++T      +    G+  I+   F 
Sbjct: 142 --VVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPISQVKFS 199

Query: 572 I-----VSGAHDKTVKVWDLQSGKCIHTF---DSHQAPITC 604
           +     +  + D  +K+WD   G  + TF   DS +   +C
Sbjct: 200 VNGKYLLVKSLDGVLKIWDFIRGSVVRTFKICDSTKLKYSC 240

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 51/97 (52%), Gaps = 13/97 (13%)

Query: 310 IQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRD-----GVK 361
           ++    H + V+S+     +  +L +GSYD  + I+D  TG  ++ LT  +D     GV 
Sbjct: 132 LKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVV 191

Query: 362 AI-----YFDGQKLITGSLDRMIRVWNYVTGACVAAY 393
            I       +G+ L+  SLD ++++W+++ G+ V  +
Sbjct: 192 PISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTF 228

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/70 (22%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 538 DNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTF 595
           D TI++  +  G+  R   GH   +  +   +    + S + D+++K+WD+ +G  + T 
Sbjct: 77  DFTIEINHITYGRLHRL-VGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTI 135

Query: 596 DSHQAPITCV 605
            +H  P+  +
Sbjct: 136 SAHSEPVVSI 145

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 71/155 (45%), Gaps = 20/155 (12%)

Query: 329 LLFTGSYDSTVAIWDLATGK-------LVRRLTGHRDGVKAIYF--DGQKLITGSLDRMI 379
           LL  GS+DSTV+IW             L+  + GH + VK + +  DG  L T S D+ +
Sbjct: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSV 131

Query: 380 RVWNYVTGA----CVAAYPGHSDSVLSVDSY--KKIIVSGSADKTVKVW--HVESRTCY- 430
            +W          C++    HS  V  V  +  + ++ S S D TV++W  + +   C  
Sbjct: 132 WIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA 191

Query: 431 TLRGH--TEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
            L GH  T W          F   SGSDD+T+R+W
Sbjct: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 101/265 (38%), Gaps = 63/265 (23%)

Query: 344 LATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRV----WNYVTGACVAAYPGHSDS 399
           +A+  L++ L  +++ + +  F    L TGS DR I++    ++  T   V     H  +
Sbjct: 1   MASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA 60

Query: 400 VLSVD--SYKKIIVSGSADKTVKVWHVESRTCYT--------LRGHTEWVGTVKLHPKSF 449
           + SV    +  ++ +GS D TV +W  E     T        + GH   V  V      +
Sbjct: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120

Query: 450 TCFSGSDDTTIRMWDIRSN----TCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPR 505
              + S D ++ +W+   +     C+ V + H   V+ V+                    
Sbjct: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW------------------- 161

Query: 506 NEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTG--KCVRTHFGHVEGIW 563
                                P  + L S S D+T+++W+      +CV    GH   +W
Sbjct: 162 --------------------HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVW 201

Query: 564 DIAADN----FRIVSGAHDKTVKVW 584
               D     FR+ SG+ D TV+VW
Sbjct: 202 SSDFDKTEGVFRLCSGSDDSTVRVW 226

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 329 LLFTGSYDSTVAIWDLATG--KLVRRLTGHRDGVKAIYFDGQ----KLITGSLDRMIRVW 382
           LL + SYD TV IW       + V  L GH   V +  FD      +L +GS D  +RVW
Sbjct: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226

Query: 383 NYV 385
            Y+
Sbjct: 227 KYM 229

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 107/277 (38%), Gaps = 40/277 (14%)

Query: 313 FKGHMDGVLSLQFNYRL-LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLI 371
           FKGH   +  ++F     + T S D T A+WD+   K VR  + H   V A+        
Sbjct: 177 FKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLAL-------- 228

Query: 372 TGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCY- 430
                               A P   +S  S +++     S  +D    +W   S +   
Sbjct: 229 --------------------AIPEEPNSENSSNTF----ASCGSDGYTYIWDSRSPSAVQ 264

Query: 431 TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTIL 490
           +   +   +  ++      +  +GSD+  I M+D+RS+  +  F    G  ++  P    
Sbjct: 265 SFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLRSDCSIATFSLFRGYEERT-PTPTY 323

Query: 491 DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGK 550
              N+  + T+  P+   +T+    D Q     D       + SC  D    +W+V  G+
Sbjct: 324 MAANMEYN-TAQSPQTLKSTSSSYLDNQGVVSLDFSASGRLMYSCYTDIGCVVWDVLKGE 382

Query: 551 CV---RTHFGHVEGIWDIAADNFRIVSGAHDKTVKVW 584
            V     H G V G+   + D   + +G+ D T+K+W
Sbjct: 383 IVGKLEGHGGRVTGVRS-SPDGLAVCTGSWDSTMKIW 418

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/255 (21%), Positives = 101/255 (39%), Gaps = 46/255 (18%)

Query: 353 LTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS--VDSYKK 408
           L GH + +    +  D +++++ S D  + +W+  +G    A P  S  VLS  +     
Sbjct: 88  LKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSST 147

Query: 409 IIVSGSADKTVKVWHV--ESRTCYTL----RGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
           ++ S   +    ++ V  E+R    +    +GHT ++  ++    +    + S D T  +
Sbjct: 148 LVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAH-ILTASGDMTCAL 206

Query: 463 WDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSAL 522
           WDI     V+ +  H+G    VL L I +  N           N + T            
Sbjct: 207 WDIPKAKRVREYSDHLGD---VLALAIPEEPN---------SENSSNT------------ 242

Query: 523 DDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKT 580
                      SC  D    +W+ R+   V++ + +   I       D   IV+G+ +  
Sbjct: 243 ---------FASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGA 293

Query: 581 VKVWDLQSGKCIHTF 595
           + ++DL+S   I TF
Sbjct: 294 INMYDLRSDCSIATF 308

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 4/69 (5%)

Query: 319 GVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGS 374
           GV+SL F+   RL+++   D    +WD+  G++V +L GH   V  +    DG  + TGS
Sbjct: 351 GVVSLDFSASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSPDGLAVCTGS 410

Query: 375 LDRMIRVWN 383
            D  +++W+
Sbjct: 411 WDSTMKIWS 419

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 6/87 (6%)

Query: 527 PYPSHLLSCSLDNTIKLWEV----RTGKCVRTHF-GHVEGIWDIA-ADNFRIVSGAHDKT 580
           P  + + S  L+N   ++ V    R  + V + F GH   I DI   DN  I++ + D T
Sbjct: 144 PSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAHILTASGDMT 203

Query: 581 VKVWDLQSGKCIHTFDSHQAPITCVGI 607
             +WD+   K +  +  H   +  + I
Sbjct: 204 CALWDIPKAKRVREYSDHLGDVLALAI 230

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/306 (20%), Positives = 117/306 (38%), Gaps = 61/306 (19%)

Query: 313 FKGHMDGVLSLQFNYR---LLFTGSYDSTVAIWDLATGKLV-RRLTGHRDGVKAIYF--D 366
           + GH  G  +L+F  +   L  +G  D  + IWD+   +L+ R   GHR  + A  F  D
Sbjct: 170 YDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHD 229

Query: 367 GQKLITGSLDRMIRVWNYVTGACV--AAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHV 424
             +  + S D+ +++W+  TG  +   ++    + +      K+ ++ G +D   K+ H 
Sbjct: 230 NVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDS--KIRHF 287

Query: 425 ESRT------CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV 478
           + R             H   +  ++  P      S SDD +IR+W+ + N  +K      
Sbjct: 288 DLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWENQINIPIK------ 341

Query: 479 GQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLD 538
                     I DT+          P +    AQ                       S+D
Sbjct: 342 ---------QISDTDQYPAPWIQLHPEHNQFAAQ-----------------------SMD 369

Query: 539 NTIKLWEVRTG------KCVRTH-FGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKC 591
           N+I ++ ++        K  R H       ++DIA D   + +G     + +WD ++ K 
Sbjct: 370 NSIYVYSMKPKYKRHPRKAFRGHKSAGYNSMFDIAPDGRYVAAGDTSGRLFIWDWKTTKI 429

Query: 592 IHTFDS 597
           +   ++
Sbjct: 430 LRQLET 435

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 81/183 (44%), Gaps = 16/183 (8%)

Query: 310 IQEFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG 367
           ++++ GH   + +  F++      + SYD TV IWD  TG ++ RL+  +     + F  
Sbjct: 211 LRDYCGHRKAISATSFSHDNVQFASSSYDKTVKIWDTETGDIINRLS-FKATPNCMTFHP 269

Query: 368 Q---KLITGSLDRMIRVWNYVT---GACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTV 419
           Q   +L+ G  D  IR ++         +  Y  H  ++ ++  +      +S S DK++
Sbjct: 270 QNKEQLLVGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSI 329

Query: 420 KVWHVESRTCYTLRGHTEWVGT--VKLHPKSFTCFSGSDDTTIRMWDIRSNT---CVKVF 474
           ++W  +          T+      ++LHP+     + S D +I ++ ++        K F
Sbjct: 330 RIWENQINIPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKAF 389

Query: 475 RGH 477
           RGH
Sbjct: 390 RGH 392

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 532 LLSCSLDNTIKLWEVRTGKCV-RTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDLQS 588
            LS   D  +K+W++   + + R + GH + I     + DN +  S ++DKTVK+WD ++
Sbjct: 190 FLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHDNVQFASSSYDKTVKIWDTET 249

Query: 589 GKCIHTFDSHQAPITCV 605
           G  I+   S +A   C+
Sbjct: 250 GDIINRL-SFKATPNCM 265

>Scas_692.29
          Length = 456

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 77/357 (21%), Positives = 132/357 (36%), Gaps = 118/357 (33%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVW---- 382
           + + T SYD  +  W+L+ GK+ ++ +GH   ++A+ F    +L++   DR +R+W    
Sbjct: 116 KAIITASYDGVIRTWNLS-GKVQKQYSGHSGPIRAVKFISDTRLVSAGNDRTLRLWKTKN 174

Query: 383 ---------------NYVTGACVAAYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVES 426
                          N   G  +A   GH   V+S+D S    I+S S D ++ +W    
Sbjct: 175 NDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTSRILSSSYDNSIGLWS--- 231

Query: 427 RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV---GQVQK 483
            T Y                K  T     ++  I   D + +T  +  R      G +++
Sbjct: 232 -TIY----------------KEMTVVDPMEE--INNADNKISTAARKRRKLTLKDGTIRR 272

Query: 484 VLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKL 543
             PL++L++     ++ S                     DD++ Y     S S D+TIK 
Sbjct: 273 RAPLSLLESHTAPVEQAS-----------------FDINDDTVGY-----SVSQDHTIKT 310

Query: 544 WEVRTGKCVRTH---------------------------------------------FGH 558
           W++ T +C+ T                                               GH
Sbjct: 311 WDLVTARCIDTKTTSYSLLSLTQLPTLNLLACGSSARHITLHDPRMGASSKVTQHQLIGH 370

Query: 559 VEGI--WDIAADNFRIV-SGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEF 612
              +   D   +N  I+ SG+HD TVKVWD++S   ++T       +   G+ D  F
Sbjct: 371 KNFVVSLDTCPENEYILCSGSHDGTVKVWDVRSTAPMYTITREDKNVEK-GVNDKVF 426

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 84/207 (40%), Gaps = 30/207 (14%)

Query: 399 SVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDT 458
           S + V   KK I++ S D  ++ W++  +      GH+  +  VK    +    S  +D 
Sbjct: 107 SSIDVSQDKKAIITASYDGVIRTWNLSGKVQKQYSGHSGPIRAVKFISDT-RLVSAGNDR 165

Query: 459 TIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQ 518
           T+R+W  ++N  V         VQ        D E    D  ++    +     +     
Sbjct: 166 TLRLWKTKNNDSV---------VQH------FDEE----DEEANIEDGKTLAILEGHKAP 206

Query: 519 LSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHD 578
           + +LD  +   S +LS S DN+I LW       +      V+ + +I   + +I + A  
Sbjct: 207 VVSLD--VSNTSRILSSSYDNSIGLWS-----TIYKEMTVVDPMEEINNADNKISTAARK 259

Query: 579 K---TVKVWDLQSGKCIHTFDSHQAPI 602
           +   T+K   ++    +   +SH AP+
Sbjct: 260 RRKLTLKDGTIRRRAPLSLLESHTAPV 286

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 12/83 (14%)

Query: 311 QEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGKLVRRLT--------GHRDG 359
            +  GH + V+SL     N  +L +GS+D TV +WD+ +   +  +T        G  D 
Sbjct: 365 HQLIGHKNFVVSLDTCPENEYILCSGSHDGTVKVWDVRSTAPMYTITREDKNVEKGVNDK 424

Query: 360 VKAI-YFDGQKLITGSLDRMIRV 381
           V A+ + +   +I+G  D+ I++
Sbjct: 425 VFAVRWAEKIGIISGGQDKKIQI 447

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 63/154 (40%), Gaps = 5/154 (3%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYV 385
           R L   +Y    ++W+ +T      +  H   V  + +   G  LI+G  D +I++W   
Sbjct: 94  RRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPN 153

Query: 386 TGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTV 442
                     H + V  +S        V+ S D  +K+W+  + +    L GH   V + 
Sbjct: 154 FNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSC 213

Query: 443 KLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRG 476
             HP      SGS D  I++WD RS  C+    G
Sbjct: 214 DWHPTMGLIVSGSKDNLIKLWDPRSGQCISTILG 247

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-----IVSGAHDKTVKVW 584
           S  ++CS DN +K+W    G+  R   GH    WD+ + ++      IVSG+ D  +K+W
Sbjct: 178 SKFVTCSDDNILKIWNFSNGQQERVLSGHH---WDVKSCDWHPTMGLIVSGSKDNLIKLW 234

Query: 585 DLQSGKCIHTF 595
           D +SG+CI T 
Sbjct: 235 DPRSGQCISTI 245

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 99/263 (37%), Gaps = 56/263 (21%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI---IVSGSADKTVKVW 422
           +G++L+  +      +WN  T    +    H DS ++   Y      ++SG +D  +K+W
Sbjct: 92  EGRRLVVATYSGEFSLWNGSTFNFESIMQAH-DSAVTTMEYSHAGDWLISGDSDGIIKIW 150

Query: 423 HVESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
                    L + H E V  V          + SDD  +++W+  +    +V  GH   V
Sbjct: 151 QPNFNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDV 210

Query: 482 QKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTI 541
           +                                         D  P    ++S S DN I
Sbjct: 211 KSC---------------------------------------DWHPTMGLIVSGSKDNLI 231

Query: 542 KLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSG------AHDKTVKVWDL-QSGKCIHT 594
           KLW+ R+G+C+ T  G       I    F+   G      A DK+ K++D+ Q+ K + +
Sbjct: 232 KLWDPRSGQCISTILGFKH---TIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKS 288

Query: 595 F--DSHQAPITCVGIGDSEFVSG 615
           F  +S    +T   I +S F  G
Sbjct: 289 FRDESDYMSLTWHPINESIFTVG 311

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 85/166 (51%), Gaps = 11/166 (6%)

Query: 314 KGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK-- 369
           + HM+ V  + F+       T S D+ + IW+ + G+  R L+GH   VK+  +      
Sbjct: 162 QAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPTMGL 221

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD---SYKKIIVSGSADKTVKVWHVES 426
           +++GS D +I++W+  +G C++   G   +++      +   ++   + DK+ K++ +  
Sbjct: 222 IVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQ 281

Query: 427 --RTCYTLRGHTEWVGTVKLHPKSFTCFS-GSDDTTIRMWDIRSNT 469
             +   + R  ++++ ++  HP + + F+ G  D +++ +D+  +T
Sbjct: 282 NMKELKSFRDESDYM-SLTWHPINESIFTVGCYDGSLKHFDLLQDT 326

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 65/157 (41%), Gaps = 29/157 (18%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
           I  F+ H   V  L  + R L +GS D  + I+DL   K +  L GH+  +  + F   K
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGK 93

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTC 429
              G  D  +  W                           ++S S D  + VW V+    
Sbjct: 94  DADGQ-DIQLNKW---------------------------LLSASEDHKIIVWRVKDWEN 125

Query: 430 Y-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           + TL+GHT  +    +HP +    S S+D +IR+W++
Sbjct: 126 FGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLWNL 162

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 59/140 (42%), Gaps = 31/140 (22%)

Query: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512
           SGS+D  IR++D++    +    GH G +            NL   R  D          
Sbjct: 56  SGSNDENIRIYDLQKRKELGTLLGHQGSIT-----------NLRFSRGKDA--------- 95

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNF 570
           D  D QL+           LLS S D+ I +W V+  +   T  GH   I  +DI   N 
Sbjct: 96  DGQDIQLNKW---------LLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNR 146

Query: 571 RIVSGAHDKTVKVWDLQSGK 590
             VS + D ++++W+L + K
Sbjct: 147 VAVSVSEDHSIRLWNLMTVK 166

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 45/103 (43%), Gaps = 11/103 (10%)

Query: 390 VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKS 448
           +  +  HS SV  +D  K+ +VSGS D+ ++++ ++ R    TL GH   +  ++     
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGK 93

Query: 449 FT----------CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
                         S S+D  I +W ++        +GH  ++
Sbjct: 94  DADGQDIQLNKWLLSASEDHKIIVWRVKDWENFGTLKGHTARI 136

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPIT 603
           +VSG++D+ ++++DLQ  K + T   HQ  IT
Sbjct: 54  LVSGSNDENIRIYDLQKRKELGTLLGHQGSIT 85

>Kwal_55.21559
          Length = 351

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 78/174 (44%), Gaps = 25/174 (14%)

Query: 316 HMDGVLSLQF--NYRLLFTGSYDSTVAIW----------DLATGKLVRRLTGHRDGVKAI 363
           H   V S+ F  +  +L  GS+DST++IW          D    +L+  + GH + VKA+
Sbjct: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135

Query: 364 YFD--GQKLITGSLDRMIRVWNY----VTGACVAAYPGHSDSVLSV--DSYKKIIVSGSA 415
            +   G  L + S D+ + +W          C++    H+  V  V   S   ++ S S 
Sbjct: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195

Query: 416 DKTVKVWHVES---RTCYTLRGH--TEWVGTVKLHPKSFTCFSGSDDTTIRMWD 464
           D T+++W  ++        L GH  T W    +    S    S SDD+T+R+W+
Sbjct: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 88/218 (40%), Gaps = 28/218 (12%)

Query: 396 HSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR-----GHTEWVGTVKLHPKSFT 450
           H+D + S+D  K ++ + S+D+ +K+ ++++     +       H + V +V   P S  
Sbjct: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI 91

Query: 451 CFSGSDDTTIRMW----------DIRSNTCVKVFRGHVGQVQKV------LPLTILDTEN 494
             +GS D+TI +W          D      + +  GH  +V+ V        L     + 
Sbjct: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151

Query: 495 LVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL-SCSLDNTIKLW--EVRTGKC 551
            V    +D    E        +              HLL S S D+TI+LW  +    +C
Sbjct: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211

Query: 552 VRTHFGHVEGIW----DIAADNFRIVSGAHDKTVKVWD 585
                GH   +W    + +  + R+ S + D TV+VW+
Sbjct: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 6/64 (9%)

Query: 328 RLLFTGSYDSTVAIW--DLATGKLVRRLTGHRDGVKAIYFDGQ----KLITGSLDRMIRV 381
            LL + SYD T+ +W  D    +    L GH+  V    F+      +L + S D  +RV
Sbjct: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247

Query: 382 WNYV 385
           WNYV
Sbjct: 248 WNYV 251

>Scas_721.128
          Length = 851

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 93/221 (42%), Gaps = 35/221 (15%)

Query: 390 VAAYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKS 448
           V  Y  HS  +L +D S    +++ S DK V +WH +  T      H ++V +V+ HPK 
Sbjct: 260 VRIYKEHSHDILDLDWSKNNFLLTASMDKLVSLWHPDRETSLKSFPHPDFVTSVRFHPKD 319

Query: 449 FTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNE 507
              F SG  D   RMW I  N  V  F                D ++L+T  +  P   E
Sbjct: 320 DRFFVSGCLDHKCRMWSILENKVVYEF----------------DCQDLITAISISPGVGE 363

Query: 508 ATTAQDPPDGQ---LSALDDSLPYPSHLLSCSL------DNTIKLWEVRTGKCVRTHFG- 557
            T      +G    LS  +    Y  H+L   +      D++ K      G+ ++ H G 
Sbjct: 364 FTII-GTFNGYITILSTFELKPLYTFHVLDKHMQGNSGNDSSFKNL---LGQNLKNHHGP 419

Query: 558 HVEGI---WDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTF 595
            V G+    +   D+ +++  + D  ++++DL+  K I  F
Sbjct: 420 RVTGLQLFLEKETDDLKLLVSSTDSRIRIFDLEKNKLIEVF 460

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHV-E 425
           L+T S+D+++ +W+      + ++P H D V SV  + K     VSG  D   ++W + E
Sbjct: 281 LLTASMDKLVSLWHPDRETSLKSFP-HPDFVTSVRFHPKDDRFFVSGCLDHKCRMWSILE 339

Query: 426 SRTCY 430
           ++  Y
Sbjct: 340 NKVVY 344

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 74/154 (48%), Gaps = 19/154 (12%)

Query: 329 LLFTGSYDSTVAIW----DLATGK--LVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIR 380
           +L  GS+D+TV+IW    D  +G+  L+  + GH + VK++ +  DG  L T S D+ + 
Sbjct: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129

Query: 381 VWNYVTGA----CVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVES---RTCYT 431
           +W     +    C +    HS  V  +   + + ++ S S D TV++W  +         
Sbjct: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189

Query: 432 LRGH--TEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
           L GH  T W    +         SGSDDTT+R+W
Sbjct: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 84/191 (43%), Gaps = 19/191 (9%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRL--TGHRDGVKAIYF-- 365
           ++  K H D   S+  +  LL TGS D  + + D+   KLV  L  T H+  V+++ +  
Sbjct: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66

Query: 366 DGQKLITGSLDRMIRVW----NYVTG--ACVAAYPGHSDSVLSV--DSYKKIIVSGSADK 417
               L  GS D  + +W    +  +G    +A   GH + V SV        + + S DK
Sbjct: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126

Query: 418 TVKVWHV----ESRTCYT-LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN--TC 470
           +V +W      E   C + L+ H++ V  +  H       S S D T+R+W  + +   C
Sbjct: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186

Query: 471 VKVFRGHVGQV 481
             V  GH G V
Sbjct: 187 AAVLSGHGGTV 197

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 88/216 (40%), Gaps = 32/216 (14%)

Query: 396 HSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR-----GHTEWVGTVKLHPKSFT 450
           H D   SVD  K ++ +GSAD+ +K+  V+ R    +       H + V +V   P    
Sbjct: 13  HGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNV 70

Query: 451 CFSGSDDTTIRMW-----DIRSNT-CVKVFRGHVGQVQKV--------LPLTILDTENLV 496
             +GS DTT+ +W     D    T  + V  GH  +V+ V        L     D    +
Sbjct: 71  LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWI 130

Query: 497 TDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL--SCSLDNTIKLWEVRTG--KCV 552
            +        E  +        +  +   + + S LL  S S D+T+++W  +    +C 
Sbjct: 131 WEADELSEEFECNSVLQEHSQDVKHI---VWHASRLLLASSSYDDTVRIWAEQDDDWECA 187

Query: 553 RTHFGHVEGIW----DIAADNFRIVSGAHDKTVKVW 584
               GH   +W    + A    R+ SG+ D TV++W
Sbjct: 188 AVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 12/67 (17%)

Query: 329 LLFTGSYDSTVAIW-----DLATGKLVRRLTGHRDGVKAIYFD----GQKLITGSLDRMI 379
           LL + SYD TV IW     D     +   L+GH   V    F+    G +L +GS D  +
Sbjct: 164 LLASSSYDDTVRIWAEQDDDWECAAV---LSGHGGTVWCSDFERAETGIRLCSGSDDTTV 220

Query: 380 RVWNYVT 386
           R+W  +T
Sbjct: 221 RIWRCLT 227

>Kwal_27.12239
          Length = 316

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 73/158 (46%), Gaps = 15/158 (9%)

Query: 332 TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGAC 389
           T S D T+ I  +  G+L  RL GH   V ++ +   G  L + S+D  I++W+ ++G  
Sbjct: 75  TASDDFTIIITHIVFGEL-HRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTL 133

Query: 390 VAAYPGHSDSVLSVD---SYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLH 445
           +     HS+ V+S+D       I+ SGS D  ++++   +  C  TL    +W     + 
Sbjct: 134 LRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVV 193

Query: 446 PKSFTCFS--------GSDDTTIRMWDIRSNTCVKVFR 475
           P S   FS         S D  +++WD      V+ F+
Sbjct: 194 PISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRTFK 231

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 87/215 (40%), Gaps = 52/215 (24%)

Query: 397 SDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSD 456
           SD   S DS  + I + S D T+ + H+     + L GHT  V +VK   K     S S 
Sbjct: 62  SDLCWSPDS--QCIATASDDFTIIITHIVFGELHRLVGHTAPVTSVKYTMKGNLLCSCSM 119

Query: 457 DTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPD 516
           D +I++WDI S T ++    H                            +E   + D P 
Sbjct: 120 DESIKIWDILSGTLLRTLSAH----------------------------SEPVVSIDLP- 150

Query: 517 GQLSALDDSLPY-PSHLLSCSLDNTIKLWEVRTGKCVRT-----HFGHVEGIWDIAADNF 570
                     P+ PS L S S D  I++++  TG C++T      +    G+  I+   F
Sbjct: 151 ----------PFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKF 200

Query: 571 R-----IVSGAHDKTVKVWDLQSGKCIHTFDSHQA 600
                 ++  + D  +K+WD   GK + TF S ++
Sbjct: 201 SRNGKYLLVKSLDGILKIWDFVRGKVVRTFKSGES 235

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 66/142 (46%), Gaps = 24/142 (16%)

Query: 310 IQEFKGHMDGVLSLQ---FNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRD-------- 358
           ++    H + V+S+    F+  +L +GSYD  + I+D ATG  ++ LT  +D        
Sbjct: 134 LRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVV 193

Query: 359 GVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD-----------S 405
            +  + F  +G+ L+  SLD ++++W++V G  V  +     S L              +
Sbjct: 194 PISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRTFKSGESSSLRYSCGMDFLYPQDQT 253

Query: 406 YKKIIVSGSADKTVKVWHVESR 427
              I+VSG+    +  W  +++
Sbjct: 254 VDPIVVSGTESGQIVCWDSQTK 275

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 10/36 (27%), Positives = 22/36 (61%)

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
           + S + D+++K+WD+ SG  + T  +H  P+  + +
Sbjct: 114 LCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDL 149

>Kwal_55.22067
          Length = 451

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 63/154 (40%), Gaps = 5/154 (3%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYV 385
           R L   +Y    ++W+ +T      +  H   V  + +   G  LI+G  D  I++W   
Sbjct: 96  RRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVAVMKYSHAGDWLISGDSDGTIKIWQPN 155

Query: 386 TGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTV 442
                     H+  +  +S        V+ S D  +K+W+  + +   TL GH   V + 
Sbjct: 156 FNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSC 215

Query: 443 KLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRG 476
             HP      SGS D  +++WD R+  C+    G
Sbjct: 216 DWHPTMGLIASGSKDNLVKLWDPRAGQCISTILG 249

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/263 (19%), Positives = 95/263 (36%), Gaps = 56/263 (21%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI---IVSGSADKTVKVW 422
           +G++L+  +      +WN  T    +    H DS ++V  Y      ++SG +D T+K+W
Sbjct: 94  EGRRLVVATYSGEFSLWNGSTFNFESIMQAH-DSAVAVMKYSHAGDWLISGDSDGTIKIW 152

Query: 423 HVESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
                    L   HT+ +  +          + SDD  +++W+  +        GH   V
Sbjct: 153 QPNFNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDV 212

Query: 482 QKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTI 541
           +                                         D  P    + S S DN +
Sbjct: 213 RSC---------------------------------------DWHPTMGLIASGSKDNLV 233

Query: 542 KLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSG------AHDKTVKVWDLQSGK---CI 592
           KLW+ R G+C+ T  G       I +  F+   G      + DK+ +++D++       +
Sbjct: 234 KLWDPRAGQCISTILGCKH---TIISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKELAV 290

Query: 593 HTFDSHQAPITCVGIGDSEFVSG 615
           +  +S    +T   I +S F  G
Sbjct: 291 YRDESDYMSLTWHPINESMFTVG 313

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 80/166 (48%), Gaps = 14/166 (8%)

Query: 308 AHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-YFD 366
           AH Q  +G     +S         T S D+ + IW+ + G+    L+GH   V++  +  
Sbjct: 165 AHTQCIRG-----ISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSCDWHP 219

Query: 367 GQKLI-TGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD---SYKKIIVSGSADKTVKVW 422
              LI +GS D ++++W+   G C++   G   +++S     +   ++   S DK+ +++
Sbjct: 220 TMGLIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIF 279

Query: 423 HVES--RTCYTLRGHTEWVGTVKLHPKSFTCFS-GSDDTTIRMWDI 465
            +    +     R  ++++ ++  HP + + F+ G  D +++ +D+
Sbjct: 280 DIRQNMKELAVYRDESDYM-SLTWHPINESMFTVGCYDGSMKHFDL 324

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 62/149 (41%), Gaps = 14/149 (9%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD---GQKLITGSLDRMIRVWNYV 385
           L+ +GS D+ V +WD   G+ +  + G +  + +  F    G  L   S D+  R+++  
Sbjct: 223 LIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIR 282

Query: 386 TGAC-VAAYPGHSD--SVLSVDSYKKIIVSGSADKTVKVWHV------ESRTCY--TLRG 434
                +A Y   SD  S+      + +   G  D ++K + +       S  C+      
Sbjct: 283 QNMKELAVYRDESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSSSGCFHNIPYA 342

Query: 435 HTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
           H + + ++  +P      S S D TIR W
Sbjct: 343 HDKCITSLAYNPVGHILASASKDRTIRFW 371

>Scas_720.45
          Length = 755

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 51/107 (47%), Gaps = 10/107 (9%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAY---PGHSDSVLSVDSY----KKIIVSGSADKT 418
           D     +G LDR ++VW+   G     +    G    V  VD Y    K  +++ S D T
Sbjct: 9   DPNTFASGCLDRTVKVWS--LGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLT 66

Query: 419 VKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWD 464
            KVW  ++++C  TL GH   V     HP      SGS+D T+++W+
Sbjct: 67  CKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWN 113

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 332 TGSYDSTVAIWDLATGKLVRRL-TGHRDGVKAIYF----DGQKLITGSLDRMIRVWNYVT 386
           +G  D TV +W L        L +G   GV  + +    D   LIT S D   +VW+Y T
Sbjct: 15  SGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKVWDYQT 74

Query: 387 GACVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVWH 423
            +CVA   GH  +V     +    II+SGS D T+K+W+
Sbjct: 75  KSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWN 113

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 11/95 (11%)

Query: 410 IVSGSADKTVKVWHVESRT-CYTLR-GHTEWVGTVKLHP---KSFTCFSGSDDTTIRMWD 464
             SG  D+TVKVW +   T  +TL  G  + V  V  +P   K +   + SDD T ++WD
Sbjct: 13  FASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPY-LITSSDDLTCKVWD 71

Query: 465 IRSNTCVKVFRGHVGQV-----QKVLPLTILDTEN 494
            ++ +CV    GH+  V        LP+ I  +E+
Sbjct: 72  YQTKSCVATLEGHMANVSFAVFHPTLPIIISGSED 106

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 8/75 (10%)

Query: 526 LPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-----IVSGAHDKT 580
           LP   +L++ S D T K+W+ +T  CV T  GH+    +++   F      I+SG+ D T
Sbjct: 52  LPDKPYLITSSDDLTCKVWDYQTKSCVATLEGHMA---NVSFAVFHPTLPIIISGSEDGT 108

Query: 581 VKVWDLQSGKCIHTF 595
           +K+W+  + K   T 
Sbjct: 109 LKIWNSATYKVEKTL 123

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 529 PSHLLSCSLDNTIKLWEV-RTGKCVRTHFGHVEGI----WDIAADNFRIVSGAHDKTVKV 583
           P+   S  LD T+K+W + +       + G  +G+    +    D   +++ + D T KV
Sbjct: 10  PNTFASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKV 69

Query: 584 WDLQSGKCIHTFDSHQAPIT 603
           WD Q+  C+ T + H A ++
Sbjct: 70  WDYQTKSCVATLEGHMANVS 89

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 2/59 (3%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVT 386
           L T S D T  +WD  T   V  L GH   V    F      +I+GS D  +++WN  T
Sbjct: 58  LITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

>Kwal_56.24163
          Length = 729

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 49/99 (49%), Gaps = 15/99 (15%)

Query: 336 DSTVAIWDLATGKLVRRLTGHRD-GVKAIYF----DGQKLITGSLDRMIRVWNYVTGACV 390
           D TV IW L        L  H   GV  + +    D   LIT S DR +++W+Y T +CV
Sbjct: 19  DHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCV 78

Query: 391 AAYPGHSDSVLSVDSYK------KIIVSGSADKTVKVWH 423
           A   GH  +V    SY        II+SGS D T+KVW+
Sbjct: 79  ATLEGHMANV----SYAVFHPSLPIILSGSEDGTLKVWN 113

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 8/110 (7%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGH-SDSVLSVDSY----KKIIVSGSADKTVK 420
           D     +  LD  +++W+            H +  V  VD Y    K  +++ S D+TVK
Sbjct: 9   DPSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVK 68

Query: 421 VWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNT 469
           +W  ++++C  TL GH   V     HP      SGS+D T+++W+  SNT
Sbjct: 69  IWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWN--SNT 116

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 11/95 (11%)

Query: 410 IVSGSADKTVKVWHVESRTC-YTLRGH-TEWVGTVKLHP---KSFTCFSGSDDTTIRMWD 464
             S   D TVK+W +   T  +TL+ H T  V  V  +P   K +   + SDD T+++WD
Sbjct: 13  FASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPY-LITSSDDRTVKIWD 71

Query: 465 IRSNTCVKVFRGHVGQVQKV-----LPLTILDTEN 494
            ++ +CV    GH+  V        LP+ +  +E+
Sbjct: 72  YQTKSCVATLEGHMANVSYAVFHPSLPIILSGSED 106

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 529 PSHLLSCSLDNTIKLWEVRTGKCVRTHFGH-VEGI----WDIAADNFRIVSGAHDKTVKV 583
           PS   S  LD+T+K+W +       T   H   G+    +    D   +++ + D+TVK+
Sbjct: 10  PSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKI 69

Query: 584 WDLQSGKCIHTFDSHQAPIT 603
           WD Q+  C+ T + H A ++
Sbjct: 70  WDYQTKSCVATLEGHMANVS 89

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 2/68 (2%)

Query: 531 HLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI-WDIAADNFRIV-SGAHDKTVKVWDLQS 588
           +L++ S D T+K+W+ +T  CV T  GH+  + + +   +  I+ SG+ D T+KVW+  +
Sbjct: 57  YLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNT 116

Query: 589 GKCIHTFD 596
            K   T +
Sbjct: 117 YKLEKTLN 124

 Score = 37.0 bits (84), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 61/162 (37%), Gaps = 42/162 (25%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK--LITGSLDRMIRVWNYVT- 386
           L T S D TV IWD  T   V  L GH   V    F      +++GS D  ++VWN  T 
Sbjct: 58  LITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNTY 117

Query: 387 ------------GACVAAYP--------------------GHSDSVLSVDSYKKIIVSGS 414
                         C+A +P                    G+ +  LS+D   K++  G 
Sbjct: 118 KLEKTLNLGLERSWCIATHPTGKRNYIASGFDNGFTVLSLGNDEPKLSLDPVGKLVWCGG 177

Query: 415 ADK------TVKVWHVE-SRTCYTLRGHTEWVGTVKLHPKSF 449
            +       T  +   E S    TL   T+ +GTV + P+S 
Sbjct: 178 KNASATDVFTAAIRGTEGSEDGETLPLQTKELGTVDVFPQSL 219

>Scas_685.11
          Length = 384

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 65/159 (40%), Gaps = 28/159 (17%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
           I  F+ H   V  L  + R L +GS D  + I+DL   K +  L  H+  +  + F   K
Sbjct: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTC 429
              G  +                            S  K ++S S D  + +W V+    
Sbjct: 94  TENGDGE---------------------------GSNNKWLLSASEDNKIIIWRVKDWEN 126

Query: 430 Y-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
           + TL+GH   +  V +HP +    S S+D +IR+W++ +
Sbjct: 127 FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 58/140 (41%), Gaps = 30/140 (21%)

Query: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512
           SGS+D  IR++D++    +     H G +   L  +   TEN                  
Sbjct: 56  SGSNDEHIRIYDLQKRKELGTLLAHQGSITN-LKFSKSKTEN------------------ 96

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNF 570
              DG+ S           LLS S DN I +W V+  +   T  GH+  I   DI   N 
Sbjct: 97  --GDGEGSN-------NKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNR 147

Query: 571 RIVSGAHDKTVKVWDLQSGK 590
             +S + D ++++W+L + K
Sbjct: 148 VAISVSEDHSIRLWNLMTVK 167

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 14/105 (13%)

Query: 393 YPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFT- 450
           +  H+ SV  +D  K+ +VSGS D+ ++++ ++ R    TL  H   +  +K   KS T 
Sbjct: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF-SKSKTE 95

Query: 451 -----------CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
                        S S+D  I +W ++        +GH+ ++  V
Sbjct: 96  NGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV 140

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 29/45 (64%)

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSGD 616
           +VSG++D+ ++++DLQ  K + T  +HQ  IT +    S+  +GD
Sbjct: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGD 98

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 119/291 (40%), Gaps = 66/291 (22%)

Query: 312 EFKGHMDGVLSL-QFNYRLLFTGSYDSTVAIWDL------------ATGKLVRRLTGHRD 358
           + +GH   V S+   +   + + S D TV IW+L            ++ K V  LT   D
Sbjct: 7   QLRGHTQDVRSVVSLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSLT--YD 64

Query: 359 GVKAIYF-DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADK 417
             + + F  GQ+ I   +  ++ +        V    GH  ++ S+    + +VS S DK
Sbjct: 65  AKQCVLFCGGQEKIIYGVSPLLALGQ----EPVYTLVGHEGNICSLSGDFESLVSSSWDK 120

Query: 418 TVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           T KVW       + L+GH+  V   KL     +  + S DTT+++W  ++ T  K F   
Sbjct: 121 TAKVW-TNGIVKWELKGHSASVWDAKLLNDG-SVLTASADTTVKLW--KNGTLAKTF--- 173

Query: 478 VGQVQKVLPLTILDTENLVTDRT-SDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCS 536
                               D+  SD  RN            +  LDD      H +SCS
Sbjct: 174 --------------------DKLHSDVVRN------------ICILDDG----KHFVSCS 197

Query: 537 LDNTIKLWEVRTGKCVRTHFGHVEGIWDIA-ADNFRIVSGAHDKTVKVWDL 586
            D T+KL  +  G  +    GH   ++ +    +  IVS   D+TV++W++
Sbjct: 198 NDGTLKLSNLE-GGILHEFIGHESFVYAVKQLPSGDIVSCGEDRTVRIWNM 247

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 73/164 (44%), Gaps = 9/164 (5%)

Query: 306 GTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV-KAIY 364
           G   +    GH   + SL  ++  L + S+D T  +W    G +   L GH   V  A  
Sbjct: 89  GQEPVYTLVGHEGNICSLSGDFESLVSSSWDKTAKVW--TNGIVKWELKGHSASVWDAKL 146

Query: 365 FDGQKLITGSLDRMIRVWNYVTGACVAAYPG-HSDSV--LSVDSYKKIIVSGSADKTVKV 421
            +   ++T S D  +++W    G     +   HSD V  + +    K  VS S D T+K+
Sbjct: 147 LNDGSVLTASADTTVKLWK--NGTLAKTFDKLHSDVVRNICILDDGKHFVSCSNDGTLKL 204

Query: 422 WHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
            ++E    +   GH  +V  VK  P S    S  +D T+R+W++
Sbjct: 205 SNLEGGILHEFIGHESFVYAVKQLP-SGDIVSCGEDRTVRIWNM 247

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 76/168 (45%), Gaps = 14/168 (8%)

Query: 303 WRKGTAHIQEFKGHMDGVLSLQF-NYRLLFTGSYDSTVAIWDLAT-GKLVRRLTGHRDGV 360
           W  G     E KGH   V   +  N   + T S D+TV +W   T  K   +L  H D V
Sbjct: 125 WTNGIVK-WELKGHSASVWDAKLLNDGSVLTASADTTVKLWKNGTLAKTFDKL--HSDVV 181

Query: 361 KAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK-IIVSGSADK 417
           + I    DG+  ++ S D  +++ N + G  +  + GH   V +V       IVS   D+
Sbjct: 182 RNICILDDGKHFVSCSNDGTLKLSN-LEGGILHEFIGHESFVYAVKQLPSGDIVSCGEDR 240

Query: 418 TVKVWHVES--RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
           TV++W+++   +   TL   + W  TV + P       GS D  IR++
Sbjct: 241 TVRIWNMDGTIKQVITLPAISIW--TVDVLPNG-DIVVGSSDKIIRIF 285

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 92/225 (40%), Gaps = 23/225 (10%)

Query: 395 GHSDSVLSVDSYKKI-IVSGSADKTVKVWHVESRTCY---TLRGHTEWVGTVKLHPKSFT 450
           GH+  V SV S     + S S D TV++W++++   +         ++V ++    K   
Sbjct: 10  GHTQDVRSVVSLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSLTYDAKQCV 69

Query: 451 CFSGSDDTTIRMWD---IRSNTCVKVFRGHVGQVQKVLPLTILDTENLVT---DRTSDPP 504
            F G  +  I             V    GH G +  +      D E+LV+   D+T+   
Sbjct: 70  LFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSLSG----DFESLVSSSWDKTAKVW 125

Query: 505 RNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT----HFGHVE 560
            N      +      S  D  L     +L+ S D T+KLW  + G   +T    H   V 
Sbjct: 126 TN-GIVKWELKGHSASVWDAKLLNDGSVLTASADTTVKLW--KNGTLAKTFDKLHSDVVR 182

Query: 561 GIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
            I  I  D    VS ++D T+K+ +L+ G  +H F  H++ +  V
Sbjct: 183 NIC-ILDDGKHFVSCSNDGTLKLSNLEGG-ILHEFIGHESFVYAV 225

>Kwal_14.884
          Length = 395

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 70/158 (44%), Gaps = 22/158 (13%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD-GQ 368
           I  F+ H   V  L  + R L +GS D  + I+DL   K +  L  H+  + A+ F  G 
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRT 428
           K+   + D         TG       G  +S        K ++S S D  + +W V+   
Sbjct: 94  KIEDKNEDD--------TGLTT----GRGNS--------KWLISASDDHNLVIWRVKDWE 133

Query: 429 CY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
            + TL+GH   +    +HP +    S S+D +IR+W++
Sbjct: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 75/160 (46%), Gaps = 23/160 (14%)

Query: 393 YPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCF 452
           +  HS SV  +D  K+ +VSGS D+ ++++ ++ R         + +GT+  H  S T  
Sbjct: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKR---------KELGTLLSHQGSITAL 87

Query: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512
             S  T I   +   +T +   RG+   +     ++  D  NLV  R  D   N  T   
Sbjct: 88  KFSKGTKIEDKN-EDDTGLTTGRGNSKWL-----ISASDDHNLVIWRVKD-WENFGTLK- 139

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSL--DNTIKLWEVRTGK 550
               G  S ++D   +PS+ ++ S+  D++I+LW + T K
Sbjct: 140 ----GHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 57/140 (40%), Gaps = 22/140 (15%)

Query: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512
           SGS+D  IR++D++    +     H G +          T    +  T    +NE  T  
Sbjct: 56  SGSNDEHIRIYDLQKRKELGTLLSHQGSI----------TALKFSKGTKIEDKNEDDTGL 105

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNF 570
               G              L+S S D+ + +W V+  +   T  GH   I  +DI   N 
Sbjct: 106 TTGRGN----------SKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNR 155

Query: 571 RIVSGAHDKTVKVWDLQSGK 590
             +S + D ++++W+L + K
Sbjct: 156 IAISVSEDHSIRLWNLMTVK 175

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%)

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
           +VSG++D+ ++++DLQ  K + T  SHQ  IT +
Sbjct: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL 87

>Kwal_55.21450
          Length = 503

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 79/181 (43%), Gaps = 24/181 (13%)

Query: 310 IQEFKGHMDG---VLSLQFNYRLLFTGSYDSTVAIWDLATGK-LVRRLTGHRDGVKAIYF 365
           I  + GH +G   +L L  +  L  +   D+ V IWDL   + L+R   GH   V+ I F
Sbjct: 203 IHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISF 262

Query: 366 --DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWH 423
             +G + ++ S D+ I++W+  TG     Y     S   + +  +   S S +  V + +
Sbjct: 263 NSEGSEFLSVSFDQQIKIWDTETGKVRHQY-----SYSCIPNCAEFRPSNSNEFIVGLSN 317

Query: 424 VESRTCYTLRG------------HTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCV 471
            E R  Y LR             H   +  +K  P      S S+D ++R+W+ + N  +
Sbjct: 318 SEIRH-YDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWENQINIPI 376

Query: 472 K 472
           K
Sbjct: 377 K 377

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 526 LPYPSHL-LSCSLDNTIKLWEV-RTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTV 581
           LP   HL LS   DN +K+W++ R  + +R + GH + +  I+  ++    +S + D+ +
Sbjct: 219 LPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQI 278

Query: 582 KVWDLQSGKCIHTF 595
           K+WD ++GK  H +
Sbjct: 279 KIWDTETGKVRHQY 292

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 87/202 (43%), Gaps = 23/202 (11%)

Query: 423 HVESRTCYTLRGHTEWVGTVKLHPKS-FTCFSGSDDTTIRMWDI-RSNTCVKVFRGHVGQ 480
           ++  +  +T  GH     ++ L PKS   C S  +D  +++WD+ R    ++ +RGH   
Sbjct: 197 YLPKKLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKA 256

Query: 481 VQKV--------LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHL 532
           V+ +              D +  + D  +   R++ + +  P   +        P  S+ 
Sbjct: 257 VRGISFNSEGSEFLSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFR------PSNSNE 310

Query: 533 LSCSLDNT-IKLWEVRTGK---CVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDL 586
               L N+ I+ +++RT      V+ +  H+  I  +    D  + VS + DK++++W+ 
Sbjct: 311 FIVGLSNSEIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWEN 370

Query: 587 QSGKCIHTF-DSHQAPITCVGI 607
           Q    I    D+ Q  +  +GI
Sbjct: 371 QINIPIKQISDTSQYSMPYIGI 392

>Kwal_33.15136
          Length = 473

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 69/315 (21%), Positives = 128/315 (40%), Gaps = 54/315 (17%)

Query: 315 GHMDGVLSLQFNYRL---LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKL- 370
           GH DGV ++  NY +   L T S D  V  W+++T + V     H   +  +    Q L 
Sbjct: 65  GHRDGVYTIAKNYHVLNKLATASADGVVKYWNMSTREEVCSFKAHYGLIHGLCVTPQHLS 124

Query: 371 --------ITGSLDRMIRVWNYVT----------------GACVAAYPGHSDSVLSVDSY 406
                   ++   DR +++W+  T                   +  + G   + L +D +
Sbjct: 125 QNKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHG-EHAFLGIDHH 183

Query: 407 K--KIIVSGSADKTVKVW-HVESRTCYTLRGHTEWVGTVKLHPKSFTCF-SGSDDTTIRM 462
           +     V+G A+  + +W    SR    L    + V TVK +      F S   D ++ +
Sbjct: 184 RSNSNFVTGGAE--INLWDSTRSRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVL 241

Query: 463 WDIRSNTCVKVFRGHVGQVQKVLPLTI----LDTENLVTDRTSDPP-----RNEATTAQD 513
           +D+R+N+  + F      VQK+    +    ++  N V             RN +     
Sbjct: 242 YDLRTNSPTQKF------VQKMRTNALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHV 295

Query: 514 PPDGQLSALD-DSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT-HFGHVEGIWDI--AADN 569
             D   + +D D  P    +++ S D TI++++V+ G      H   ++ ++ +    D+
Sbjct: 296 FKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQVKHGHSREIYHTKRMQHVFQVKYTMDS 355

Query: 570 FRIVSGAHDKTVKVW 584
             IVSG+ D  V++W
Sbjct: 356 RYIVSGSDDGNVRMW 370

 Score = 32.7 bits (73), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 14/101 (13%)

Query: 336 DSTVAIWDLATGKLVRRLTGHRDGVKAIY---FD--GQKLITGSLDRMIRVWNYVTGACV 390
           D     +D+    L R L   +D V A+    F   G +++TGS D+ IR++    G   
Sbjct: 278 DHNAYYYDMRN--LSRALHVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQVKHGHSR 335

Query: 391 AAYPGHSDSVLSVDSYK-----KIIVSGSADKTVKVWHVES 426
             Y  H+  +  V   K     + IVSGS D  V++W  ++
Sbjct: 336 EIY--HTKRMQHVFQVKYTMDSRYIVSGSDDGNVRMWRAKA 374

>Scas_397.2
          Length = 410

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 50/121 (41%), Gaps = 39/121 (32%)

Query: 434 GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTE 493
            H   + T+K  P      SGS D  +++W I+  +C ++FRGH  ++          T+
Sbjct: 137 AHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKI----------TD 186

Query: 494 NLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVR 553
           +++ +R  D                              +S SLD T+KLWE  +G  VR
Sbjct: 187 SVLIERGRD-----------------------------FVSSSLDGTMKLWECGSGSTVR 217

Query: 554 T 554
           T
Sbjct: 218 T 218

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 526 LPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWD-IAADNFR-IVSGAHDKTVKV 583
            P    +LS S D  +KLW ++   C R   GH   I D +  +  R  VS + D T+K+
Sbjct: 148 FPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKL 207

Query: 584 WDLQSGKCIHTFDSHQAP 601
           W+  SG  + TF   + P
Sbjct: 208 WECGSGSTVRTFMRRENP 225

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 408 KIIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIR 466
           ++++SGS+D  +K+W ++  +C    RGHT  +    L  +     S S D T+++W+  
Sbjct: 152 EVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECG 211

Query: 467 SNTCVKVF 474
           S + V+ F
Sbjct: 212 SGSTVRTF 219

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 6/60 (10%)

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYPGH----SDSVLSVDSYKKIIVSGSADKTVKVW 422
           G+ +++GS D  +++W+    +C   + GH    +DSVL      +  VS S D T+K+W
Sbjct: 151 GEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLI--ERGRDFVSSSLDGTMKLW 208

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 526 LPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA-ADNFR-IVSGAHDKTVKV 583
            P    L+S S D  +K+W V+ G   RT  GH   + DIA  D  R ++S + D T+++
Sbjct: 145 FPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRL 204

Query: 584 WDLQSGKCIHTFDSHQAP 601
           W+  +G  IHTF+  + P
Sbjct: 205 WECGTGTTIHTFNRKENP 222

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 76/192 (39%), Gaps = 37/192 (19%)

Query: 314 KGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK--AIYFDGQK 369
           + H+  +  L+F  +   L + S D  + IW +  G   R L GHR  V   AI   G+ 
Sbjct: 133 QAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRN 192

Query: 370 LITGSLDRMIRVWNYVTGACVAAY---PGHSDSVLSVDSYKKIIVSGSADKTVKVWHVES 426
           +++ SLD  IR+W   TG  +  +       D V S+  +           T K  ++E 
Sbjct: 193 VLSASLDGTIRLWECGTGTTIHTFNRKENPHDGVNSIALFVGTDRQLHEISTSKKNNLEF 252

Query: 427 RTC--YTLRGHTEWVGTVKLH-----------PKSFTC---------------FSGSDDT 458
            T   Y + GH    G + +H           P  FTC               ++G ++ 
Sbjct: 253 GTYGKYVIAGHVS--GVITVHNVFSKEQTIQLPSKFTCSCNSLTVDGNNANYIYAGYENG 310

Query: 459 TIRMWDIRSNTC 470
            +  WD+RS  C
Sbjct: 311 MLAQWDLRSPEC 322

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 410 IVSGSADKTVKVWHV-ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN 468
           ++S S D  +K+W V +     TL GH   V  + +  +     S S D TIR+W+  + 
Sbjct: 151 LISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRLWECGTG 210

Query: 469 TCVKVFR 475
           T +  F 
Sbjct: 211 TTIHTFN 217

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/255 (21%), Positives = 103/255 (40%), Gaps = 19/255 (7%)

Query: 348 KLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD-- 404
           K+V    GH   V  + F + + ++T S D    +W+      V+ Y  H   VL++   
Sbjct: 168 KIVSIFKGHTCYVSDLEFINNESILTASGDMTCALWDIPKSKRVSEYSDHLGDVLTLSVP 227

Query: 405 -----SYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDT 458
                SY  +  SG +D  V +W   S  +          + TV+      +  +GSDD 
Sbjct: 228 PAGTTSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDG 287

Query: 459 TIRMWDIRSNTCVKVFRGHVGQVQKVLPL-------TILDTENLVTDRTSDPPRNEATTA 511
             R++D+RS+  +  +       Q+ + L       + ++  N     T   P  E   +
Sbjct: 288 IARLFDLRSDCELSSYSLSQKVQQQQMKLKNRSYLSSTMEYSNSSAAATPYSPAAETIRS 347

Query: 512 QDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI--AADN 569
               +  + +LD S+     L +C  +    +W+   G+ V    GH   I  +  + D 
Sbjct: 348 SYLDNQGIVSLDFSIS-GRLLYACYTEYGCIVWDTLRGEIVGRLEGHSSRISGVRTSPDG 406

Query: 570 FRIVSGAHDKTVKVW 584
             + +G+ D T+K+W
Sbjct: 407 MCVCTGSWDSTMKLW 421

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 319 GVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGS 374
           G++SL F+   RLL+    +    +WD   G++V RL GH   +  +    DG  + TGS
Sbjct: 354 GIVSLDFSISGRLLYACYTEYGCIVWDTLRGEIVGRLEGHSSRISGVRTSPDGMCVCTGS 413

Query: 375 LDRMIRVW 382
            D  +++W
Sbjct: 414 WDSTMKLW 421

>Scas_571.4
          Length = 601

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 69/176 (39%), Gaps = 32/176 (18%)

Query: 432 LRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTIL 490
            RGH   V      P   F   S SDD  I +W+I  N  ++ +R    +   + P  IL
Sbjct: 85  FRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKIL 144

Query: 491 DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYP---SHLLSCSLDNTIKLWEVR 547
                                     G    +   L +P   + L S SLD T+K+W ++
Sbjct: 145 -------------------------SGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIK 179

Query: 548 TGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAP 601
            GK + T   H + +  +A   D   + +   +K + +WD+ S + +    SHQ P
Sbjct: 180 KGKVIGT-LQHSDMVTAMAFDPDGAYLATITRNKKLTIWDIASKQIVSQTKSHQGP 234

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 70/175 (40%), Gaps = 26/175 (14%)

Query: 309 HIQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV-KAIY 364
           H+  F+GH   VL   F   N   + + S D  + IW++     +R    +RD   K + 
Sbjct: 81  HVSLFRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMR---TYRDSENKPMD 137

Query: 365 FDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHV 424
               K+++G   ++                GH   VL     + ++ S S D TVK+W++
Sbjct: 138 IRPSKILSGHTRKV----------------GH---VLFHPRIRNVLASSSLDFTVKIWNI 178

Query: 425 ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           +         H++ V  +   P      + + +  + +WDI S   V   + H G
Sbjct: 179 KKGKVIGTLQHSDMVTAMAFDPDGAYLATITRNKKLTIWDIASKQIVSQTKSHQG 233

>Scas_585.8
          Length = 460

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-----IVSGAHDKTVKVW 584
           S  ++CS DN +K+W    G+  RT  GH    WDI + ++      IVS + D  VK+W
Sbjct: 186 SKFVTCSDDNVLKIWNFSNGQVERTLSGHH---WDIKSCDWHPEMGLIVSASKDNLVKLW 242

Query: 585 DLQSGKCIHTF 595
           D +SG+CI T 
Sbjct: 243 DPRSGQCISTI 253

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 63/149 (42%), Gaps = 6/149 (4%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYV 385
           R L   +Y+   ++W+  T      +  H   V  I +   G  + +G  D  I++W   
Sbjct: 103 RRLVVATYNGEFSLWN-GTSFNESLMQAHDSAVSCIQYSHAGDWMCSGDADGGIKIWQPN 161

Query: 386 TGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTV 442
                     H++ +  +S  +     V+ S D  +K+W+  + +   TL GH   + + 
Sbjct: 162 FNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKSC 221

Query: 443 KLHPKSFTCFSGSDDTTIRMWDIRSNTCV 471
             HP+     S S D  +++WD RS  C+
Sbjct: 222 DWHPEMGLIVSASKDNLVKLWDPRSGQCI 250

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 88/174 (50%), Gaps = 12/174 (6%)

Query: 303 WRKGTAHIQEFK-GHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDG 359
           W+     ++EF+  H + +  + F  N     T S D+ + IW+ + G++ R L+GH   
Sbjct: 158 WQPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWD 217

Query: 360 VKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV---DSYKKIIVSGS 414
           +K+  +  +   +++ S D ++++W+  +G C++       +VL      +   ++ + S
Sbjct: 218 IKSCDWHPEMGLIVSASKDNLVKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAIS 277

Query: 415 ADKTVKVWHVES--RTCYTLRGHTEWVGTVKLHPKSFTCFS-GSDDTTIRMWDI 465
            DK+ +V+ +    +    +R   +++ T+  +P + + F+ G+ D  ++ +D+
Sbjct: 278 KDKSCRVFDIRHSMKELMCVRDEVDYM-TLTWNPINESMFTVGNYDGAMKYFDL 330

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 68/193 (35%), Gaps = 45/193 (23%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKI---IVSGSADKTVKVW 422
           +G++L+  + +    +WN  T    +    H DS +S   Y      + SG AD  +K+W
Sbjct: 101 EGRRLVVATYNGEFSLWN-GTSFNESLMQAH-DSAVSCIQYSHAGDWMCSGDADGGIKIW 158

Query: 423 HVESRTCYTLR-GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
                        HTE +  +          + SDD  +++W+  +    +   GH   +
Sbjct: 159 QPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWDI 218

Query: 482 QKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTI 541
           +                                         D  P    ++S S DN +
Sbjct: 219 KSC---------------------------------------DWHPEMGLIVSASKDNLV 239

Query: 542 KLWEVRTGKCVRT 554
           KLW+ R+G+C+ T
Sbjct: 240 KLWDPRSGQCIST 252

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 2/70 (2%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADN--FRIVSGAHDKTVKVWDLQSG 589
           + S   D  IK+W+            H E I DI+  N   + V+ + D  +K+W+  +G
Sbjct: 146 MCSGDADGGIKIWQPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNG 205

Query: 590 KCIHTFDSHQ 599
           +   T   H 
Sbjct: 206 QVERTLSGHH 215

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 79/193 (40%), Gaps = 30/193 (15%)

Query: 290 KVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKL 349
           K+++R+    E  +     H QE  G     L    +   L +G  D+ V ++D  + K 
Sbjct: 350 KILHRDVRMPEHYFETANTHSQEVCG-----LKWNVDENRLASGGNDNVVYVYDGPSKKP 404

Query: 350 VRRLTGHRDGVKAIYFDGQKLIT-----GSLDRMIRVWNYVTGA-----------CVAAY 393
           V + T H   VKA+ +   +  T     G+ DR +++WN  +G            C   +
Sbjct: 405 VLKFTEHNAAVKAMAWSPHRRATLATGGGTADRRLKIWNVNSGVRLNDVDTGSQVCNMVW 464

Query: 394 PGHSDSVLSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCF 452
             ++D +++   Y K          + +W   +      L+GH+  V  + L     T  
Sbjct: 465 SKNTDEIVTSHGYSKF--------NLTLWDCPTLEPLAVLKGHSFRVLHLTLSTDGTTIV 516

Query: 453 SGSDDTTIRMWDI 465
           SG+ D T+R W +
Sbjct: 517 SGAGDETLRYWKL 529

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 91/237 (38%), Gaps = 23/237 (9%)

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVES 426
           G  L  G  + ++ + + V   C+    GH D V  +   + I+ SGS D   K+ H + 
Sbjct: 299 GSHLAVGLGNGLVELHDVVKQKCIRTLSGHLDRVACLSWNQHILSSGSKDH--KILHRDV 356

Query: 427 RT----CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQ 482
           R       T   H++ V  +K +       SG +D  + ++D  S   V  F  H   V+
Sbjct: 357 RMPEHYFETANTHSQEVCGLKWNVDENRLASGGNDNVVYVYDGPSKKPVLKFTEHNAAVK 416

Query: 483 KVL----PLTILDTENLVTDR-------TSDPPRNEATTAQDPPDGQLSALDDSLPYPSH 531
            +         L T     DR        S    N+  T     +   S   D +   SH
Sbjct: 417 AMAWSPHRRATLATGGGTADRRLKIWNVNSGVRLNDVDTGSQVCNMVWSKNTDEI-VTSH 475

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDL 586
             S      + LW+  T + +    GH   +    ++ D   IVSGA D+T++ W L
Sbjct: 476 GYS---KFNLTLWDCPTLEPLAVLKGHSFRVLHLTLSTDGTTIVSGAGDETLRYWKL 529

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 8/87 (9%)

Query: 526 LPYPSHLLSC-SLDNTIKLWEVRTGK----CVRTHFGHVEGI-WDIAADNFRIVSGAHDK 579
           L +  H+LS  S D+ I   +VR  +       TH   V G+ W++  D  R+ SG +D 
Sbjct: 335 LSWNQHILSSGSKDHKILHRDVRMPEHYFETANTHSQEVCGLKWNV--DENRLASGGNDN 392

Query: 580 TVKVWDLQSGKCIHTFDSHQAPITCVG 606
            V V+D  S K +  F  H A +  + 
Sbjct: 393 VVYVYDGPSKKPVLKFTEHNAAVKAMA 419

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 100/261 (38%), Gaps = 53/261 (20%)

Query: 350 VRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS--VDS 405
           VR L GH + +  + +  D   +++ S D  I +W+  TG   +A P  S  VLS  +  
Sbjct: 79  VRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSAISP 138

Query: 406 YKKIIVSGSADKTVKVWHV------ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTT 459
              ++ S   D    V+ V      +       +GHT ++   +   +  T  + S D T
Sbjct: 139 SGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDER-TILTASGDMT 197

Query: 460 IRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQL 519
             MWDI  +  V  F  H+G V             L  D    PP N             
Sbjct: 198 CAMWDIPKSKRVTEFIDHLGDV-------------LTMDL---PPANTGR---------- 231

Query: 520 SALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF-----RIVS 574
                   Y  + ++   D    LW+VR     ++ F       D++A  F       ++
Sbjct: 232 --------YGHNFITGGSDGYAYLWDVRQPNSAQSFFISDS---DVSAIKFFNNGESFMA 280

Query: 575 GAHDKTVKVWDLQSGKCIHTF 595
           G+ D + +++DL+S   I T+
Sbjct: 281 GSDDGSARLFDLRSDCQISTY 301

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 42/71 (59%), Gaps = 4/71 (5%)

Query: 319 GVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGS 374
           GV+S+ F+   RL++    D   A+WD+  G+++ ++ GHR+ + A+    DG  +++ S
Sbjct: 364 GVISIDFSSSGRLMYACYADYGCAVWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSS 423

Query: 375 LDRMIRVWNYV 385
            D  ++VW  V
Sbjct: 424 WDMTLKVWTPV 434

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 57/136 (41%), Gaps = 9/136 (6%)

Query: 348 KLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD-- 404
            ++    GH   + A  F D + ++T S D    +W+      V  +  H   VL++D  
Sbjct: 166 NVISIFKGHTCYISATEFLDERTILTASGDMTCAMWDIPKSKRVTEFIDHLGDVLTMDLP 225

Query: 405 -----SYKKIIVSGSADKTVKVWHV-ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDT 458
                 Y    ++G +D    +W V +  +  +       V  +K      +  +GSDD 
Sbjct: 226 PANTGRYGHNFITGGSDGYAYLWDVRQPNSAQSFFISDSDVSAIKFFNNGESFMAGSDDG 285

Query: 459 TIRMWDIRSNTCVKVF 474
           + R++D+RS+  +  +
Sbjct: 286 SARLFDLRSDCQISTY 301

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRI--VSGAHDKTVKVWDLQSG 589
           L +CS D +  +W    G+ + T  GH+  IW I +D+  +  V+G+ D T+KVW L +G
Sbjct: 25  LFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNG 84

Query: 590 KCIHTFD 596
           +C+ T++
Sbjct: 85  QCVQTWN 91

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 315 GHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKL-- 370
           GH   +  +++N    LLFT S D + ++W    G+ +  L GH   + +I  D   L  
Sbjct: 8   GHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYC 67

Query: 371 ITGSLDRMIRVWNYVTGACV 390
           +TGS D  I+VW  + G CV
Sbjct: 68  VTGSADYTIKVWTLMNGQCV 87

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 4/81 (4%)

Query: 353 LTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKII 410
           L GH   +  + +  +G  L T S D    VW    G  +    GH  S+ S+DS    +
Sbjct: 6   LMGHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSL 65

Query: 411 --VSGSADKTVKVWHVESRTC 429
             V+GSAD T+KVW + +  C
Sbjct: 66  YCVTGSADYTIKVWTLMNGQC 86

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 46/225 (20%), Positives = 95/225 (42%), Gaps = 29/225 (12%)

Query: 409 IIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
           ++ + S D +  VW+  +     TL GH   + ++     S  C +GS D TI++W + +
Sbjct: 24  LLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMN 83

Query: 468 NTCVKVFRGHVGQVQKV-------LPLTILDT------ENLVTDRTSDPPRNEATTAQDP 514
             CV+ +   V  V++V         L ILD          + +   +P  NE T   + 
Sbjct: 84  GQCVQTWNCPV-PVKRVEFSPCGKYILAILDNVMKKPGSIEIYEVKRNPETNEITEFVEE 142

Query: 515 PDGQLSALDDSLPYPS---------HLLSCSLDNTIKLWEVRTG-KCVRTHFGHVEGIWD 564
           P   +    + L   S         ++++   D  I  ++ + G K V +   H + + D
Sbjct: 143 PIHSI-VTHEGLDAASVAGWSGEGKYIIAGHKDGKISKYDTQDGYKLVESQQVHKDSVSD 201

Query: 565 I--AADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
           +  + D    ++ + D    + D+++ K + T+++  +P+    I
Sbjct: 202 LQFSPDRTYFITCSRDSNAHIIDIETFKVLKTYET-DSPLNSAAI 245

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 526 LPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA-ADNFR-IVSGAHDKTVKV 583
            P     LS S+D  +K+W+  TG  +RT  GH   + D A  D  R  VS + D ++K+
Sbjct: 167 FPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKL 226

Query: 584 WDLQSGKCIHTFDSHQAPITCVGIGD 609
           W+  +  C+ T +S+   I C+ + +
Sbjct: 227 WECSTSACVFTLNSNDG-INCISLAN 251

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 314 KGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK--AIYFDGQK 369
           + H   +   QF  N     + S D  + IWD +TG  +R   GH   V   A+   G+ 
Sbjct: 155 EAHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRN 214

Query: 370 LITGSLDRMIRVWNYVTGACV 390
            ++ S D  +++W   T ACV
Sbjct: 215 FVSASSDGSLKLWECSTSACV 235

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWH 423
           +G   ++ S+D  +++W+  TG  +  + GH+ SV   ++    +  VS S+D ++K+W 
Sbjct: 169 NGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWE 228

Query: 424 VESRTCYTLRGHTEWVGTVKL 444
             +  C       + +  + L
Sbjct: 229 CSTSACVFTLNSNDGINCISL 249

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 1/71 (1%)

Query: 410 IVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN 468
            +S S D  +K+W   + T   T  GHT  V    +  +     S S D ++++W+  ++
Sbjct: 173 FLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWECSTS 232

Query: 469 TCVKVFRGHVG 479
            CV     + G
Sbjct: 233 ACVFTLNSNDG 243

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 2/68 (2%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF--RIVSGAHDKTVKVWDLQSG 589
           L SCS D++  +W    G+ + T  GH   IW I  D F    V+G+ D ++K+WD+ +G
Sbjct: 25  LFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNG 84

Query: 590 KCIHTFDS 597
           +C+ T+ S
Sbjct: 85  QCVATWKS 92

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 352 RLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS--VDSYK 407
           +LTGH   +  + +  +G  L + S D    VW  + G  +    GH+ ++ S  VD + 
Sbjct: 5   KLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFT 64

Query: 408 KIIVSGSADKTVKVWHVESRTC 429
           K  V+GSAD ++K+W V +  C
Sbjct: 65  KYCVTGSADYSIKLWDVSNGQC 86

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 315 GHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKL 370
           GH   +  +++N    LLF+ S DS+ ++W    G+ +  L GH   + +I  D   +  
Sbjct: 8   GHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYC 67

Query: 371 ITGSLDRMIRVWNYVTGACVAAY 393
           +TGS D  I++W+   G CVA +
Sbjct: 68  VTGSADYSIKLWDVSNGQCVATW 90

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 409 IIVSGSADKTVKVWH-VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
           ++ S S D +  VW+ +      TL GHT  + ++ +   +  C +GS D +I++WD+ +
Sbjct: 24  LLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSN 83

Query: 468 NTCVKVFRGHV 478
             CV  ++  V
Sbjct: 84  GQCVATWKSPV 94

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 115/272 (42%), Gaps = 58/272 (21%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTG 387
           L TG     + +W +  GKL   L+ HR  +  I +  D   ++T   D M  VWN ++G
Sbjct: 209 LLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267

Query: 388 ACVAAYP---GHSDSVLSVDSY----KKIIVSGSADKTVKVWHVE-SRTCYTLRGHTEWV 439
             V  +      ++  L VD+      K  + G    ++ V+++  S+    LRGH++ +
Sbjct: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKLRGHSKTL 326

Query: 440 GTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDR 499
            T+  +  +    S SDD T+R+W   +     VF GH                      
Sbjct: 327 TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGH---------------------- 364

Query: 500 TSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHV 559
                 +++ T+    D      DD+      ++S S+D +I++W + +   V +    V
Sbjct: 365 ------SQSITSAHWVD------DDT------IISTSMDGSIRVWSLASNSTVAS--ATV 404

Query: 560 EGIWD----IAADNFRIVSGAHDKTVKVWDLQ 587
           +G+ +    ++ D  +  +G  D  V V+D+Q
Sbjct: 405 DGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 84/199 (42%), Gaps = 24/199 (12%)

Query: 410 IVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNT 469
           +++G     +++W VE +    L  H   +  +K +       +   D    +W++ S T
Sbjct: 209 LLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT 268

Query: 470 CVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQD----PPDGQLSALDDS 525
            V+ F       ++ L +   D   +  D+ + P    +    +     P G+L     +
Sbjct: 269 AVQHFSFKEAGTEESLGV---DATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKT 325

Query: 526 L---PYPSH---LLSCSLDNTIKLWEVRTGKCVRTH--FGHVEGI----WDIAADNFRIV 573
           L    Y  H   LLS S DNT+++W  R G    +H  +GH + I    W    D+  I+
Sbjct: 326 LTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAHW---VDDDTII 380

Query: 574 SGAHDKTVKVWDLQSGKCI 592
           S + D +++VW L S   +
Sbjct: 381 STSMDGSIRVWSLASNSTV 399

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 392 AYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFT 450
           ++ GH+  +L +D S    +++GS DKTVK+WH + +       H ++V  VK HP    
Sbjct: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450

Query: 451 CF-SGSDDTTIRMWDI 465
            F SG  D   R+W I
Sbjct: 451 FFISGCLDHKARLWSI 466

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 82/203 (40%), Gaps = 33/203 (16%)

Query: 311 QEFKGHMDGVLSLQFN-YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF---D 366
           + F GH   +L + ++    + TGS D TV +W     +L++    H D V  + F   D
Sbjct: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPND 448

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAY------------PGHSD-SVLSVDSYKKIIVSG 413
            +  I+G LD   R+W+ +       +            PG S  ++L   +   I++  
Sbjct: 449 DRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLT 508

Query: 414 SADKTVKVWH-----------VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
              + V  +H           V +R   T R +T     V        CF   +D T+++
Sbjct: 509 RGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKV----TGIECFRAVNDMTLKL 564

Query: 463 WDIRSNTCVKVFRGHVGQVQKVL 485
               +++ ++VF      +Q+VL
Sbjct: 565 LVTSNDSKIRVFNLKDNILQEVL 587

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 7/68 (10%)

Query: 553 RTHFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI--- 607
           R+  GH + I DI  + +NF +++G+ DKTVK+W     + +  F  H   +TCV     
Sbjct: 390 RSFLGHNQDILDIDWSKNNF-VLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPN 447

Query: 608 GDSEFVSG 615
            D  F+SG
Sbjct: 448 DDRFFISG 455

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 86/235 (36%), Gaps = 55/235 (23%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWH 423
           +G++LI  +      +WN  +         H  SV  +        ++SG AD T+K+W 
Sbjct: 93  EGRRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQ 152

Query: 424 VESRTCYTL-RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQ 482
                   L R HTE +  V          + SDD  +++W+  +    +V  GH   V+
Sbjct: 153 PNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVR 212

Query: 483 KVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIK 542
                                                    D  P    ++S S DN +K
Sbjct: 213 SC---------------------------------------DWHPELGLIVSGSKDNLVK 233

Query: 543 LWEVRTGKCVRT--HFGHVEGIWDIAADNFRIVSG------AHDKTVKVWDLQSG 589
           LW+ R+G+CV T   F H      +    F+   G      + DK+ +V+DL++ 
Sbjct: 234 LWDPRSGQCVSTLLKFKHT-----VLKTRFQPTKGNLLAAISKDKSCRVFDLRAS 283

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR-----IVSGAHDKTVKVW 584
           S  ++CS DN +K+W    G+  R   GH    WD+ + ++      IVSG+ D  VK+W
Sbjct: 179 SKFVTCSDDNILKIWNFSNGQQERVLSGHH---WDVRSCDWHPELGLIVSGSKDNLVKLW 235

Query: 585 DLQSGKCIHTF 595
           D +SG+C+ T 
Sbjct: 236 DPRSGQCVSTL 246

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 64/154 (41%), Gaps = 9/154 (5%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVW--- 382
           R L   ++    ++W+ ++      +  H   V  + +   G  +I+G  D  I++W   
Sbjct: 95  RRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPN 154

Query: 383 -NYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVG 440
            N V         G  D   S +  K   V+ S D  +K+W+  + +    L GH   V 
Sbjct: 155 FNMVKELDRIHTEGIRDVAFSNNDSK--FVTCSDDNILKIWNFSNGQQERVLSGHHWDVR 212

Query: 441 TVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVF 474
           +   HP+     SGS D  +++WD RS  CV   
Sbjct: 213 SCDWHPELGLIVSGSKDNLVKLWDPRSGQCVSTL 246

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 67/132 (50%), Gaps = 8/132 (6%)

Query: 303 WRKGTAHIQEF-KGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDG 359
           W+     ++E  + H +G+  + F  N     T S D+ + IW+ + G+  R L+GH   
Sbjct: 151 WQPNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWD 210

Query: 360 VKAIYFDGQK--LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV---DSYKKIIVSGS 414
           V++  +  +   +++GS D ++++W+  +G CV+       +VL      +   ++ + S
Sbjct: 211 VRSCDWHPELGLIVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAIS 270

Query: 415 ADKTVKVWHVES 426
            DK+ +V+ + +
Sbjct: 271 KDKSCRVFDLRA 282

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 65/142 (45%), Gaps = 10/142 (7%)

Query: 333 GSYDSTVAIWDLATGKLVRRLTGHRDGV--KAIYFDGQKLITGSLDRMIRVWNYVTGACV 390
           G+    V +W+L TG +V+RL GH   +    +  DG+ + + S DR IRVW+  TG  V
Sbjct: 157 GTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQV 216

Query: 391 AAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHV-----ESRTCYTLRGHTEWVGTVK 443
               GH+  +  L        +VS S D T +VW V     +    Y +   T+ V  V 
Sbjct: 217 GIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAVGAERMQEEAVYDVH-QTKSVWAVD 275

Query: 444 LHPKSFTCFSGSDDTTIRMWDI 465
           +        +  +D  +R+ D+
Sbjct: 276 VQEDDMVAVTAGNDGRLRLVDL 297

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 8/72 (11%)

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI----AADNFRIVSGAHDKTVKVWDLQSG 589
           SCS D +I++W + TG+ V   +GH   IWD+     AD  ++VS + D T +VW + + 
Sbjct: 198 SCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFLRVAD--KLVSVSEDCTCRVWAVGAE 255

Query: 590 KCIH--TFDSHQ 599
           +      +D HQ
Sbjct: 256 RMQEEAVYDVHQ 267

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 3/103 (2%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS--VDSYKKIIVSGSADKTVKVWH 423
           D   +  G++   + VW   TGA V    GH  S+    V    +++ S S D++++VW 
Sbjct: 150 DAVYVCAGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWS 209

Query: 424 VESRTCYTLR-GHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           +E+     +  GHT  +  ++    +    S S+D T R+W +
Sbjct: 210 LETGEQVGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAV 252

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 541 IKLWEVRTGKCVRTHFGHVEGIW-DIAADNFRIV-SGAHDKTVKVWDLQSGKCIHTFDSH 598
           + +WE+ TG  V+   GH   I+  + +D+ R+V S + D++++VW L++G+ +     H
Sbjct: 163 VVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAWGH 222

Query: 599 QAPI 602
            A I
Sbjct: 223 TARI 226

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 308 AHIQEFKGHMDGVLS--LQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF 365
           A +Q  +GH   +    +  + RL+ + S D ++ +W L TG+ V    GH   +  + F
Sbjct: 172 AVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRF 231

Query: 366 --DGQKLITGSLDRMIRVW 382
                KL++ S D   RVW
Sbjct: 232 LRVADKLVSVSEDCTCRVW 250

>Scas_605.18
          Length = 424

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/261 (20%), Positives = 95/261 (36%), Gaps = 47/261 (18%)

Query: 353 LTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS--VDSYKK 408
           L GH + +    +  D + +++ S D  + +W+  +G    A P  S  VLS  +     
Sbjct: 87  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTASGLKRNAIPLDSQWVLSCALSPSGN 146

Query: 409 IIVSGSADKTVKVWHV------ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
           +  S   +    ++ V      +       +GHT ++  ++    S    + S D T  +
Sbjct: 147 LAASAGLNNNCTIYRVSKENRVQQNVVSIFKGHTCYISDIEFLDNSHI-ITSSGDMTCAL 205

Query: 463 WDIRSNTCVKVFRGHVGQVQKV-LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSA 521
           WDI     V+ +  H+G V  + LP                PP  +  T  +        
Sbjct: 206 WDIPKAKRVREYADHLGDVLALALP----------------PPSADENTGANI------- 242

Query: 522 LDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDK 579
                       SC  D    +W+ RT   V+  F     +  I    D   IV+G  D 
Sbjct: 243 ----------FASCGSDGYTYIWDTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGGDDG 292

Query: 580 TVKVWDLQSGKCIHTFDSHQA 600
            + ++DL+S   I ++   Q 
Sbjct: 293 VINMFDLRSDCAIASYSLQQG 313

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 105/259 (40%), Gaps = 32/259 (12%)

Query: 348 KLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--- 403
            +V    GH   +  I F D   +IT S D    +W+      V  Y  H   VL++   
Sbjct: 171 NVVSIFKGHTCYISDIEFLDNSHIITSSGDMTCALWDIPKAKRVREYADHLGDVLALALP 230

Query: 404 ------DSYKKIIVSGSADKTVKVWHVESRTCYTLR---GHTEWVGTVKLHPKSFTCFSG 454
                 ++   I  S  +D    +W  ++RT   ++        V  ++      +  +G
Sbjct: 231 PPSADENTGANIFASCGSDGYTYIW--DTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTG 288

Query: 455 SDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDP 514
            DD  I M+D+RS+  +  +    G +QK +      + N+   R S  P++  +TA   
Sbjct: 289 GDDGVINMFDLRSDCAIASYSLQQG-IQKEIRDPTYMSSNMEYSRGS--PQSPISTAISS 345

Query: 515 PDGQLSALDD----SLPYPSH---LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI-- 565
                S LD+    SL + +    + +C  D    +W+V   + V    GH   +  +  
Sbjct: 346 -----SYLDNQGVVSLDFSNSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRT 400

Query: 566 AADNFRIVSGAHDKTVKVW 584
           + D   + +G+ D T+++W
Sbjct: 401 SPDGLGVCTGSWDSTMRIW 419

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 6/73 (8%)

Query: 319 GVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGS 374
           GV+SL F+   RL+F    D    IWD+   ++V +L GH + V ++    DG  + TGS
Sbjct: 352 GVVSLDFSNSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGS 411

Query: 375 LDRMIRVW--NYV 385
            D  +R+W  NY+
Sbjct: 412 WDSTMRIWSPNYM 424

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 73/190 (38%), Gaps = 45/190 (23%)

Query: 424 VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQK 483
           +  ++  TL+GH   +   +    S +  S S D  + +WD  S           G  + 
Sbjct: 79  INLQSTLTLKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTAS-----------GLKRN 127

Query: 484 VLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKL 543
            +PL   D++ +++   S             P G L+A            S  L+N   +
Sbjct: 128 AIPL---DSQWVLSCALS-------------PSGNLAA------------SAGLNNNCTI 159

Query: 544 WEV----RTGKCVRTHF-GHVEGIWDIA-ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDS 597
           + V    R  + V + F GH   I DI   DN  I++ + D T  +WD+   K +  +  
Sbjct: 160 YRVSKENRVQQNVVSIFKGHTCYISDIEFLDNSHIITSSGDMTCALWDIPKAKRVREYAD 219

Query: 598 HQAPITCVGI 607
           H   +  + +
Sbjct: 220 HLGDVLALAL 229

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 41/100 (41%), Gaps = 12/100 (12%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA-----ADNFR----IVSGAHDKT 580
           SH+++ S D T  LW++   K VR +  H+  +  +A     AD         S   D  
Sbjct: 192 SHIITSSGDMTCALWDIPKAKRVREYADHLGDVLALALPPPSADENTGANIFASCGSDGY 251

Query: 581 VKVWDLQSGKCIHTFDSHQAPITCVGI---GDSEFVSGDE 617
             +WD ++   +  F +    +  +     G+S    GD+
Sbjct: 252 TYIWDTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGGDD 291

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 75/179 (41%), Gaps = 26/179 (14%)

Query: 305 KGTAHIQEFKGHMDGVLSLQFN---YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK 361
           K    I  F+GH   VL   F+    R+L +GS D  + +W+                + 
Sbjct: 69  KAPDQIPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWE----------------IP 112

Query: 362 AIY-FDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVK 420
           A Y F   +   G+++ +  V  ++TG       GH   VL   + + ++ S S D TV+
Sbjct: 113 ATYSFHNAQDEDGNVEHVAPV-KFLTGHQRKV--GH---VLYHPTAQGVLASSSLDHTVR 166

Query: 421 VWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           +W+VE  T   +  H + V ++          +   D  +R+WDIR    V    GH G
Sbjct: 167 LWNVEQGTNPIVLTHPDMVTSMSFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSG 225

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 72/188 (38%), Gaps = 34/188 (18%)

Query: 432 LRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTIL 490
            RGHT  V      P       SGSDD  I +W+I +       +   G V+ V P+  L
Sbjct: 77  FRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPVKFL 136

Query: 491 DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSH---LLSCSLDNTIKLWEVR 547
                                     G    +   L +P+    L S SLD+T++LW V 
Sbjct: 137 -------------------------TGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVE 171

Query: 548 TG--KCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPIT-- 603
            G    V TH   V  +   +     + +   DK ++VWD++ G+ +     H  P    
Sbjct: 172 QGTNPIVLTHPDMVTSM-SFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSGPKNQR 230

Query: 604 CVGIGDSE 611
            V +G+S+
Sbjct: 231 VVWLGNSD 238

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 54/133 (40%), Gaps = 16/133 (12%)

Query: 316 HMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHR--DGVKAIYF-DGQKL 370
           H D V S+ F+Y    L T   D  + +WD+  G++V    GH      + ++  +  +L
Sbjct: 181 HPDMVTSMSFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSGPKNQRVVWLGNSDRL 240

Query: 371 ITGSL----DRMIRVW---NYVTGACVAAYPGHSDSVLSV----DSYKKIIVSGSADKTV 419
            T       DR I VW   N   G     Y     S + +    DS K + V+G  D  +
Sbjct: 241 ATTGFSKLSDRQIAVWDAFNLEKGQLGGFYNVDQSSGILMPFYDDSNKILYVAGKGDGNI 300

Query: 420 KVWHVESRTCYTL 432
           + +  +    Y L
Sbjct: 301 RYYEFQDDELYEL 313

>Scas_680.11
          Length = 347

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 2/68 (2%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF--RIVSGAHDKTVKVWDLQSG 589
           L SCS DN   +W    G+ + T  GH   IW I  D F    V+G+ D ++K+W +++G
Sbjct: 25  LFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVETG 84

Query: 590 KCIHTFDS 597
           + ++++DS
Sbjct: 85  ENVYSWDS 92

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 353 LTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS--VDSYKK 408
           L GH   +  + +  +G  L + S D    VW  V G  +    GH+ ++ S  VD + +
Sbjct: 6   LMGHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTE 65

Query: 409 IIVSGSADKTVKVWHVES 426
             V+GSAD ++K+W VE+
Sbjct: 66  YCVTGSADYSIKMWKVET 83

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 315 GHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG--QKL 370
           GH   +  +++N    LLF+ S D+  ++W    G+ +  L GH   + +I  D   +  
Sbjct: 8   GHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYC 67

Query: 371 ITGSLDRMIRVWNYVTGACVAAY 393
           +TGS D  I++W   TG  V ++
Sbjct: 68  VTGSADYSIKMWKVETGENVYSW 90

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 1/64 (1%)

Query: 409 IIVSGSADKTVKVWH-VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
           ++ S S D    VW+ V      TL GH   + ++ +   +  C +GS D +I+MW + +
Sbjct: 24  LLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVET 83

Query: 468 NTCV 471
              V
Sbjct: 84  GENV 87

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 78/167 (46%), Gaps = 18/167 (10%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           IQE  GH   V SL F  +  L+ T   D+   IWD+ +GK +  L GH   + ++ +  
Sbjct: 300 IQE--GHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQ 357

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVW 422
           +G +L +GS D  I+VW+      V     H+  V  V   K+    +VS   DK V ++
Sbjct: 358 NGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNKQNGGYLVSSGYDKKVNIF 417

Query: 423 H----VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           +    ++ R   +L GH + V ++ +       +S   D ++  W +
Sbjct: 418 NDGNWIKER---SLEGHLDKVMSIDIVGPDI--YSAGWDRSVNKWGV 459

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 63/137 (45%), Gaps = 13/137 (9%)

Query: 331 FTGS--YDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVT 386
           F GS  +D T  + D      +    GH   V ++ F  DG  + T  LD +  +W+  +
Sbjct: 277 FIGSTSFDKTWILIDTVKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRS 336

Query: 387 GACVAAYPGHSDSVLSVD----SYKKIIVSGSADKTVKVWHVESR-TCYTLRGHTEWVGT 441
           G  + +  GHS  + SVD     Y+  + SGS D T+KVW +  +    T+  H   V  
Sbjct: 337 GKNIMSLQGHSKPIYSVDWSQNGYQ--LASGSGDGTIKVWDIRKKGNVETILAHNSIVSQ 394

Query: 442 VKLHPKS--FTCFSGSD 456
           VK + ++  +   SG D
Sbjct: 395 VKFNKQNGGYLVSSGYD 411

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 46/78 (58%), Gaps = 2/78 (2%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNFRIVSGAHDKTVKVWDLQ 587
           S + +  LD    +W++R+GK + +  GH + I+  D + + +++ SG+ D T+KVWD++
Sbjct: 318 SLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIR 377

Query: 588 SGKCIHTFDSHQAPITCV 605
               + T  +H + ++ V
Sbjct: 378 KKGNVETILAHNSIVSQV 395

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 3/114 (2%)

Query: 374 SLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVES-RTCY 430
           S D+   + + V  A +    GHS  V S+  +    ++ +   D    +W + S +   
Sbjct: 282 SFDKTWILIDTVKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIM 341

Query: 431 TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
           +L+GH++ + +V      +   SGS D TI++WDIR    V+    H   V +V
Sbjct: 342 SLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQV 395

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 34/81 (41%), Gaps = 2/81 (2%)

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVW 584
           P  S + S S D T  L +      +    GH   ++ ++   D   + +   D    +W
Sbjct: 273 PCNSFIGSTSFDKTWILIDTVKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIW 332

Query: 585 DLQSGKCIHTFDSHQAPITCV 605
           D++SGK I +   H  PI  V
Sbjct: 333 DIRSGKNIMSLQGHSKPIYSV 353

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 98/250 (39%), Gaps = 32/250 (12%)

Query: 348 KLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS--V 403
           K V  L GH + V +  +  D + +++ S D  + +W+  TG    A P HS  VLS  +
Sbjct: 118 KPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAI 177

Query: 404 DSYKKIIVSGSADKTVKVWHV------ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDD 457
                ++ S   D    ++ V      +       +GHT ++  ++    + +  + S D
Sbjct: 178 CPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDN-SILTASGD 236

Query: 458 TTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDG 517
            T  +WDI  +  +  F  H+G    VL L+   TE            N    A    DG
Sbjct: 237 MTCALWDITKSKRINEFADHLGD---VLSLSAAPTET---------EGNGNVFASGGSDG 284

Query: 518 QLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEG---IWDIAAD----NF 570
            L   D  +P        S  +  K+   R G  + T  G  +G   ++D+ +D    N+
Sbjct: 285 YLYIWDKRVPTSVQSFFVSDSDVSKVKFFRNGNTIAT--GSDDGCTNLYDLRSDCRIANY 342

Query: 571 RIVSGAHDKT 580
            +    H  T
Sbjct: 343 SLSRSIHGAT 352

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 319 GVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGS 374
           GV+S+ F+   RLL+    +   A+WDL  G+++ +L GH D +  +    DG  + TGS
Sbjct: 395 GVISMDFSRSGRLLYVSYTEFGCAVWDLVKGEIIGKLDGHSDRISGVATSPDGLAICTGS 454

Query: 375 LDRMIRVWN 383
            D  ++VW+
Sbjct: 455 WDMTMKVWS 463

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 71/349 (20%), Positives = 123/349 (35%), Gaps = 80/349 (22%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATG-------------------- 347
           +   KGH + V S ++  + R + + S D  + +WD ATG                    
Sbjct: 120 VTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAICP 179

Query: 348 ---------------------------KLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMI 379
                                       +V    GH   +  I F D   ++T S D   
Sbjct: 180 NGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDNSILTASGDMTC 239

Query: 380 RVWNYVTGACVAAYPGHSDSVLSVDSYK-------KIIVSGSADKTVKVWHVESRTCY-T 431
            +W+      +  +  H   VLS+ +          +  SG +D  + +W     T   +
Sbjct: 240 ALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLYIWDKRVPTSVQS 299

Query: 432 LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN------TCVKVFRGHVGQVQKVL 485
                  V  VK      T  +GSDD    ++D+RS+      +  +   G     Q+  
Sbjct: 300 FFVSDSDVSKVKFFRNGNTIATGSDDGCTNLYDLRSDCRIANYSLSRSIHGATPVQQQTY 359

Query: 486 PLTILDTENLVTDRTSDPPRNEA--TTAQDPPDGQ-LSALDDS----LPYPSHL-LSCSL 537
            ++ +D            P + A  T +    D Q + ++D S    L Y S+    C+ 
Sbjct: 360 IMSNMDYTAPSGTLARASPYSPAIGTVSSSFIDNQGVISMDFSRSGRLLYVSYTEFGCA- 418

Query: 538 DNTIKLWEVRTGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVW 584
                +W++  G+ +    GH + I  +A   D   I +G+ D T+KVW
Sbjct: 419 -----VWDLVKGEIIGKLDGHSDRISGVATSPDGLAICTGSWDMTMKVW 462

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 12/125 (9%)

Query: 355 GHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK------- 407
            H   VK +    + L++GS D  IR+++      +     H  S+ ++   K       
Sbjct: 39  AHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQEPK 98

Query: 408 ----KIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
               K ++S S D  + VW V+    + TL+GHT  +  + +HP +    S S+D +IR+
Sbjct: 99  STSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRL 158

Query: 463 WDIRS 467
           W++ +
Sbjct: 159 WNLMT 163

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 13/128 (10%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF---- 365
           I  F+ H   V  L  + R L +GS D  + I+DL   K +  L  H+  +  + F    
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVS 93

Query: 366 -------DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSAD 416
                   G+ L++ S D  I VW            GH+  +  +D +   +++ S S D
Sbjct: 94  DQEPKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSED 153

Query: 417 KTVKVWHV 424
            ++++W++
Sbjct: 154 HSIRLWNL 161

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 10/99 (10%)

Query: 393 YPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKL------H 445
           +  HS SV  +D  K+ +VSGS D+ ++++ ++ R    TL  H   +  +K        
Sbjct: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQE 96

Query: 446 PKSFT---CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
           PKS +     S S+D  I +W ++        +GH  ++
Sbjct: 97  PKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARI 135

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 55/138 (39%), Gaps = 32/138 (23%)

Query: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512
           SGS+D  IR++D++    +     H G +            NL   + SD         Q
Sbjct: 56  SGSNDEHIRIYDLQKRKELGTLLAHQGSIT-----------NLKFSKVSD---------Q 95

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNF 570
           +P                 LLS S DN I +W V+  +   T  GH   I   DI   N 
Sbjct: 96  EPKSTS----------GKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNR 145

Query: 571 RIVSGAHDKTVKVWDLQS 588
            + S + D ++++W+L +
Sbjct: 146 VVASVSEDHSIRLWNLMT 163

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 23/32 (71%)

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPIT 603
           +VSG++D+ ++++DLQ  K + T  +HQ  IT
Sbjct: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSIT 85

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 71/178 (39%), Gaps = 24/178 (13%)

Query: 305 KGTAHIQEFKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK 361
           K    +  F+GH   VL   F   N   + +GS DS + IWD+       +   H D   
Sbjct: 69  KAPDQVPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPEN---YKFHDHVDE-- 123

Query: 362 AIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKV 421
               DG+ +        I+   ++TG       GH   VL     + ++ S S D TVK+
Sbjct: 124 ----DGEPI-------DIKPVKFLTGHARKV--GH---VLYHPVAENVLASSSGDYTVKL 167

Query: 422 WHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           W+VE+        H + V ++          + + D  +R+W+IR    V     H G
Sbjct: 168 WNVETGKDMITLKHPDMVTSMSFSYDGNYLATVARDKKLRVWNIREEKIVSEGPAHTG 225

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 69/176 (39%), Gaps = 38/176 (21%)

Query: 432 LRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHV---GQVQKVLPL 487
            RGHT  V      P       SGSDD+ I +WDI  N     F  HV   G+   + P+
Sbjct: 77  FRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYK---FHDHVDEDGEPIDIKPV 133

Query: 488 TILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYP---SHLLSCSLDNTIKLW 544
             L                          G    +   L +P   + L S S D T+KLW
Sbjct: 134 KFLT-------------------------GHARKVGHVLYHPVAENVLASSSGDYTVKLW 168

Query: 545 EVRTGKCVRT--HFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSH 598
            V TGK + T  H   V  +   + D   + + A DK ++VW+++  K +    +H
Sbjct: 169 NVETGKDMITLKHPDMVTSM-SFSYDGNYLATVARDKKLRVWNIREEKIVSEGPAH 223

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 67/155 (43%), Gaps = 24/155 (15%)

Query: 331 FTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG--QKLITGSLDRMIRVWNYVTG- 387
           F GS + ++ I+++ +G L ++   H+  V  I  DG  +K+++  LD ++  +++    
Sbjct: 476 FIGSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKST 535

Query: 388 --------ACVAAYPGHSDS---VLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHT 436
                   A + A   H  S    L++D    +++            V  R    L GH+
Sbjct: 536 LLGKLKLDAPITAMVYHRSSDLFALALDDLSIVVIDA----------VTQRVVRQLWGHS 585

Query: 437 EWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCV 471
             +      P+     S S D+TIR WD+ +  C+
Sbjct: 586 NRITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCI 620

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 530 SHLLSCSLDN-TIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDL 586
           S L + +LD+ +I + +  T + VR  +GH   I  +D + +   IVS + D T++ WDL
Sbjct: 555 SDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTWDL 614

Query: 587 QSGKCI 592
            +G CI
Sbjct: 615 PTGGCI 620

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 85/243 (34%), Gaps = 50/243 (20%)

Query: 373 GSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCY 430
           GS +  I ++N  +G     Y  H  +V  +S+D   + +VS   D  V  +     T  
Sbjct: 478 GSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKSTLL 537

Query: 431 TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTIL 490
                   +  +  H  S       DD +I + D  +   V+   GH             
Sbjct: 538 GKLKLDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGH------------- 584

Query: 491 DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGK 550
                          N  T     P+G+             ++S SLD+TI+ W++ TG 
Sbjct: 585 --------------SNRITAFDFSPEGRW------------IVSASLDSTIRTWDLPTGG 618

Query: 551 CVRTHFGHVEGIW-DIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGD 609
           C       ++GI  D  A N +  S   D         +G CI T  +    ++   I +
Sbjct: 619 C-------IDGIIVDNVATNVKF-SPNGDLLATTHVTGNGICIWTNRAQFKTVSTRTIDE 670

Query: 610 SEF 612
           SEF
Sbjct: 671 SEF 673

>KLLA0F16038g complement(1487475..1490063) weakly similar to
           ca|CA1657|IPF16022 Candida albicans unknown function,
           hypothetical start
          Length = 862

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 8/112 (7%)

Query: 321 LSLQFNYRLLFTGSYDSTVAIWDL---ATGKLVRRLTGHRDGVKAIYF-----DGQKLIT 372
           L LQ     +     D T+ I+D    +T +L+R L    DG+   +F       Q L +
Sbjct: 607 LRLQLTNSDIIVSRSDKTMQIFDKTSNSTPRLLRLLDDQGDGILVNHFYVNADSDQILCS 666

Query: 373 GSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHV 424
            SLD+ IR ++Y TG C+  Y  H+D V+ + +     V+ + +  +  W +
Sbjct: 667 SSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEI 718

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 95/219 (43%), Gaps = 35/219 (15%)

Query: 384 YVTGACVAAYPGHSDSVLSVDSYKK----IIVSGSADKTVKVWHV---ESRTCYTLRGHT 436
           Y    C      HS ++  +  Y+K    I+++ S D+T+    +   E   C T++ + 
Sbjct: 499 YKDNVCEYQSKVHSAAINGIQIYEKDAFKIVITISRDRTMNFIELRAGEWNICETVKDNK 558

Query: 437 EWVGTVKLHPKSFTCFSGSDDTTIRMW--DIRSNTCVKVFRGHVGQVQKV-LPLTILDTE 493
             +  ++L       ++ S D T+  +  DI  NT + V +  +  V+   L L + +++
Sbjct: 559 GNI--IQLEMCDNKLYTISSDRTVSCYRIDIVDNT-LNVSKETILSVKNSPLRLQLTNSD 615

Query: 494 NLVT---------DRTSDPPRNEATTAQDPPDGQL------SALDDSLPYPSHLLSCSLD 538
            +V+         D+TS+          D  DG L      +A  D +     L S SLD
Sbjct: 616 IIVSRSDKTMQIFDKTSNSTPRLLRLLDDQGDGILVNHFYVNADSDQI-----LCSSSLD 670

Query: 539 NTIKLWEVRTGKCVRTHFGHVEGIWDI--AADNFRIVSG 575
            TI+ +   TGKC+  ++ H + +  +   A+ F  V+G
Sbjct: 671 KTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTG 709

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 565 IAADNFRIV-SGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVS 614
           + AD+ +I+ S + DKT++ +   +GKC++ + +H  P+  +    ++FV+
Sbjct: 656 VNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVT 706

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 111/291 (38%), Gaps = 58/291 (19%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTG 387
           L TG  +  + +W    G L      HR  V +I +  D   ++T  +D +  VWN +TG
Sbjct: 222 LITGVENGELRMWSFR-GILQNVFNFHRSPVVSIEWNADSTHVLTSDVDNITIVWNALTG 280

Query: 388 ACVAAYP---GHSDSVLSVD----SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVG 440
             +  +       +  L +D       K ++ G     +     ES+    L GHT+ + 
Sbjct: 281 TALQHFDLKDTTGNESLGIDVEWIETDKFVIPGLQGSILVFSIGESKPIGKLVGHTKTLT 340

Query: 441 TVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRT 500
            +  +  +    S SDD T+R W   +      F GH                       
Sbjct: 341 VLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYGHT---------------------- 378

Query: 501 SDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVE 560
                 ++ T  D        LDD       L+S S+D ++++W V+    V      V+
Sbjct: 379 ------QSITYAD-------WLDD-----DRLISTSMDGSVRVWSVKQNALV--GLSVVD 418

Query: 561 GI----WDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
           G+      +++D  +  +G  D  V V++++  K +   D+ + PI  V I
Sbjct: 419 GVPIFCGTLSSDKQKFATGTLDGEVSVYNVK--KLLEVLDADEKPIGPVRI 467

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 5/121 (4%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK-AIYFD 366
           I +  GH   +  L +N   +LL + S D T+  W            GH   +  A + D
Sbjct: 329 IGKLVGHTKTLTVLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSITYADWLD 388

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVL--SVDSYKKIIVSGSADKTVKVWHV 424
             +LI+ S+D  +RVW+    A V         +   ++ S K+   +G+ D  V V++V
Sbjct: 389 DDRLISTSMDGSVRVWSVKQNALVGLSVVDGVPIFCGTLSSDKQKFATGTLDGEVSVYNV 448

Query: 425 E 425
           +
Sbjct: 449 K 449

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 62/125 (49%), Gaps = 13/125 (10%)

Query: 310 IQEFKGHMDGVLSLQFN---YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF- 365
           ++   GH   V  L F+     +L + S D TV IWD++  + V+    H D V ++ F 
Sbjct: 145 VRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEE-VKFTLKHPDMVTSMSFS 203

Query: 366 -DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDS----VLSVDSYKKIIVSGS---ADK 417
            DG+ L+T S D+ +RVW+      V+  P HS +    V+ +    K+  +G    +D+
Sbjct: 204 YDGKHLVTVSRDKKLRVWDVRAEKIVSEGPAHSGAKNQRVVWLGDTDKVATTGFSRLSDR 263

Query: 418 TVKVW 422
            + VW
Sbjct: 264 QIGVW 268

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 78/185 (42%), Gaps = 37/185 (20%)

Query: 313 FKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATG----------------KLVRRL 353
           F+GH   VL   F   N  ++ +GS D  + IW++                   K VR L
Sbjct: 89  FRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRML 148

Query: 354 TGHRDGVKAIYFD---GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD-SYK-K 408
           +GH   V  + F       L + SLD  +++W+ ++   V     H D V S+  SY  K
Sbjct: 149 SGHSRKVGHLLFHPLAENILASSSLDYTVKIWD-ISQEEVKFTLKHPDMVTSMSFSYDGK 207

Query: 409 IIVSGSADKTVKVWHVESRTCYT--------LRGHTEWVG-TVKLHPKSFTCFSGSDDTT 459
            +V+ S DK ++VW V +    +              W+G T K+   + T FS   D  
Sbjct: 208 HLVTVSRDKKLRVWDVRAEKIVSEGPAHSGAKNQRVVWLGDTDKV---ATTGFSRLSDRQ 264

Query: 460 IRMWD 464
           I +WD
Sbjct: 265 IGVWD 269

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 79/191 (41%), Gaps = 34/191 (17%)

Query: 432 LRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTIL 490
            RGHT  V      P       SGSDD  I +W+I  +  +  +    G  + + P+ +L
Sbjct: 89  FRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRML 148

Query: 491 DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYP---SHLLSCSLDNTIKLWEVR 547
                                     G    +   L +P   + L S SLD T+K+W++ 
Sbjct: 149 S-------------------------GHSRKVGHLLFHPLAENILASSSLDYTVKIWDI- 182

Query: 548 TGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPIT-- 603
           + + V+    H + +     + D   +V+ + DK ++VWD+++ K +    +H       
Sbjct: 183 SQEEVKFTLKHPDMVTSMSFSYDGKHLVTVSRDKKLRVWDVRAEKIVSEGPAHSGAKNQR 242

Query: 604 CVGIGDSEFVS 614
            V +GD++ V+
Sbjct: 243 VVWLGDTDKVA 253

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 82/253 (32%), Gaps = 95/253 (37%)

Query: 382 WNYVTGACVAAYP---------------GHSDSVLSVDSY---KKIIVSGSADKTVKVWH 423
           WN   G   A  P               GH+  VL  D       I+ SGS D  + +W 
Sbjct: 63  WNSSGGGAFAVIPVKEVGKIPDQVPLFRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWE 122

Query: 424 V-----------------ESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSD-DTTIRMWDI 465
           +                 + +    L GH+  VG +  HP +    + S  D T+++WDI
Sbjct: 123 IPEDYGLHEYVDEEGNPKDLKPVRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDI 182

Query: 466 RSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDS 525
            S   VK    H   V                           T+     DG+       
Sbjct: 183 -SQEEVKFTLKHPDMV---------------------------TSMSFSYDGK------- 207

Query: 526 LPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIV------------ 573
                HL++ S D  +++W+VR  K V       EG     A N R+V            
Sbjct: 208 -----HLVTVSRDKKLRVWDVRAEKIVS------EGPAHSGAKNQRVVWLGDTDKVATTG 256

Query: 574 -SGAHDKTVKVWD 585
            S   D+ + VWD
Sbjct: 257 FSRLSDRQIGVWD 269

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 78/172 (45%), Gaps = 15/172 (8%)

Query: 308 AHIQEFKGHMDGVLSLQFNYRL---LFTGSYDSTVAIWDLATGKLVRR-LTGHRDGVKAI 363
           A +     H +    L FN  +   L +GS D+TVA+WD+   K  +  LT H D V  +
Sbjct: 177 AQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDV 236

Query: 364 ---YFDGQKLITGSLDRMIRVWNY-VTGACVAAYPGHSD-SVLSVDSY-KKIIVSGSADK 417
               F+     T S D+ ++V +  V    V   P  S  + LS   + + ++ +   D 
Sbjct: 237 KWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDS 296

Query: 418 TVKVWHVE--SRTCYTLRGHTEWVGTVKLHPKS--FTCFSGSDDTTIRMWDI 465
            + ++ +   S   + + GH + V TV+  P +    C SGSD   I +WD+
Sbjct: 297 QIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDL 347

>Kwal_34.15818
          Length = 349

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/255 (21%), Positives = 113/255 (44%), Gaps = 35/255 (13%)

Query: 353 LTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS--VDSYKK 408
           L GH   +  + F  +G  + T + D +  VW  + G  +  + GH  ++ S  VD + +
Sbjct: 6   LKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQ 65

Query: 409 IIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
             V+GSAD ++K+W V+  T  +T +  T         P     FS S D  + + D   
Sbjct: 66  YAVTGSADFSIKLWKVQDGTNVFTWKTKT---------PVRRVQFSPSGDKILAVLD--- 113

Query: 468 NTCVKVFRGHVGQVQKVLPLTIL---DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDD 524
                   G +G    V   T+    +T+++V D + +P  N  T        +++A+  
Sbjct: 114 --------GVMGYPGSVTVYTVRRDPETKDIV-DISEEPTFNILTR----EGFEIAAVAA 160

Query: 525 SLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI--AADNFRIVSGAHDKTVK 582
                +++++   D  +  +E  +G+ + +   H + + DI  + D    ++ + D   K
Sbjct: 161 WSFNDTYIVAGHKDGRVSKYEGHSGEYIDSAALHTQNVSDIQFSPDGTYFITSSRDSAAK 220

Query: 583 VWDLQSGKCIHTFDS 597
           + D ++ + + T+++
Sbjct: 221 LVDTETLEVLKTYET 235

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 102/263 (38%), Gaps = 55/263 (20%)

Query: 313 FKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQ 368
            KGH   +  ++FN    L+FT + D+  ++W    G+ +    GH+  + +I  D   Q
Sbjct: 6   LKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQ 65

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVW-----H 423
             +TGS D  I++W    G  V  +   +         +++  S S DK + V      +
Sbjct: 66  YAVTGSADFSIKLWKVQDGTNVFTWKTKT-------PVRRVQFSPSGDKILAVLDGVMGY 118

Query: 424 VESRTCYTLRGHTEWVGTVKLHPK-SFTCFS--GSDDTTIRMWDIRSNTC--------VK 472
             S T YT+R   E    V +  + +F   +  G +   +  W               V 
Sbjct: 119 PGSVTVYTVRRDPETKDIVDISEEPTFNILTREGFEIAAVAAWSFNDTYIVAGHKDGRVS 178

Query: 473 VFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHL 532
            + GH G+         +D+  L T   SD         Q  PDG            ++ 
Sbjct: 179 KYEGHSGE--------YIDSAALHTQNVSD--------IQFSPDG------------TYF 210

Query: 533 LSCSLDNTIKLWEVRTGKCVRTH 555
           ++ S D+  KL +  T + ++T+
Sbjct: 211 ITSSRDSAAKLVDTETLEVLKTY 233

>Scas_659.9
          Length = 475

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 54/123 (43%), Gaps = 28/123 (22%)

Query: 355 GHRDGVKAI---YFDGQKLITGSLDRMIRVWNY---------------VTGACVAAYPGH 396
           GHRDGV  I   Y +  KL TGS D +++ WN                +TG CV   P H
Sbjct: 65  GHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGLITGLCVT--PEH 122

Query: 397 SDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEW---VGTVKLHPKSFTCFS 453
               LS    +  ++S S DKTVK+W V S     L+   +     G +K +   F  F 
Sbjct: 123 ----LSKQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDF-AFQ 177

Query: 454 GSD 456
           G D
Sbjct: 178 GID 180

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 71/157 (45%), Gaps = 12/157 (7%)

Query: 318 DGVLSLQFNYR---LLFTGSYDSTVAIWDLATGKLVRRL--TGHRDGVKAIYFDGQKLIT 372
           D + +++FN     +L +   D+++ ++DL T    +++  T   + +     +    + 
Sbjct: 214 DNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVV 273

Query: 373 GSLDRMIRVWNYVTGA-CVAAYPGHSDSVLSVD--SYKKIIVSGSADKTVKVW---HVES 426
            + D     ++    +  +  +  H  +V+ VD       IV+GS DKT++++   H  S
Sbjct: 274 ANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHS 333

Query: 427 RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
           R  Y  +   + V  VK    +    SGSDD  +R+W
Sbjct: 334 REIYHTK-RMQHVFQVKFSMDAKYIVSGSDDGNVRLW 369

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 13/85 (15%)

Query: 395 GHSDSVLSV-DSYKKI--IVSGSADKTVKVWHVESRT--CYTLRGHTEWVGTVKLHPKSF 449
           GH D V  +  +YK +  + +GSAD  VK W++ +R   C + + H   +  + + P+  
Sbjct: 65  GHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELC-SFKAHYGLITGLCVTPEHL 123

Query: 450 T-------CFSGSDDTTIRMWDIRS 467
           +         S SDD T+++W + S
Sbjct: 124 SKQKNENFMLSCSDDKTVKLWSVNS 148

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 9/77 (11%)

Query: 313 FKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIY-----F 365
           FK H+  V+ + F+     + TGSYD T+ I++   G    R   H   ++ ++      
Sbjct: 295 FKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGH--SREIYHTKRMQHVFQVKFSM 352

Query: 366 DGQKLITGSLDRMIRVW 382
           D + +++GS D  +R+W
Sbjct: 353 DAKYIVSGSDDGNVRLW 369

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 396 HSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPK-SFTCFS 453
           H   +L  D S    +++ S DKTVK+WH+   T      H ++V  V+ HP      FS
Sbjct: 213 HLQDILDCDWSKNSFLLTASMDKTVKLWHINRTTSLKTFVHPDFVTCVRFHPHDDRFFFS 272

Query: 454 GSDDTTIRMWDIRSNTCVKVF 474
           G  D T+R W I      + F
Sbjct: 273 GCLDHTVRTWSILEGEVAEAF 293

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 2/69 (2%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRT--HFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQ 587
           S LL+ S+D T+KLW +     ++T  H   V  +     D+    SG  D TV+ W + 
Sbjct: 226 SFLLTASMDKTVKLWHINRTTSLKTFVHPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSIL 285

Query: 588 SGKCIHTFD 596
            G+    F+
Sbjct: 286 EGEVAEAFN 294

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 336 DSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACV 390
           D ++ + D  T K+VR+L GH + + A  F  DG+ L++ SLD  IR W+  TG+C+
Sbjct: 562 DLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCI 618

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 65/155 (41%), Gaps = 24/155 (15%)

Query: 331 FTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG--QKLITGSLDRMIRVWNYVTG- 387
           F GS +  + ++++ +G L ++   H+  V  +  DG  +K+++  LD +I  +++    
Sbjct: 474 FVGSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVSCGLDGIIGFYDFNESK 533

Query: 388 --------ACVAAYPGHSDS---VLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHT 436
                   A + +   H  S     ++D    ++V     K V+           L GH 
Sbjct: 534 YLGKLQMDAPITSMVYHRSSDLCAFALDDLSIVVVDTVTQKVVR----------QLWGHG 583

Query: 437 EWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCV 471
             +      P      S S D+TIR WD+ + +C+
Sbjct: 584 NRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCI 618

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 5/80 (6%)

Query: 518 QLSALDDSLPY--PSHLLSCSLDN-TIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRI 572
           Q+ A   S+ Y   S L + +LD+ +I + +  T K VR  +GH   I  +D + D   +
Sbjct: 539 QMDAPITSMVYHRSSDLCAFALDDLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDGRWL 598

Query: 573 VSGAHDKTVKVWDLQSGKCI 592
           VS + D T++ WDL +G CI
Sbjct: 599 VSASLDSTIRTWDLPTGSCI 618

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 9/54 (16%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK 361
           +++  GH + + +  F  + R L + S DST+  WDL TG  +       DGVK
Sbjct: 576 VRQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCI-------DGVK 622

>Scas_700.27*
          Length = 433

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 68/179 (37%), Gaps = 45/179 (25%)

Query: 420 KVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           K+W +E     T+  + E++  + +   +    +G D + +R+WDIR+   V    GH  
Sbjct: 195 KIWLLE----ITMATYHEYIQMIFILLLNLIATAGRD-SVVRLWDIRARVAVMTLIGHKN 249

Query: 480 QVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDN 539
            + KV                                         LP    ++SCS D 
Sbjct: 250 PINKV---------------------------------------HCLPVDPQIVSCSTDA 270

Query: 540 TIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRI-VSGAHDKTVKVWDLQSGKCIHTFDS 597
           TI+LW++  GK ++    H + + +IA       +S      ++ W L  G  +  F+S
Sbjct: 271 TIRLWDIVAGKSMKVITHHKKSVRNIAFHPTEFSMSSCSANDIRSWKLPEGGLLTNFNS 329

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 116/280 (41%), Gaps = 38/280 (13%)

Query: 337 STVAIWDLATGKLVRRLTGH-RDGVKAIYFDGQKLITGSLDRMIRVWN-------YVTGA 388
           +T+ I DLA GKL+  L  H  D  + + F    + T      IR+++       ++   
Sbjct: 143 TTIKICDLAKGKLLVTLACHIHDRNETLPFPND-IPTYFQPLNIRLYHAGTWKKIWLLEI 201

Query: 389 CVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPK 447
            +A Y  +   +  +     +I +   D  V++W + +R    TL GH   +  V   P 
Sbjct: 202 TMATYHEYIQMIFIL--LLNLIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPV 259

Query: 448 SFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNE 507
                S S D TIR+WDI +   +KV   H   V+ +       TE  ++  ++    N+
Sbjct: 260 DPQIVSCSTDATIRLWDIVAGKSMKVITHHKKSVRNI---AFHPTEFSMSSCSA----ND 312

Query: 508 ATTAQDPPDGQLSALDD---------SLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHF-- 556
             + + P  G L+  +          S+     L + S +  +  ++ ++G   ++    
Sbjct: 313 IRSWKLPEGGLLTNFNSDGLGIINTLSINQDDVLFAGSDNGMLSFYDYKSGHKYQSMMTK 372

Query: 557 ---GHVEGIWDIAADNF-----RIVSGAHDKTVKVWDLQS 588
              G +E    I    F     R+++G  DK++K+W + S
Sbjct: 373 EIPGSLESERGILCSTFDRTGLRLLTGETDKSIKIWSMDS 412

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 538 DNTIKLWEVRTGKCVRTHFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDLQSGKCIHTF 595
           D+ ++LW++R    V T  GH   I  +     + +IVS + D T+++WD+ +GK +   
Sbjct: 227 DSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDATIRLWDIVAGKSMKVI 286

Query: 596 DSHQAPITCVGIGDSEF 612
             H+  +  +    +EF
Sbjct: 287 THHKKSVRNIAFHPTEF 303

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 67/145 (46%), Gaps = 8/145 (5%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIY---FDGQKLITGSLDRMIRVWNYV 385
           L+ T   DS V +WD+     V  L GH++ +  ++    D Q +++ S D  IR+W+ V
Sbjct: 220 LIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQ-IVSCSTDATIRLWDIV 278

Query: 386 TGACVAAYPGHSDSVLSVDSY-KKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKL 444
            G  +     H  SV ++  +  +  +S  +   ++ W +      T   +++ +G +  
Sbjct: 279 AGKSMKVITHHKKSVRNIAFHPTEFSMSSCSANDIRSWKLPEGGLLT-NFNSDGLGIINT 337

Query: 445 HP--KSFTCFSGSDDTTIRMWDIRS 467
               +    F+GSD+  +  +D +S
Sbjct: 338 LSINQDDVLFAGSDNGMLSFYDYKS 362

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/147 (19%), Positives = 61/147 (41%), Gaps = 12/147 (8%)

Query: 334 SYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRM-IRVWNYVTGACVAA 392
           S D+T+ +WD+  GK ++ +T H+  V+ I F   +    S     IR W    G  +  
Sbjct: 267 STDATIRLWDIVAGKSMKVITHHKKSVRNIAFHPTEFSMSSCSANDIRSWKLPEGGLLTN 326

Query: 393 YPGHSDSVLSVDSYKK--IIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVK------- 443
           +      +++  S  +  ++ +GS +  +  +  +S   Y      E  G+++       
Sbjct: 327 FNSDGLGIINTLSINQDDVLFAGSDNGMLSFYDYKSGHKYQSMMTKEIPGSLESERGILC 386

Query: 444 --LHPKSFTCFSGSDDTTIRMWDIRSN 468
                      +G  D +I++W + S+
Sbjct: 387 STFDRTGLRLLTGETDKSIKIWSMDSD 413

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 329 LLFTGSYDSTVAIWDLATGK-----LVRRLTGHRDGVKAIY---FD--GQKLITGSLDRM 378
           +LF GS +  ++ +D  +G      + + + G  +  + I    FD  G +L+TG  D+ 
Sbjct: 345 VLFAGSDNGMLSFYDYKSGHKYQSMMTKEIPGSLESERGILCSTFDRTGLRLLTGETDKS 404

Query: 379 IRVWNYVTGACVAAYPG 395
           I++W+  + A     PG
Sbjct: 405 IKIWSMDSDATPETDPG 421

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 44/90 (48%), Gaps = 9/90 (10%)

Query: 523 DDSLPYPSHLLSCSLDNTIKLWEVRTGK-------CVRTHFGHVEGIWDIAADNFRIVSG 575
           +++LP+P+ + +      I+L+   T K        + T+  +++ I+ +  +   I + 
Sbjct: 167 NETLPFPNDIPTYFQPLNIRLYHAGTWKKIWLLEITMATYHEYIQMIFILLLN--LIATA 224

Query: 576 AHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
             D  V++WD+++   + T   H+ PI  V
Sbjct: 225 GRDSVVRLWDIRARVAVMTLIGHKNPINKV 254

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 336 DSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACV 390
           D ++ + D  T K+VR+L GH + V A  F  DG+ +++ SLD  IR W+  TG C+
Sbjct: 570 DLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCI 626

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 66/159 (41%), Gaps = 24/159 (15%)

Query: 331 FTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG--QKLITGSLDRMIRVWNYVTGA 388
           F GS +  + +++L +G   ++   H+  V  +  DG  +K+++  LD +I  +++   A
Sbjct: 482 FVGSSEGGIGVYNLQSGLQRKKYRLHKKAVTGVAIDGMNRKMVSCGLDGLIGFYDFTKSA 541

Query: 389 CVA-----------AYPGHSD-SVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHT 436
            +             Y   SD   +++D    +++     K V+           L GH+
Sbjct: 542 FLGKLQLDAPVTSMVYHRSSDLFAVALDDLSIVVIDAVTQKVVR----------QLWGHS 591

Query: 437 EWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFR 475
             V      P      S S D+TIR WD+ +  C+   R
Sbjct: 592 NRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGVR 630

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 5/80 (6%)

Query: 518 QLSALDDSLPY--PSHLLSCSLDN-TIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRI 572
           QL A   S+ Y   S L + +LD+ +I + +  T K VR  +GH   +  +D + D   I
Sbjct: 547 QLDAPVTSMVYHRSSDLFAVALDDLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWI 606

Query: 573 VSGAHDKTVKVWDLQSGKCI 592
           VS + D T++ WDL +G CI
Sbjct: 607 VSASLDSTIRTWDLPTGGCI 626

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 531 HLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVWDL 586
           +++SCS D +IKLW +++G+ + T +GH   IW +    ++ ++VS + D T +VWD+
Sbjct: 195 YVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDI 252

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 74/157 (47%), Gaps = 11/157 (7%)

Query: 320 VLSLQFNY---RLLFTGSYDSTVAIWDLATGKLVRRLTGHRD----GVKAIYFDGQKLIT 372
           +++ +FN+    +    SY+  +   D    + V+ + G R     G  +++ D +  I 
Sbjct: 96  IIAGEFNFDASTVFLLTSYNKVLCCNDQGEIRWVKAVYGERSILYSGSISVFSDTKVYIN 155

Query: 373 -GSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVES-RT 428
            G++   + +W+  +   V    GH  S+  V   K  + +VS S D+++K+W+++S   
Sbjct: 156 AGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGEL 215

Query: 429 CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
             T  GHT  +  +K         S S+D T R+WDI
Sbjct: 216 LSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDI 252

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 4/108 (3%)

Query: 396 HSDSVLSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFTCFSG 454
           +S S+      K  I +G+    V +W + S T  + L GH   +  V L        S 
Sbjct: 140 YSGSISVFSDTKVYINAGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSC 199

Query: 455 SDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD 502
           SDD +I++W+++S   +    GH  ++ +   L  +D +  V   + D
Sbjct: 200 SDDRSIKLWNLKSGELLSTGWGHTARIWQ---LKFIDNDTKVVSVSED 244

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 517 GQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNFRIVS 574
           G +S   D+  Y +   + ++   + +W++ +   V    GH   I+   ++ +   +VS
Sbjct: 142 GSISVFSDTKVYIN---AGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVS 198

Query: 575 GAHDKTVKVWDLQSGKCIHTFDSHQAPI 602
            + D+++K+W+L+SG+ + T   H A I
Sbjct: 199 CSDDRSIKLWNLKSGELLSTGWGHTARI 226

>Kwal_27.11126
          Length = 996

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 534 SCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVWDLQSGKC 591
           SCS D +IKLW++++G+ + T +GH   IW++    ++ +++S + D T +VWD+     
Sbjct: 198 SCSDDRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNT 257

Query: 592 IHTFDSHQAPI 602
           +     H+  +
Sbjct: 258 LSQASVHEGHL 268

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 63/140 (45%), Gaps = 3/140 (2%)

Query: 373 GSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVES-RTC 429
           G++   + VW+  +   +  +  H  ++  V + K  K   S S D+++K+W ++S +  
Sbjct: 157 GTVMDGVIVWDLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSDDRSIKLWDLKSGQLL 216

Query: 430 YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTI 489
            T  GHT  +  +          S S+D T R+WDI  +  +     H G + K +    
Sbjct: 217 STAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQASVHEGHLLKSVWGLD 276

Query: 490 LDTENLVTDRTSDPPRNEAT 509
           +D E ++   + +  R + T
Sbjct: 277 VDNERMIAATSGNDGRIKLT 296

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 12/100 (12%)

Query: 333 GSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-----DGQKLITGSLDRMIRVWNYVTG 387
           G+    V +WDL + + +   T H     AI+F     +G+   + S DR I++W+  +G
Sbjct: 157 GTVMDGVIVWDLESEQNLHHFTDHE---GAIFFVTASKNGKYAASCSDDRSIKLWDLKSG 213

Query: 388 ACVAAYPGHSD---SVLSVDSYKKIIVSGSADKTVKVWHV 424
             ++   GH+    ++L  D+  K+I S S D T +VW +
Sbjct: 214 QLLSTAWGHTARIWNLLFFDNDSKVI-SVSEDCTCRVWDI 252

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 53/101 (52%), Gaps = 8/101 (7%)

Query: 336 DSTVAIWDLATGKLVRRLTGHRDGV-KAIYFDG-QKLITGSLDRMIRVWNYV---TGACV 390
           D ++ +WDL +G+L+    GH   +   ++FD   K+I+ S D   RVW+     T +  
Sbjct: 202 DRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQA 261

Query: 391 AAYPGH-SDSV--LSVDSYKKIIVSGSADKTVKVWHVESRT 428
           + + GH   SV  L VD+ + I  +   D  +K+  +++++
Sbjct: 262 SVHEGHLLKSVWGLDVDNERMIAATSGNDGRIKLTDLKAKS 302

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 83/192 (43%), Gaps = 14/192 (7%)

Query: 283 TRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIW 342
           T  +R  K+++R+    E  + +   H QE  G     L    +   L +G  D+ V ++
Sbjct: 347 TSGSRDRKILHRDVRMPEPYFEQVETHTQEVCG-----LKWNTDENRLASGGNDNVVYVY 401

Query: 343 DLATGKLVRRLTGHRDGVKAIYFDGQK---LITG--SLDRMIRVWNYVTGACVAAYPGHS 397
           D  + K   +L  H   VKAI +   K   L TG  + D+ +++WN  T   +      S
Sbjct: 402 DGTSRKPTLKLAEHTAAVKAIAWSPHKRGILATGGGTADKKMKIWNVNTSTKLRDIDTGS 461

Query: 398 ---DSVLSVDSYKKIIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFTCFS 453
              + + S ++ + +   G +   + +W   S      L+GH+  V  + L     T  S
Sbjct: 462 QVCNMIWSKNTNELVTSHGYSRYNLTLWDYPSMEPVAILKGHSFRVLHLTLSADGTTVVS 521

Query: 454 GSDDTTIRMWDI 465
           G+ D T+R W +
Sbjct: 522 GAGDETLRYWKL 533

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 103/266 (38%), Gaps = 47/266 (17%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNY-VTGA 388
           L  G  +  V I+D+   K +R L+GH D V  + ++   L +GS DR I   +  +   
Sbjct: 306 LAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEP 365

Query: 389 CVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLH 445
                  H+  V  L  ++ +  + SG  D  V V+   SR     L  HT  V  +   
Sbjct: 366 YFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWS 425

Query: 446 PKS---FTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD 502
           P          G+ D  +++W++  NT  K              L  +DT + V +    
Sbjct: 426 PHKRGILATGGGTADKKMKIWNV--NTSTK--------------LRDIDTGSQVCNMIWS 469

Query: 503 PPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI 562
              NE  T+                Y  + L+        LW+  + + V    GH   +
Sbjct: 470 KNTNELVTSHG--------------YSRYNLT--------LWDYPSMEPVAILKGHSFRV 507

Query: 563 --WDIAADNFRIVSGAHDKTVKVWDL 586
               ++AD   +VSGA D+T++ W L
Sbjct: 508 LHLTLSADGTTVVSGAGDETLRYWKL 533

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 80/184 (43%), Gaps = 14/184 (7%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGK-LVRRLTGHRDGVKAIYF--D 366
           I+   GHMD V  L +N  +L +GS D  +   D+   +    ++  H   V  + +  D
Sbjct: 326 IRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEPYFEQVETHTQEVCGLKWNTD 385

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVS---GSADKTVKV 421
             +L +G  D ++ V++  +         H+ +V ++    +K+ I++   G+ADK +K+
Sbjct: 386 ENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWSPHKRGILATGGGTADKKMKI 445

Query: 422 WHVESRTCYTLRGHTEWVGTVKL----HPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
           W+V + T   LR          +    +        G     + +WD  S   V + +GH
Sbjct: 446 WNVNTST--KLRDIDTGSQVCNMIWSKNTNELVTSHGYSRYNLTLWDYPSMEPVAILKGH 503

Query: 478 VGQV 481
             +V
Sbjct: 504 SFRV 507

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 31/52 (59%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTV 581
           SHL     +  ++++++   KC+RT  GH++ +  ++ +N  + SG+ D+ +
Sbjct: 304 SHLAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDRKI 355

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 116/287 (40%), Gaps = 76/287 (26%)

Query: 339 VAIWDLATGKLVRRL-TGHRDGVKAIYFD---GQKLITGSLDRMIRVWNY---------- 384
           + ++D + G  + R    HR+ V  I  D   G  L+ GS  R   + N           
Sbjct: 29  IEVFDYSNGSSINRCHIFHRNKVHGISIDKTSGNVLVYGS--RSFSIVNINDLFSKSEVL 86

Query: 385 ----VTGACVAA--YPGHSDSVLSVDSYKKIIVSGSADKTVKVWHV---ESRTCYTLRGH 435
               +TG  + +  +  + + +  + SY ++++    + TVK  H    E    Y+    
Sbjct: 87  DQEKMTGEWIMSGEFSFNKEEIYLLTSYNRVLIIDPDNFTVKSTHFVEGERSILYS---- 142

Query: 436 TEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENL 495
               G++K+        +G+    I +W++ S   +   RGH G +  V           
Sbjct: 143 ----GSIKVLRHKVLVNAGTIMNGIIVWELDSKKKIHTLRGHEGSIFYV----------- 187

Query: 496 VTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTH 555
                        TT+ +   G+L            L SCS D +I +W++ +GK +   
Sbjct: 188 -------------TTSNN---GKL------------LASCSDDRSIIIWDMVSGKLLSRA 219

Query: 556 FGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCI--HTFDSH 598
           +GH   IW++    D+ +++S + D T +VW+ ++ +      F+SH
Sbjct: 220 WGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKNDELTIKDIFESH 266

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 63/131 (48%), Gaps = 11/131 (8%)

Query: 310 IQEFKGHMDGVL--SLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-- 365
           I   +GH   +   +   N +LL + S D ++ IWD+ +GKL+ R  GH   +  + F  
Sbjct: 174 IHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFFN 233

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVA--AYPGH-SDSVLSVDSYKK--IIVSGSADKTVK 420
           D  +LI+ S D   RVWNY          +  H + +V  VD  +   I +SG  D  +K
Sbjct: 234 DDTQLISVSEDCTCRVWNYKNDELTIKDIFESHLTKNVWGVDVEETNLIAISGGNDGRLK 293

Query: 421 VWHV--ESRTC 429
           V  +   +R+C
Sbjct: 294 VTELVPHNRSC 304

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 373 GSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVW-HVESRTC 429
           G++   I VW   +   +    GH  S+  V +    K++ S S D+++ +W  V  +  
Sbjct: 157 GTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLL 216

Query: 430 YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN--TCVKVFRGHV 478
               GHT  +  +K         S S+D T R+W+ +++  T   +F  H+
Sbjct: 217 SRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKNDELTIKDIFESHL 267

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 539 NTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF--RIVSGAHDKTVKVWDLQSGKCIHTFD 596
           N I +WE+ + K + T  GH   I+ +   N    + S + D+++ +WD+ SGK +    
Sbjct: 161 NGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAW 220

Query: 597 SHQAPI 602
            H A I
Sbjct: 221 GHTARI 226

>Kwal_26.7655
          Length = 743

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 393 YPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTC 451
           Y  H+  +L +D S    I++ S DKT ++WH +      +  H ++V   K HP     
Sbjct: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRF 327

Query: 452 F-SGSDDTTIRMWDIRSNTC 470
           F SG  D T+R+W I  N+ 
Sbjct: 328 FISGCLDHTLRLWSILDNSV 347

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 78/189 (41%), Gaps = 27/189 (14%)

Query: 313 FKGHMDGVLSLQFNYR-LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF---DGQ 368
           ++ H   +L L ++    + T S D T  +W     K ++  T H D V    F   D +
Sbjct: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDR 326

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK---KIIVSGSADKTVKVWHVE 425
             I+G LD  +R+W+ +  +    Y    D + ++D+     K   +G+ +  + + +  
Sbjct: 327 FFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKYTAAGTFNGHIIILYTR 385

Query: 426 S-RTCYTLRGHTEWVGTVKLHPKSFTCFSG-----------------SDDTTIRMWDIRS 467
                 T     +  GT K  P+S    +G                 S+D+ IR++ I+ 
Sbjct: 386 GLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKG 445

Query: 468 NTCVKVFRG 476
            + ++V +G
Sbjct: 446 QSLLEVLKG 454

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 79/188 (42%), Gaps = 24/188 (12%)

Query: 294 RERFKVESNWRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRL 353
           R +  + S W K T+ +   K   DG+         L +G  D+TV IWD    + +   
Sbjct: 334 RVKDHIVSTWEKHTSEVCGIKFRQDGLQ--------LASGGNDNTVMIWDTRQDEPLWVK 385

Query: 354 TGHRDGVKAIYF--DGQKLIT---GSLDRMIRVWNYVTGACVAAYPGHS--DSVLSVDSY 406
             H   VKAI +  D   L+    GSLDR I  WN  TGA + +    S   S+    SY
Sbjct: 386 RNHNAAVKAITWHPDVVNLLATGGGSLDRHIHFWNTTTGARIGSINTGSQVSSLHWGQSY 445

Query: 407 KK-------IIVSGSADKTVKVWHVES--RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDD 457
           +        +   GS D ++ +++ +S  +     + H   + + +L P   T  +   D
Sbjct: 446 EDSHMNREIVATGGSPDNSISIYNYDSKVKVAEITQAHESRIVSSQLSPDGTTIATVGGD 505

Query: 458 TTIRMWDI 465
             ++ + +
Sbjct: 506 ENLKFYRV 513

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 41/215 (19%), Positives = 82/215 (38%), Gaps = 40/215 (18%)

Query: 394 PGHSDSV-LSVDSY-KKIIVSGSADKTVKVWHVESRTCYTL-RGHTEWVGTVKLHPKSFT 450
           PG  D   L++ S+ KK +++ + D+++ +W+ E+     L    TE + +V        
Sbjct: 218 PGFQDDFYLNLLSWSKKNVLAIALDQSIYLWNGETGEVSLLTEFETETITSVVWSNDDCH 277

Query: 451 CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATT 510
              G DD    +WD+ + + V+  R  +G   ++     LDT   +  ++ +   N+   
Sbjct: 278 ISIGKDDGNTEIWDVETMSHVRTMRSSLGV--RICSQDWLDTVVCIGAKSGEIQVNDVRV 335

Query: 511 AQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF 570
                                      D+ +  WE  T +     F           D  
Sbjct: 336 K--------------------------DHIVSTWEKHTSEVCGIKFRQ---------DGL 360

Query: 571 RIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
           ++ SG +D TV +WD +  + +    +H A +  +
Sbjct: 361 QLASGGNDNTVMIWDTRQDEPLWVKRNHNAAVKAI 395

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 32/167 (19%), Positives = 67/167 (40%), Gaps = 5/167 (2%)

Query: 323 LQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIR 380
           L ++ + +   + D ++ +W+  TG++        + + ++ +  D   +  G  D    
Sbjct: 229 LSWSKKNVLAIALDQSIYLWNGETGEVSLLTEFETETITSVVWSNDDCHISIGKDDGNTE 288

Query: 381 VWNYVTGACVAAYPGH-SDSVLSVDSYKKIIVSGSADKTVKV--WHVESRTCYTLRGHTE 437
           +W+  T + V          + S D    ++  G+    ++V    V+     T   HT 
Sbjct: 289 IWDVETMSHVRTMRSSLGVRICSQDWLDTVVCIGAKSGEIQVNDVRVKDHIVSTWEKHTS 348

Query: 438 WVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484
            V  +K         SG +D T+ +WD R +  + V R H   V+ +
Sbjct: 349 EVCGIKFRQDGLQLASGGNDNTVMIWDTRQDEPLWVKRNHNAAVKAI 395

>Scas_615.11
          Length = 349

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 75/170 (44%), Gaps = 34/170 (20%)

Query: 328 RLLFTGSYDSTVAIW-------------------DLATGKLVRRLTGHRDGVKAIYF--D 366
            LL  GS+DSTV+IW                   +     L+  + GH + VK I +  D
Sbjct: 73  NLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHENEVKGIAWSHD 132

Query: 367 GQKLITGSLDRMIRVWNYVTGA----CVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVK 420
           G  L + S D+ + +W          C++    HS  V  V  + +  ++ S S D T++
Sbjct: 133 GALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIR 192

Query: 421 VW--HVESRTC-YTLRGH--TEWVGTVK--LHPKSFTCFSGSDDTTIRMW 463
           +W  + +   C   L GH  T W    +   + +S    SGSDD+T+R+W
Sbjct: 193 LWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 96/290 (33%), Gaps = 104/290 (35%)

Query: 348 KLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGA------------------- 388
           KL + L    D + ++ +    L TGS DR I++ N VT A                   
Sbjct: 4   KLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIIN-VTNAPRGQVSLMDVLDDTVHKKA 62

Query: 389 --CVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVW--------------------HVES 426
             CVA  P           +  ++ +GS D TV +W                     +E 
Sbjct: 63  IRCVAWRP-----------HSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEM 111

Query: 427 RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW----DIRSNTCVKVFRGHVGQVQ 482
                + GH   V  +          S S D ++ +W    D     C+ V + H   V+
Sbjct: 112 DLLAIIEGHENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVK 171

Query: 483 KVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIK 542
            V+                             P+         LP    L S S D+TI+
Sbjct: 172 HVVW---------------------------HPE---------LPL---LASSSYDDTIR 192

Query: 543 LWEVRTG--KCVRTHFGHVEGIW--DIA----ADNFRIVSGAHDKTVKVW 584
           LW+      +C     GH   +W  D       ++ R+ SG+ D TV+VW
Sbjct: 193 LWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 45/111 (40%), Gaps = 18/111 (16%)

Query: 329 LLFTGSYDSTVAIWDLATG--KLVRRLTGHRDGVKAIYFDGQK------LITGSLDRMIR 380
           LL + SYD T+ +W       +    L GH   V    F+  K      L +GS D  +R
Sbjct: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240

Query: 381 VWNYVTG--------ACVAAYPG-HSDSVLSVD-SYKKIIVSGSADKTVKV 421
           VW Y+           C A  P  H   + SV  S   +I S  +D T+ V
Sbjct: 241 VWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAV 291

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 526 LPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWD--IAADNFRIVSGAHDKTVKV 583
            P  + LLS S D  +K+W +  G   RT  GH  GI D  I      ++S + D +V++
Sbjct: 150 FPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRL 209

Query: 584 WDLQSGKCIHTF 595
           W+L SGK I  F
Sbjct: 210 WELGSGKTISKF 221

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 69/170 (40%), Gaps = 32/170 (18%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV--KAIYFDGQKLITGSLDRMIRVWNYVT 386
           +L +GS D  + +W L  G   R L GH  G+    I   G+ +++ SLD  +R+W   +
Sbjct: 155 VLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRLWELGS 214

Query: 387 GACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVES--RTCYTLRGHTEWV----G 440
           G  ++ +    ++   V S   ++   S   + +V   E+  R  +   G   +     G
Sbjct: 215 GKTISKFCRKENTTDGVTSMSLLVGEESTSMSAQVTDRETGDRLEFGTEGKQVFAGHLSG 274

Query: 441 TVKLH-----------PKSFTC-------------FSGSDDTTIRMWDIR 466
           T+ +H           P SF                SG +D T+  WDIR
Sbjct: 275 TITVHDLFNKQQILQIPSSFVAPCNTIAQISEHAIVSGYEDGTVATWDIR 324

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 65/154 (42%), Gaps = 40/154 (25%)

Query: 400 VLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRG-HTEWVGTVKLHPKSFTCFSGSDDT 458
           ++S D+    IV G +   + V+  E  +  +L G H   V TVK+ P +    SGS D 
Sbjct: 104 LISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDM 163

Query: 459 TIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQ 518
            +++W +   +  +  +GH   +          T+ ++ +R     RN            
Sbjct: 164 QLKVWSLEDGSNPRTLKGHSAGI----------TDTIIIER----GRN------------ 197

Query: 519 LSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCV 552
                        +LS SLD +++LWE+ +GK +
Sbjct: 198 -------------VLSSSLDGSVRLWELGSGKTI 218

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 69/162 (42%), Gaps = 9/162 (5%)

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY--KKIIVSGSADKTVKVWHVES 426
           K++ G     I V+++   + ++    H   V +V  +    +++SGS D  +KVW +E 
Sbjct: 113 KIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLED 172

Query: 427 RTC-YTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVL 485
            +   TL+GH+  +    +  +     S S D ++R+W++ S   +  F         V 
Sbjct: 173 GSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRLWELGSGKTISKFCRKENTTDGVT 232

Query: 486 PLTILDTENL------VTDRTSDPPRNEATTAQDPPDGQLSA 521
            +++L  E        VTDR +       T  +    G LS 
Sbjct: 233 SMSLLVGEESTSMSAQVTDRETGDRLEFGTEGKQVFAGHLSG 274

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%)

Query: 565 IAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPIT 603
           I   N  ++SG+ D  +KVW L+ G    T   H A IT
Sbjct: 149 IFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGIT 187

>Kwal_14.1235
          Length = 607

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 94/223 (42%), Gaps = 42/223 (18%)

Query: 424 VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQK 483
           +E    +  + HT  V  +KL+       SGS D  +  WD+ S  C+  F+G   Q+  
Sbjct: 306 MEGHIAHYFKKHTSTVNQLKLNNDESRFISGSWDKQVLEWDLNSGECINEFKGSSAQISS 365

Query: 484 V--LPL----TILDT-----------------ENLVTDRTSDPPR---NEATTAQD---- 513
           +   PL     I DT                 ++L  D   +  R    E TTA++    
Sbjct: 366 LEFRPLFSSVEIQDTSTEDDDDVQMKADDDDLDSLFGDEEEEEKRKAQEENTTAEESTKK 425

Query: 514 PPDGQL--SALDDSLPYPSHLLSCSLDNTIKLWEVRTGK--CVRTHFGHVEGIWDIAA-- 567
            P+ ++  S L       + L SC+ + +I++W+ R      ++   G     W ++A  
Sbjct: 426 SPEEEISRSTLRTVFDENTFLGSCT-NGSIQIWDRRIASRPAMKLMRGPQTPPWCMSACW 484

Query: 568 --DNFRIVSGAHDKTVKVWDLQ-SGKCIHT--FDSHQAPITCV 605
             D  R+ +G  + TV+ +DL+  GK   T  F S   P++CV
Sbjct: 485 STDGDRVYAGRRNATVEEYDLKIGGKTSKTLKFPSISGPVSCV 527

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 22/39 (56%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD 404
           D  + I+GS D+ +  W+  +G C+  + G S  + S++
Sbjct: 329 DESRFISGSWDKQVLEWDLNSGECINEFKGSSAQISSLE 367

>Sklu_1659.2 YMR092C, Contig c1659 410-2251
          Length = 613

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 4/90 (4%)

Query: 334 SYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAY 393
           S D T+ I+ +    LVRR+ GH  G+ A+  +   L++GS D  +  W       +  Y
Sbjct: 315 SLDGTLNIFKIGEDSLVRRIEGHNKGITALVVN--PLVSGSYDGRVVQWINENEPHMENY 372

Query: 394 PGHSDSVLSVDSYKKIIVSGSADKTVKVWH 423
             H + ++S+D+  KI+ + S D T+KV++
Sbjct: 373 --HGNMIVSIDNTDKIVSTVSWDDTLKVFN 400

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 77/192 (40%), Gaps = 43/192 (22%)

Query: 394 PGHSDSVLSVDSYKKII-VSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCF 452
           PG     +SV S +KI+   G   + +K  ++E  T   + G    +  +     S    
Sbjct: 212 PGTGKYAISVGSDRKIVCYDGKTGEFIK--YIED-TKENINGGLFAISWIDEGENSNKFV 268

Query: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512
           + S D T+++WD+ S+ C++ +                  EN ++        N+     
Sbjct: 269 TSSADCTLKLWDVESSKCLQSWS----------------LENTLS--------NQQVGVA 304

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRI 572
              D ++ AL             SLD T+ ++++     VR   GH +GI  +  +   +
Sbjct: 305 VTKDHEIVAL-------------SLDGTLNIFKIGEDSLVRRIEGHNKGITALVVN--PL 349

Query: 573 VSGAHDKTVKVW 584
           VSG++D  V  W
Sbjct: 350 VSGSYDGRVVQW 361

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/277 (20%), Positives = 111/277 (40%), Gaps = 49/277 (17%)

Query: 355 GHRDGVKAI---YFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV---------LS 402
           GHRDG   +   Y    KL +GS D +++ WN  T   + ++  H   V         LS
Sbjct: 65  GHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLS 124

Query: 403 VDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVG------------------TVKL 444
                  ++S   DKT+K+W V S    +++  T+ V                   ++  
Sbjct: 125 PTKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTGDGALLKTFYGEHAFQSIDH 184

Query: 445 HPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV---------QKVLPLTILDTENL 495
           H ++    +G     I++WD+     +      V  V         + +L  T  D   +
Sbjct: 185 HRRNPNFVTGG--AQIQLWDVNRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIV 242

Query: 496 VTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRT-GKCVRT 554
           + D  ++ P  +          + +AL  +   P +    + D+    +++R   + +  
Sbjct: 243 LYDLRTNSPTQKVVQRM-----RTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHV 297

Query: 555 HFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDLQSG 589
              HV  + D+  +     IV+G++DKT+++++L+ G
Sbjct: 298 FKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHG 334

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 77/175 (44%), Gaps = 46/175 (26%)

Query: 317 MDGVLSLQFNYR----LLFTGSYDSTVAIWDLATG----KLVRRLTGH------------ 356
           +D V  ++FN      L  TGS D+++ ++DL T     K+V+R+  +            
Sbjct: 216 VDNVSFVRFNQNEEDILASTGS-DNSIVLYDLRTNSPTQKVVQRMRTNALCWNPMEPFNF 274

Query: 357 ---RDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD--SYKKIIV 411
               +   A Y+D +     ++ R + V           +  H  +V+ VD     + IV
Sbjct: 275 AIANEDHNAYYYDMR-----NMSRALHV-----------FKDHVSAVMDVDFSPTGEEIV 318

Query: 412 SGSADKTVKVW---HVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
           +GS DKT++++   H  SR  Y  +   + V  VK    S    SGSDD  +R+W
Sbjct: 319 TGSYDKTIRIFNLKHGHSREVYHTK-RMQHVFQVKFTMDSKYIVSGSDDGNVRLW 372

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK-----KIIVSGSADKTVKV 421
           G++++TGS D+ IR++N   G     Y  H+  +  V   K     K IVSGS D  V++
Sbjct: 314 GEEIVTGSYDKTIRIFNLKHGHSREVY--HTKRMQHVFQVKFTMDSKYIVSGSDDGNVRL 371

Query: 422 WHVES 426
           W  ++
Sbjct: 372 WRAKA 376

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 9/86 (10%)

Query: 304 RKGTAHIQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK 361
           R  +  +  FK H+  V+ + F+     + TGSYD T+ I++L  G    R   H   ++
Sbjct: 289 RNMSRALHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGH--SREVYHTKRMQ 346

Query: 362 AIY-----FDGQKLITGSLDRMIRVW 382
            ++      D + +++GS D  +R+W
Sbjct: 347 HVFQVKFTMDSKYIVSGSDDGNVRLW 372

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 70/154 (45%), Gaps = 6/154 (3%)

Query: 326 NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG--QKLITGSLDRMIRVWN 383
           N+ L+  GS +  +++++L +G   +    H+  V  +  DG  +K+++  LD ++  ++
Sbjct: 561 NFALI--GSSNGGISVYNLQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYD 618

Query: 384 YVTGACVAAYP-GHSDSVLSVDSYKKIIVSGSADKTVKVW-HVESRTCYTLRGHTEWVGT 441
           + T + +     G   + L      ++      D +++V   V  R    L GH+  +  
Sbjct: 619 FTTNSFLGKLQLGAPITQLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITA 678

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFR 475
               P      S S D+T+R WD+ + TC+   R
Sbjct: 679 FDFSPDGRWIVSASLDSTLRTWDLPTGTCIDGVR 712

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 92/195 (47%), Gaps = 9/195 (4%)

Query: 406 YKKIIVSGSADKTVKVWHVESRTC--YTLRGHTE-WVGTVKLHPKSFTCFSGSDDTTIRM 462
           ++ ++ + + ++  + W+ +++    +TL    +  V +V +         GS +  I +
Sbjct: 515 WENVVTAHNGERAARTWNTKTKRVGRWTLSTSDDGLVKSVAMTQCGNFALIGSSNGGISV 574

Query: 463 WDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSAL 522
           ++++S    KV++ H G V   L +  ++ + +           + TT       QL A 
Sbjct: 575 YNLQSGIKRKVYKMHKGSVTG-LAVDGMNRKMVSCGLDGLVGFYDFTTNSFLGKLQLGAP 633

Query: 523 DDSLPY--PSHLLSCSLDN-TIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIVSGAH 577
              L Y   S L + +LD+ +I++ +  T + VR  +GH   I  +D + D   IVS + 
Sbjct: 634 ITQLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRWIVSASL 693

Query: 578 DKTVKVWDLQSGKCI 592
           D T++ WDL +G CI
Sbjct: 694 DSTLRTWDLPTGTCI 708

>Scas_465.4
          Length = 1002

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 531 HLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADN--FRIVSGAHDKTVKVWDL 586
           ++ SCS D +IKLW ++TG+ + T +GH   IW++   N   +++S + D T +VWD+
Sbjct: 193 YITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 75/162 (46%), Gaps = 21/162 (12%)

Query: 320 VLSLQFNYR---LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQ-------- 368
           + S +FNYR   +     Y+  V + DL TG+++ R T    G ++I + G         
Sbjct: 94  ITSGEFNYRGDQVYLLTCYNK-VFVCDL-TGEILSRKT--LQGERSILYSGSIKEFSPEK 149

Query: 369 -KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVL--SVDSYKKIIVSGSADKTVKVWHVE 425
             +  G++   + +W+      +    GH  S+   ++    + I S S D+++K+W+++
Sbjct: 150 VYISAGTVMGGVLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQ 209

Query: 426 S--RTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           +    C T  GHT  +  +K         S S+D T R+WDI
Sbjct: 210 TGEELC-TGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 71/165 (43%), Gaps = 12/165 (7%)

Query: 328 RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYV 385
            L+ TG+    + +W+   GKL   L  HR  + A+ +  D   L+T  +  ++ +W+ +
Sbjct: 222 ELVLTGTTSGELRLWN-KQGKLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVILWSTL 280

Query: 386 TGACVAAYPGHSDSVLSVDSY---------KKIIVSGSADKTVKVWHVESRTCYTLRGHT 436
           TG  +  +      + + DS           K ++ G     +      ++    L GHT
Sbjct: 281 TGTQLQHFSFKEGDIENEDSLGIDLEWVETDKFVIPGPGGSLLVYTIGNNKPLGRLLGHT 340

Query: 437 EWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
             + T++ +  + +  S SDD TI++W   +++    F  H   +
Sbjct: 341 STITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTI 385

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 85/209 (40%), Gaps = 18/209 (8%)

Query: 408 KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
           +++++G+    +++W+ + +    L  H   +  +K +       +      + +W   +
Sbjct: 222 ELVLTGTTSGELRLWNKQGKLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVILWSTLT 281

Query: 468 NTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEA----TTAQDPPDGQL---S 520
            T ++ F    G ++    L I D E + TD+   P    +    T   + P G+L   +
Sbjct: 282 GTQLQHFSFKEGDIENEDSLGI-DLEWVETDKFVIPGPGGSLLVYTIGNNKPLGRLLGHT 340

Query: 521 ALDDSLPYPSH---LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI----WDIAADNFRIV 573
           +   +L +      LLS S DNTIK+W             H + I    W    ++  I+
Sbjct: 341 STITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTISSAHW---INDDLII 397

Query: 574 SGAHDKTVKVWDLQSGKCIHTFDSHQAPI 602
           S A+D TVKVW +     +        PI
Sbjct: 398 STAYDGTVKVWSISKNSIVAEASLDSEPI 426

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 40/90 (44%), Gaps = 3/90 (3%)

Query: 315 GHMDGVLSLQFN--YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV-KAIYFDGQKLI 371
           GH   + +L+FN   + L + S D+T+ +W           T H   +  A + +   +I
Sbjct: 338 GHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTISSAHWINDDLII 397

Query: 372 TGSLDRMIRVWNYVTGACVAAYPGHSDSVL 401
           + + D  ++VW+    + VA     S+ + 
Sbjct: 398 STAYDGTVKVWSISKNSIVAEASLDSEPIF 427

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 390 VAAYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKS 448
           +  +  H+D +L +D S    I++GS DK+ K+WH    T      H+++V  V+ HP+ 
Sbjct: 256 LVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPED 315

Query: 449 FTCF-SGSDDTTIRMWDI 465
              F S   D   R+W I
Sbjct: 316 DRFFLSACLDQKCRLWSI 333

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 77/170 (45%), Gaps = 20/170 (11%)

Query: 326 NYRLLFTGSYDSTVAIWD--LATGKLVR------RLTGHRDGVKAIYFDGQK------LI 371
           N  LL  G     + I+   L+ GK++        L GH D VK+I F  Q+      L 
Sbjct: 165 NKYLLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYLLC 224

Query: 372 TGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYT 431
           +GS DR IR+W   T   +       ++ L++ S K+     S D  + + + E+     
Sbjct: 225 SGSQDRYIRIWRIRTNDLIDD-SEDDETKLTLLSSKQHKFHISEDLRIGI-NFEA----L 278

Query: 432 LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
           + GH +WV +++ H       + + DT + +W+   ++ V V    +G++
Sbjct: 279 IIGHDDWVSSLQWHESKLQLLASTADTAVMIWEPDESSGVWVCSSRLGEM 328

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/207 (19%), Positives = 71/207 (34%), Gaps = 74/207 (35%)

Query: 339 VAIW---DLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGA----- 388
           +A+W   D     +   L GH   V  + F      L++ S D  +++W Y         
Sbjct: 37  IALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPESEELE 96

Query: 389 CVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESR-------------------TC 429
           C+     +S +++S+++   +IV GSA   V +W  E+                     C
Sbjct: 97  CIQTITHYSHTIVSIETLAGLIVIGSAGGLVSIWVPETEGSDTYIISHEYSLPRNVFPLC 156

Query: 430 YTL-----------------------------------------RGHTEWVGTVKLH--- 445
           ++L                                          GH +WV +++     
Sbjct: 157 FSLSNVVGNKYLLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQE 216

Query: 446 -PKSFTCFSGSDDTTIRMWDIRSNTCV 471
            P  +   SGS D  IR+W IR+N  +
Sbjct: 217 TPGDYLLCSGSQDRYIRIWRIRTNDLI 243

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 6/45 (13%)

Query: 312 EFKGHMDGVLSLQFNYR------LLFTGSYDSTVAIWDLATGKLV 350
           E +GH D V S+QF ++      LL +GS D  + IW + T  L+
Sbjct: 199 ELEGHEDWVKSIQFRHQETPGDYLLCSGSQDRYIRIWRIRTNDLI 243

>Scas_718.6*
          Length = 546

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 77/168 (45%), Gaps = 13/168 (7%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGS-LDRMIRVWNYVT 386
           L     + ++ ++ +   K + +L GH+  +  I F+   + L+T S  D  IR+W+   
Sbjct: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401

Query: 387 GACVAAYPGHSDSVLSVDSYK-KIIVSGSADKTVKVWHVESRTCYT----LRGHTEWVGT 441
             C   + GHS S++S+      +++S S D +V++W V    C      + G+    G 
Sbjct: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV-VENCLVGMAMVDGNAIICGK 460

Query: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTI 489
           +      F    GS +  I ++DI+      + R    ++  V+P+TI
Sbjct: 461 ISHDKNKFAI--GSMNGQINVYDIKRFVSRLLKRDKKQEL--VVPITI 504

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 55/130 (42%), Gaps = 6/130 (4%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGS-YDSTVAIWDLATGKLVRRLTGHRDGVKAI-YF 365
           I +  GH   +  ++FN   RLL T S  D ++ IW            GH   + ++ + 
Sbjct: 362 IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWI 421

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVL--SVDSYKKIIVSGSADKTVKVWH 423
           +   +I+ S+D  +R+W+ V    V       ++++   +   K     GS +  + V+ 
Sbjct: 422 NDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYD 481

Query: 424 VESRTCYTLR 433
           ++      L+
Sbjct: 482 IKRFVSRLLK 491

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/191 (16%), Positives = 77/191 (40%), Gaps = 13/191 (6%)

Query: 408 KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
           ++I++   +  +++W+ + R       H   + ++K +  S    S   D    +W+  +
Sbjct: 251 ELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAIN 310

Query: 468 NTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPD----------- 516
              ++ F            L + D E +  D+   P  N +       D           
Sbjct: 311 GIILQHFEPEQKLENNTESLGV-DIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQ 369

Query: 517 GQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA-ADNFRIVSG 575
           G +S ++ ++     L S   D +I++W  +   C    +GH + I  ++  ++  ++S 
Sbjct: 370 GTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISA 429

Query: 576 AHDKTVKVWDL 586
           + D +V++W +
Sbjct: 430 SMDGSVRIWSV 440

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 62/144 (43%), Gaps = 24/144 (16%)

Query: 300 ESNWRKGTAHIQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIW--------------- 342
           E   RK  A++     H   V +L+F  + + L +GS D  + IW               
Sbjct: 63  EEQLRKPLANMSR---HTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMEN 119

Query: 343 DLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV 400
           DL    + RRL  H + ++ I +  D   L+T  LDR I VWN  T   +  +  H   V
Sbjct: 120 DLEHWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHV 179

Query: 401 LSV--DSYKKIIVSGSADKTVKVW 422
             V  D   K   + S D+TVKV+
Sbjct: 180 KGVVFDPANKYFATASDDRTVKVF 203

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 86/227 (37%), Gaps = 49/227 (21%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE 425
           DGQ++ TG LD  IR+W                SV  +  + K  VS  A +        
Sbjct: 28  DGQRVATGGLDGKIRIW----------------SVADILVFAKPKVSWPARE-----EQL 66

Query: 426 SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVL 485
            +    +  HT  V  +K  P +    SGSDD  + +W+              G VQ + 
Sbjct: 67  RKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWEKEE-----------GAVQPLF 115

Query: 486 PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWE 545
            +   D E+    R      N+       PD  +            L++  LD +I +W 
Sbjct: 116 DMEN-DLEHWNVRRRLVAHDNDIQDICWAPDSSI------------LVTVGLDRSIIVWN 162

Query: 546 VRTGKCVR---THFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSG 589
             T + ++    H  HV+G+    A+ +   + + D+TVKV+    G
Sbjct: 163 GSTFEKIKRFDVHQSHVKGVVFDPANKY-FATASDDRTVKVFRYHKG 208

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNYVT 386
           +L T   D ++ +W+ +T + ++R   H+  VK + FD   +   T S DR ++V+ Y  
Sbjct: 148 ILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGVVFDPANKYFATASDDRTVKVFRYHK 207

Query: 387 G 387
           G
Sbjct: 208 G 208

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 537 LDNTIKLWEVRTGKCVRTHFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDLQSGKCIHT 594
           ++N ++ W VR     R    H   I DI  A D+  +V+   D+++ VW+  + + I  
Sbjct: 117 MENDLEHWNVR-----RRLVAHDNDIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKR 171

Query: 595 FDSHQAPITCV 605
           FD HQ+ +  V
Sbjct: 172 FDVHQSHVKGV 182

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 5/89 (5%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWH 423
           D + L+T S+D  ++V+N  TG CVA    H+  V  V  D   + I+S S D+++ ++ 
Sbjct: 163 DDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPLNQYIISQSVDRSINIYE 222

Query: 424 VESRTCYTLRG---HTEWVGTVKLHPKSF 449
           +E R    +      TE +  +KL  + F
Sbjct: 223 IELRDSKDITSSTTSTELIKRLKLKNRIF 251

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 50/89 (56%), Gaps = 8/89 (8%)

Query: 505 RNEATTAQDPPDGQLSALDDSL--PYPSHLLSCSLDNTIKLWEVRTGKCV---RTHFGHV 559
           R  A    + P G  S + D    P   +L++ S+DN++K++ V TG CV   + H  +V
Sbjct: 138 RGTANDLDNMPGGGASEIYDLSWSPDDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYV 197

Query: 560 EGI-WDIAADNFRIVSGAHDKTVKVWDLQ 587
           +G+ WD    N  I+S + D+++ +++++
Sbjct: 198 QGVTWDPL--NQYIISQSVDRSINIYEIE 224

>Kwal_23.4118
          Length = 939

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 66/159 (41%), Gaps = 24/159 (15%)

Query: 331 FTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG--QKLITGSLDRMIRVWNYVTG- 387
           F GS +  + +++L +G   ++   H+  V  I  DG  +K+++  LD ++  +++    
Sbjct: 477 FVGSSNGGIGVYNLQSGLPRKKYRLHKKAVSGIAVDGMNRKMVSCGLDGIVGFYDFSKSS 536

Query: 388 --------ACVAAYPGHSDS---VLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHT 436
                   A V +   H  S    L++D +  ++V     K V+           L GH+
Sbjct: 537 YLGKLQLDAPVTSMVYHRSSDLFALALDDFSIVVVDAVTQKVVR----------QLWGHS 586

Query: 437 EWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFR 475
             + +    P      S S D T R WD+ +  C+   R
Sbjct: 587 NRISSFDFSPDGRWIISTSLDGTARTWDLPTGCCIDGIR 625

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 518 QLSALDDSLPY--PSHLLSCSLDN-TIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRI 572
           QL A   S+ Y   S L + +LD+ +I + +  T K VR  +GH   I  +D + D   I
Sbjct: 542 QLDAPVTSMVYHRSSDLFALALDDFSIVVVDAVTQKVVRQLWGHSNRISSFDFSPDGRWI 601

Query: 573 VSGAHDKTVKVWDLQSGKCI 592
           +S + D T + WDL +G CI
Sbjct: 602 ISTSLDGTARTWDLPTGCCI 621

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 72/166 (43%), Gaps = 12/166 (7%)

Query: 348 KLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVL--SV 403
           K V  L GH + +    +  D + +++ S D  + VW+ +TG   +A P  S  VL  ++
Sbjct: 76  KPVGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKRSAIPLDSQWVLTCAL 135

Query: 404 DSYKKIIVSGSADKTVKVWH------VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDD 457
                +  S   +    ++       V+       +GHT ++  V+   +S    S S D
Sbjct: 136 SPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSESRVVTS-SGD 194

Query: 458 TTIRMWDIRSNTCVKVFRGHVGQVQKV-LPLTILDTENLVTDRTSD 502
            T  +WDI     V+ +  H+G V  + +P+T L   N+     SD
Sbjct: 195 MTCALWDIPKAKRVREYSDHLGDVLAISIPVTNLSKNNMFASCGSD 240

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 106/251 (42%), Gaps = 29/251 (11%)

Query: 354 TGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD------SYK 407
           TG+  GV+  +    +++T S D    +W+      V  Y  H   VL++       S  
Sbjct: 174 TGYISGVE--FVSESRVVTSSGDMTCALWDIPKAKRVREYSDHLGDVLAISIPVTNLSKN 231

Query: 408 KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGT-----VKLHPKSFTCFSGSDDTTIRM 462
            +  S  +D    +W V S +          +G+     +K  P   +   G+DD TI +
Sbjct: 232 NMFASCGSDGYTFIWDVRSPSAV----QQFSIGSCDSNCLKFFPDGNSVAVGNDDGTISL 287

Query: 463 WDIRSNTCVKVF----RGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQ 518
           +D+R++  + ++    RG   Q + V     L++    +  +S        T      G 
Sbjct: 288 FDLRADCTIALYSINDRGSPLQKENVF----LNSNEYQSSSSSPKSPISLATNYFEDRGV 343

Query: 519 LSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI--AADNFRIVSGA 576
           +S LD S      + SC ++   ++W+V  G+ V +  GH   +  +  + D   I +G+
Sbjct: 344 IS-LDFS-GSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGVKCSPDGMAICTGS 401

Query: 577 HDKTVKVWDLQ 587
            D+T+K+W  Q
Sbjct: 402 WDQTLKLWTPQ 412

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 319 GVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGS 374
           GV+SL F+   RL+++   +    +WD+  G++V  L GH + +  +    DG  + TGS
Sbjct: 342 GVISLDFSGSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGVKCSPDGMAICTGS 401

Query: 375 LDRMIRVW 382
            D+ +++W
Sbjct: 402 WDQTLKLW 409

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 37/184 (20%), Positives = 68/184 (36%), Gaps = 49/184 (26%)

Query: 432 LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILD 491
           L+GHT  +   +    S    S S D  + +WD              G  +  +PL   D
Sbjct: 81  LKGHTNKIADFRWSRDSKLILSASQDGFMIVWD-----------SLTGLKRSAIPL---D 126

Query: 492 TENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKC 551
           ++ ++T   S             P G L+A            S  L+N   ++ +  G  
Sbjct: 127 SQWVLTCALS-------------PSGALAA------------SAGLNNNCTIYRMPRGSA 161

Query: 552 V--------RTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPIT 603
           V        + H G++ G+  ++    R+V+ + D T  +WD+   K +  +  H   + 
Sbjct: 162 VQQNVTSIFKGHTGYISGVEFVSES--RVVTSSGDMTCALWDIPKAKRVREYSDHLGDVL 219

Query: 604 CVGI 607
            + I
Sbjct: 220 AISI 223

>Scas_660.7*
          Length = 603

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 19/143 (13%)

Query: 336 DSTVAIWDLATGKLVRRLTGHRDGVKAIYF-----DGQKLITGSLDRMIRVWNYVTGACV 390
           D  +  +D  TG+ V+ +    + ++   F     D  K +T S D  IRVW+  +  CV
Sbjct: 214 DRKINCFDSKTGEFVKSIVDESEPIQGGIFALSWIDENKFVTASADATIRVWDVNSSKCV 273

Query: 391 AAY---PGHSDSVLS------VDSYKKIIVSGSADKTVKVWHVESRTCYT-LRGHTEWVG 440
             +       D+VL       V S +  IVS S D T+ ++ +E     T ++GH++ + 
Sbjct: 274 QKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDGTLNIFQLEQDNIITSIKGHSKGIT 333

Query: 441 TVKLHPKSFTCFSGSDDTTIRMW 463
            + ++P      +GS D  I  W
Sbjct: 334 ALAVNP----LITGSYDGKIMDW 352

 Score = 36.2 bits (82), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 329 LLFTGSYDSTVAIWDLA-TGKLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVW 382
           L+ TGS D+ + ++ +    K+++RL  H+DG+ A+ + D   L++   D  I+ W
Sbjct: 543 LVATGSLDTNIFVYSIKRPMKIIKRLNAHKDGISALLWEDASTLVSTGADACIKKW 598

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 49/104 (47%), Gaps = 11/104 (10%)

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT---------HFGHVEGIW 563
           +P  G + AL  S    +  ++ S D TI++W+V + KCV+          +    + + 
Sbjct: 236 EPIQGGIFAL--SWIDENKFVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVG 293

Query: 564 DIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
            +A+   RIVS + D T+ ++ L+    I +   H   IT + +
Sbjct: 294 VVASQEGRIVSLSLDGTLNIFQLEQDNIITSIKGHSKGITALAV 337

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVE----GIWDIA-ADNFRIVSGAHDKTVKVW 584
           S  ++   D  I  ++ +TG+ V++     E    GI+ ++  D  + V+ + D T++VW
Sbjct: 206 SFAITVGSDRKINCFDSKTGEFVKSIVDESEPIQGGIFALSWIDENKFVTASADATIRVW 265

Query: 585 DLQSGKCIH 593
           D+ S KC+ 
Sbjct: 266 DVNSSKCVQ 274

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 59/132 (44%), Gaps = 34/132 (25%)

Query: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512
           + S D TIR+WD+ S+ CV+ +                    +VT  + D         +
Sbjct: 255 TASADATIRVWDVNSSKCVQKW--------------------VVTSSSDD------NVLR 288

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRI 572
           D   G +++ +        ++S SLD T+ ++++     + +  GH +GI  +A +   +
Sbjct: 289 DQQVGVVASQE------GRIVSLSLDGTLNIFQLEQDNIITSIKGHSKGITALAVN--PL 340

Query: 573 VSGAHDKTVKVW 584
           ++G++D  +  W
Sbjct: 341 ITGSYDGKIMDW 352

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 57/125 (45%), Gaps = 16/125 (12%)

Query: 319 GVLSLQF-NYRLLFTGSYDSTVAIWDLATGKLVRR--LTGHRDG-------VKAIYFDGQ 368
           G+ +L + +     T S D+T+ +WD+ + K V++  +T   D        V  +     
Sbjct: 241 GIFALSWIDENKFVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEG 300

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES 426
           ++++ SLD  + ++       + +  GHS  +  L+V+     +++GS D  +  W  + 
Sbjct: 301 RIVSLSLDGTLNIFQLEQDNIITSIKGHSKGITALAVNP----LITGSYDGKIMDWSNKP 356

Query: 427 RTCYT 431
              +T
Sbjct: 357 EVAHT 361

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 73/171 (42%), Gaps = 27/171 (15%)

Query: 313 FKGHMDGVLSLQFNY---RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369
           F+GH   VL   F+      + + S D  + IWD+     + + +G  + +K I  +  K
Sbjct: 77  FRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILK-SGDNEEIKDI--EPTK 133

Query: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVES-RT 428
            +TG   ++                GH   +L   + K ++ S S D TV++W+VE+   
Sbjct: 134 FLTGHSRKV----------------GH---ILYHPTAKDVLASSSLDYTVRIWNVETGED 174

Query: 429 CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
            Y L+ H + V ++          + + D  +R+W++R    V     H G
Sbjct: 175 IYKLK-HPDMVTSMSFSYDGTHLATVARDKKLRVWNVREEKVVSEGAAHAG 224

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 73/188 (38%), Gaps = 35/188 (18%)

Query: 432 LRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTIL 490
            RGHT  V      P       S SDD  I +WDI  +  + +  G   +++ + P   L
Sbjct: 77  FRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSI-LKSGDNEEIKDIEPTKFL 135

Query: 491 DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSH---LLSCSLDNTIKLWEVR 547
                                     G    +   L +P+    L S SLD T+++W V 
Sbjct: 136 T-------------------------GHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVE 170

Query: 548 TGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPIT-- 603
           TG+ +     H + +     + D   + + A DK ++VW+++  K +    +H       
Sbjct: 171 TGEDIY-KLKHPDMVTSMSFSYDGTHLATVARDKKLRVWNVREEKVVSEGAAHAGAKNQR 229

Query: 604 CVGIGDSE 611
            V +G+SE
Sbjct: 230 VVWLGNSE 237

>Scas_719.52
          Length = 628

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 68/173 (39%), Gaps = 32/173 (18%)

Query: 432 LRGHTEWVGTVKLHP-KSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTIL 490
            RGHT  V      P       S SDD+ I +W I  +   + +    G+ + + P+  L
Sbjct: 77  FRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFL 136

Query: 491 DTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYP---SHLLSCSLDNTIKLWEVR 547
                                     G    +   L +P   + L S SLD T+KLW + 
Sbjct: 137 S-------------------------GHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIE 171

Query: 548 TGKCVRTHFGHVEGIWDIAAD--NFRIVSGAHDKTVKVWDLQSGKCIHTFDSH 598
           TG+ V T   H + +  ++       + +   DK ++VWD++ GK +    +H
Sbjct: 172 TGEAVIT-LKHPDMVTSMSFSYGGNHLATVCRDKKLRVWDIREGKIVSEGPAH 223

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 6/98 (6%)

Query: 305 KGTAHIQEFKGHMDGVLSLQFN---YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK 361
           K    ++   GH   V  + F+     +L + S D TV +W++ TG+ V  L  H D V 
Sbjct: 128 KNIKPVKFLSGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVITLK-HPDMVT 186

Query: 362 AIYFD--GQKLITGSLDRMIRVWNYVTGACVAAYPGHS 397
           ++ F   G  L T   D+ +RVW+   G  V+  P H+
Sbjct: 187 SMSFSYGGNHLATVCRDKKLRVWDIREGKIVSEGPAHA 224

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 72/184 (39%), Gaps = 35/184 (19%)

Query: 313 FKGHMDGVLSLQF---NYRLLFTGSYDSTVAIWDLATG----------------KLVRRL 353
           F+GH   VL   F   N  ++ + S DS + IW +                   K V+ L
Sbjct: 77  FRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFL 136

Query: 354 TGHRDGVKAIYFDG---QKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD-SY-KK 408
           +GH   V  + F       L + SLD  +++WN  TG  V     H D V S+  SY   
Sbjct: 137 SGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVITL-KHPDMVTSMSFSYGGN 195

Query: 409 IIVSGSADKTVKVWHV-ESRTCYTLRGHTE-------WVGTVKLHPKSFTCFSGSDDTTI 460
            + +   DK ++VW + E +       H         W+G       + T FS   D  I
Sbjct: 196 HLATVCRDKKLRVWDIREGKIVSEGPAHAGAKNQRVVWLGNSDRL--ATTGFSRLSDRQI 253

Query: 461 RMWD 464
            +WD
Sbjct: 254 GIWD 257

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 53/254 (20%), Positives = 79/254 (31%), Gaps = 97/254 (38%)

Query: 382 WNYVTGACVAAYP---------------GHSDSVLSVDS---YKKIIVSGSADKTVKVWH 423
           WN   G   A  P               GH+  VL  D       II S S D  + +W 
Sbjct: 51  WNASGGGAFAVIPVAEVGKCPDQVPLFRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWK 110

Query: 424 VESRTCYT-----------------LRGHTEWVGTVKLHPKSFTCFSGSD-DTTIRMWDI 465
           +     +                  L GH+  VG V  HP +    + S  D T+++W+I
Sbjct: 111 IPEDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNI 170

Query: 466 RSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDS 525
            +   V                  L   ++VT                           S
Sbjct: 171 ETGEAV----------------ITLKHPDMVTSM-------------------------S 189

Query: 526 LPYP-SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIV----------- 573
             Y  +HL +   D  +++W++R GK V       EG     A N R+V           
Sbjct: 190 FSYGGNHLATVCRDKKLRVWDIREGKIVS------EGPAHAGAKNQRVVWLGNSDRLATT 243

Query: 574 --SGAHDKTVKVWD 585
             S   D+ + +WD
Sbjct: 244 GFSRLSDRQIGIWD 257

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 393 YPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTC 451
           Y  H   VL ++ S    I+S S DKTVK+WH + +       H ++V  V+ HP     
Sbjct: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333

Query: 452 F-SGSDDTTIRMWDI 465
           F SG  D   R+W I
Sbjct: 334 FISGCLDHKCRLWSI 348

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 3/82 (3%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRT--HFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSG 589
           +LS S+D T+KLW       ++T  H   V  +     D+   +SG  D   ++W +   
Sbjct: 292 ILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDD 351

Query: 590 KCIHTFDSHQAPITCVGIGDSE 611
           +    +D  Q  IT V +   E
Sbjct: 352 EVSFEYDC-QDLITSVTLSPEE 372

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 104/266 (39%), Gaps = 47/266 (17%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNY-VTGA 388
           L  G  +  V I+D+   K +R L+GH D V  + ++   L +GS DR I   +  +   
Sbjct: 391 LAIGQGNGIVEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADP 450

Query: 389 CVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTVKLH 445
                  H   +  L  ++    + SG  D  V V+   SRT + ++  H   V  +   
Sbjct: 451 FFEKIETHEQEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWS 510

Query: 446 PKS---FTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD 502
           P          G+ D T++MW++  NT VK              L  +DT + V +    
Sbjct: 511 PHKQGILATGGGTADRTLKMWNV--NTSVK--------------LNDVDTGSQVCNMVWS 554

Query: 503 PPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI 562
              +E  T+                Y  + L+        +WE    + +    GH   +
Sbjct: 555 TNTDEIVTSHG--------------YSKYNLT--------IWEASNLEPLAILKGHSFRV 592

Query: 563 --WDIAADNFRIVSGAHDKTVKVWDL 586
               ++AD   IVSGA D+T++ W L
Sbjct: 593 LHLTLSADGTTIVSGAGDETLRYWKL 618

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 63/125 (50%), Gaps = 8/125 (6%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGK-LVRRLTGHRDGVKAIYF--D 366
           I+   GH+D V  L +N  +L +GS D T+   D+        ++  H   +  + +  +
Sbjct: 411 IRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADPFFEKIETHEQEICGLKWNTN 470

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVS---GSADKTVKV 421
             KL +G  D M+ V++  +     +   H  +V  ++   +K+ I++   G+AD+T+K+
Sbjct: 471 DNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLKM 530

Query: 422 WHVES 426
           W+V +
Sbjct: 531 WNVNT 535

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 47/89 (52%), Gaps = 3/89 (3%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQ-S 588
           SHL     +  +++++V   KC+RT  GH++ +  ++ +N  + SG+ D+T+   D++ +
Sbjct: 389 SHLAIGQGNGIVEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMA 448

Query: 589 GKCIHTFDSHQAPITCV--GIGDSEFVSG 615
                  ++H+  I  +     D++  SG
Sbjct: 449 DPFFEKIETHEQEICGLKWNTNDNKLASG 477

>Scas_719.30
          Length = 940

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 336 DSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACV 390
           D ++ + D  T ++VR+  GH + + A+ F  DG+ +++ SLD  IR W+  TG C+
Sbjct: 565 DLSIVLIDAVTQRVVRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPTGGCI 621

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 67/153 (43%), Gaps = 20/153 (13%)

Query: 331 FTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG--QKLITGSLDRMIRVWNYVTGA 388
           F GS +  ++++++ +G L ++   H+  V  I  DG  +K+++  LD ++  +++    
Sbjct: 477 FVGSSNGGISVFNMQSGILRKKYRLHKKTVTGIALDGMNRKMVSCGLDGIVGFYDFNKST 536

Query: 389 CVAAYPGHSDSVLSVDS-YKKIIVSGSAD---------KTVKVWHVESRTCYTLRGHTEW 438
            +          L +D+   K++   S+D           V +  V  R      GH+  
Sbjct: 537 FLGK--------LQLDAPITKMVYHRSSDLFALILDDLSIVLIDAVTQRVVRQFWGHSNR 588

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCV 471
           +  +   P      S S D+TIR WD+ +  C+
Sbjct: 589 ITALDFSPDGRWIVSASLDSTIRTWDLPTGGCI 621

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 530 SHLLSCSLDN-TIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDL 586
           S L +  LD+ +I L +  T + VR  +GH   I   D + D   IVS + D T++ WDL
Sbjct: 556 SDLFALILDDLSIVLIDAVTQRVVRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDL 615

Query: 587 QSGKCI 592
            +G CI
Sbjct: 616 PTGGCI 621

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 86/218 (39%), Gaps = 47/218 (21%)

Query: 342 WDLATGKLVR-RLTGHRDG-VKAIYFD--GQKLITGSLDRMIRVWNYVTGACVAAYPGHS 397
           WD+ T ++ R       DG VK++     G     GS +  I V+N  +G     Y  H 
Sbjct: 444 WDMRTKRVGRWTFPTSDDGFVKSVALSQCGNFGFVGSSNGGISVFNMQSGILRKKYRLHK 503

Query: 398 DSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGS 455
            +V  +++D   + +VS   D  V  +   +++ +  +   +   T  ++ +S   F+  
Sbjct: 504 KTVTGIALDGMNRKMVSCGLDGIVGFYDF-NKSTFLGKLQLDAPITKMVYHRSSDLFALI 562

Query: 456 -DDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDP 514
            DD +I + D  +   V+ F GH                            N  T     
Sbjct: 563 LDDLSIVLIDAVTQRVVRQFWGH---------------------------SNRITALDFS 595

Query: 515 PDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCV 552
           PDG+             ++S SLD+TI+ W++ TG C+
Sbjct: 596 PDGRW------------IVSASLDSTIRTWDLPTGGCI 621

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 9/54 (16%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK 361
           +++F GH + + +L F  + R + + S DST+  WDL TG       G  DG+K
Sbjct: 579 VRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPTG-------GCIDGIK 625

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 336 DSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACV 390
           D ++ + D  T K+VR+L GH + + +  F  DG+ +++ SLD  IR W+  TG C+
Sbjct: 566 DLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPDGRWIVSSSLDSTIRTWDLPTGGCI 622

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 530 SHLLSCSLDN-TIKLWEVRTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTVKVWDL 586
           S L + +LD+ +I + +  T K VR  +GH   I  +D + D   IVS + D T++ WDL
Sbjct: 557 SDLFALALDDLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPDGRWIVSSSLDSTIRTWDL 616

Query: 587 QSGKCI 592
            +G CI
Sbjct: 617 PTGGCI 622

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 65/156 (41%), Gaps = 26/156 (16%)

Query: 331 FTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG--QKLITGSLDRMIRVWNYVTGA 388
             GS +  +++ +L +G+  +    H+  V  I  DG  +K+++  LD ++  +++    
Sbjct: 478 LVGSSNGGISVHNLQSGQKRKVYRLHKKAVTGIAMDGMNRKMVSCGLDGIVGFYDFSKST 537

Query: 389 CVA-----------AYPGHSD-SVLSVDSYKKIIVSGSADKTVK-VWHVESRTCYTLRGH 435
            +             Y   SD   L++D    ++V     K V+ +W           GH
Sbjct: 538 FLGKLKLDSPITSMVYHRSSDLFALALDDLSIVVVDSVTQKVVRQLW-----------GH 586

Query: 436 TEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCV 471
           +  + +    P      S S D+TIR WD+ +  C+
Sbjct: 587 SNRISSFDFSPDGRWIVSSSLDSTIRTWDLPTGGCI 622

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 518 QLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCV 552
           ++S+ D S P    ++S SLD+TI+ W++ TG C+
Sbjct: 589 RISSFDFS-PDGRWIVSSSLDSTIRTWDLPTGGCI 622

>Kwal_47.17555
          Length = 417

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 62/140 (44%), Gaps = 22/140 (15%)

Query: 354 TGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK--KIIV 411
           TG + G+ +IY D Q  +T +L+                  GH   +  V  +   ++++
Sbjct: 124 TGDQGGIISIY-DSQAEVTRTLE------------------GHYAEITDVKFFPSGEVLL 164

Query: 412 SGSADKTVKVWH-VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTC 470
           SGSAD  +KVW  ++     TL+GHT  V  + +  +     S S D ++++W+  S   
Sbjct: 165 SGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGSGET 224

Query: 471 VKVFRGHVGQVQKVLPLTIL 490
           +  F     Q   V  + IL
Sbjct: 225 IHSFARKTDQSDPVNDMLIL 244

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 4/84 (4%)

Query: 516 DGQLSALDDSLPYPSH--LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAA-DNFR- 571
           +G  + + D   +PS   LLS S D  +K+W    G   RT  GH   +  +   D  R 
Sbjct: 145 EGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRN 204

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTF 595
           ++S + D ++K+W+  SG+ IH+F
Sbjct: 205 VMSSSKDGSLKLWECGSGETIHSF 228

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 76/189 (40%), Gaps = 35/189 (18%)

Query: 313 FKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKA--IYFDGQ 368
            +GH   +  ++F  +  +L +GS D  + +W    G   R L GH   V A  I   G+
Sbjct: 144 LEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGR 203

Query: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSD------------SVLSVDSYKKIIVSGSAD 416
            +++ S D  +++W   +G  + ++   +D            S  S +   + +  G+A 
Sbjct: 204 NVMSSSKDGSLKLWECGSGETIHSFARKTDQSDPVNDMLILCSPGSSEDGSRHLEFGTAG 263

Query: 417 KTVKVWHVESRTCY--------TLRGHTEW--------VGTVKLHPKSFT---CFSGSDD 457
           KTV   H      Y        T     ++          T + HP S +    ++G D+
Sbjct: 264 KTVFAGHNSGFISYHDIRSKDLTFELPNQFESPCCSLASSTSQFHPASQSPVFLYAGYDN 323

Query: 458 TTIRMWDIR 466
            T+  WDIR
Sbjct: 324 GTVAQWDIR 332

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 57/160 (35%), Gaps = 43/160 (26%)

Query: 399 SVLSVDSYKK----IIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSG 454
           S   +D Y+     +  +G     + ++  ++    TL GH   +  VK  P      SG
Sbjct: 107 SFTCIDQYESDGDYLYATGDQGGIISIYDSQAEVTRTLEGHYAEITDVKFFPSGEVLLSG 166

Query: 455 SDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDP 514
           S D  +++W     +  +  +GH      V  L I+D             RN        
Sbjct: 167 SADMQLKVWSTLDGSNPRTLKGH---TSTVTALGIIDRG-----------RN-------- 204

Query: 515 PDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT 554
                            ++S S D ++KLWE  +G+ + +
Sbjct: 205 -----------------VMSSSKDGSLKLWECGSGETIHS 227

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 550 KCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
           +  RT  GH   I D+        ++SG+ D  +KVW    G    T   H + +T +GI
Sbjct: 139 EVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGI 198

Query: 608 GD 609
            D
Sbjct: 199 ID 200

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 92/233 (39%), Gaps = 46/233 (19%)

Query: 303 WRKGTAHIQEFKGHMDGVLSLQFNYRLLFTGSYD--STVAIWDLATGKLVRRL----TGH 356
           W K  A +     H   ++S+++N       S D  +   +W++ +G +++      TG 
Sbjct: 247 WNKTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTVMQHFELKETGG 306

Query: 357 RD------------GVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSD--SVLS 402
                         GV   + D  K +       I V+            GH    SVL 
Sbjct: 307 SSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITEKTPTGKLIGHHGPISVLE 366

Query: 403 VDSYKKIIVSGSADKTVKVWH---VESRTCYTLRGHTE------WVGTVKLHPKSFTCFS 453
            +   K+++S S D T+++WH     S+ C+   GH++      WVG  K+        S
Sbjct: 367 FNDTNKLLLSASDDGTLRIWHGGNGNSQNCF--YGHSQSIVSASWVGDDKV-------IS 417

Query: 454 GSDDTTIRMWDIRSNTC--------VKVFRGHVGQVQKVLPLTILDTENLVTD 498
            S D ++R+W ++ NT         V +F G + Q  +   +  +D +  V D
Sbjct: 418 CSMDGSVRLWSLKQNTLLALSIVDGVPIFAGRISQDGQKYAVAFMDGQVNVYD 470

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA-ADNFRIVSGAHDKTVKVWDLQ 587
           LLS S D T+++W    G      +GH + I   +   + +++S + D +V++W L+
Sbjct: 374 LLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVISCSMDGSVRLWSLK 430

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 88/195 (45%), Gaps = 20/195 (10%)

Query: 339 VAIWDLATGKLV--RRLTGHRD-----GVKAIYFDGQKLITGSLDRMIRVWNYVTGACVA 391
           V I DL TGK+V  ++L G R       +K I     ++  G++     VW+      + 
Sbjct: 115 VLITDL-TGKVVEEKKLVGERSILYSGSIKVISESEVQINAGTVMGGAIVWDLYKEELIH 173

Query: 392 AYPGHSDSVLSVDS--YKKIIVSGSADKTVKVWHVESRTCYTLR-GHTEWVGTVKLHPKS 448
              GH  S+  + S  + K+I S S D+++++W  E+    ++   HT  +  +K     
Sbjct: 174 NLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNND 233

Query: 449 FTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEA 508
               S S+D T R+W+I  N       G+  Q+  +    +L  +N+     +D  R  A
Sbjct: 234 ENLVSVSEDCTCRVWNIIPND----ISGYELQISNIFEGHLL--KNVWGVDVNDEKRIIA 287

Query: 509 TTAQDPPDGQLSALD 523
           T+     DG+++ +D
Sbjct: 288 TSGN---DGRINVID 299

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF--RIVSGAHDKTVKVWDL 586
           + SCS D +I+LW+  TGK +   + H   IW++   N    +VS + D T +VW++
Sbjct: 194 IASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNI 250

>Kwal_27.10385
          Length = 536

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 5/104 (4%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWH 423
           D   ++TGS+D  +R++    G CVA    H+  V  V  D   + I S SAD++V V+ 
Sbjct: 147 DDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWDPQNEFIFSQSADRSVHVYR 206

Query: 424 VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467
           +E     ++ G      T K+      C    D T + + +++S
Sbjct: 207 IEKTPSGSISGLKL---TNKITRGDLPCRKSKDSTELELDNVKS 247

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 40/65 (61%), Gaps = 6/65 (9%)

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRT---HFGHVEG-IWDIAADNFRIVSGAHDKTVK 582
           P  +++++ S+DN+++++EV  G CV     H  +V+G +WD    N  I S + D++V 
Sbjct: 146 PDDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWD--PQNEFIFSQSADRSVH 203

Query: 583 VWDLQ 587
           V+ ++
Sbjct: 204 VYRIE 208

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 62/177 (35%), Gaps = 34/177 (19%)

Query: 324 QFNYRLLFTGSYDSTVAIWDLA----------TGKLVRRLTGHRDGVKAIYFDGQK--LI 371
           Q   R L T   D+ + +W L           T   +  LT H   V  I F+ +   L 
Sbjct: 28  QHRIRRLVTAGGDNKIRVWQLNFEEQNENKVDTIDFLSSLTQHEQAVNVIRFNSRNDVLA 87

Query: 372 TGSLDRMIRVWNYVTGACVAAYPGHSDSV---LSVDSYKKIIVSGSADKTVKVWHVESRT 428
           T   D  + +W              +DS+     VD  +      S       W+V  R 
Sbjct: 88  TAGDDGQLLLWK------------RNDSISKEFGVDEEEFAEFKES-------WYVWKRL 128

Query: 429 CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVL 485
             +    +  +  +   P      +GS D ++R++++   TCV     H   VQ V+
Sbjct: 129 RSSSTAGSSEIYDLAWSPDDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVV 185

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 42/88 (47%), Gaps = 20/88 (22%)

Query: 355 GHRDGVKAI---YFDGQKLITGSLDRMIRVWNY---------------VTGACVAAYPGH 396
           GHRDGV AI   Y    KL TGS D +I+ WN                VTG CV   P  
Sbjct: 65  GHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQ-PRF 123

Query: 397 SDSVLSVDSYKKIIVSGSADKTVKVWHV 424
            D    + S +  ++S S DKTVK+W +
Sbjct: 124 HDKKPDLKS-QNFMLSCSDDKTVKLWSI 150

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 72/158 (45%), Gaps = 14/158 (8%)

Query: 318 DGVLSLQFNYR----LLFTGSYDSTVAIWDLATGKLVRRL--TGHRDGVKAIYFDGQKLI 371
           D + SL+FN      L  TGS D+++ ++DL T    +++  T   + +     +    +
Sbjct: 220 DNITSLKFNQNETDILASTGS-DNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFV 278

Query: 372 TGSLDRMIRVWNYVT-GACVAAYPGHSDSVLSVD--SYKKIIVSGSADKTVKVW---HVE 425
           T + D     ++       +  +  H  +V+ VD       IV+GS DK+++++   H  
Sbjct: 279 TANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGH 338

Query: 426 SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
           SR  Y  +   + V  VK    S    SGSDD  +R+W
Sbjct: 339 SREIYHTK-RMQHVFQVKYSMDSKYIISGSDDGNVRLW 375

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 15/70 (21%)

Query: 532 LLSCSLDNTIKLWEVRTGK---CVRTHFGHVEGIW-----------DIAADNFRIVSGAH 577
           L + S D  IK W + T +     + H+G V G+            D+ + NF ++S + 
Sbjct: 83  LATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNF-MLSCSD 141

Query: 578 DKTVKVWDLQ 587
           DKTVK+W + 
Sbjct: 142 DKTVKLWSIN 151

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 17/87 (19%)

Query: 395 GHSDSVLSV-DSYKKI--IVSGSADKTVKVWHVESRTCY-TLRGHTEWVGTV-----KLH 445
           GH D V ++  +Y  +  + +GSAD  +K W++ +R  + + + H   V  +     + H
Sbjct: 65  GHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFH 124

Query: 446 PK-------SFTCFSGSDDTTIRMWDI 465
            K       +F   S SDD T+++W I
Sbjct: 125 DKKPDLKSQNF-MLSCSDDKTVKLWSI 150

>YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component of
           U3 snoRNP (renamed small subunit processome) which is
           required for 18S biogenesis, has WD (WD-40) repeats
           [1542 bp, 513 aa]
          Length = 513

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 92/200 (46%), Gaps = 18/200 (9%)

Query: 303 WRKGTAHIQEFKGHMDGVLSLQFN--YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV 360
           WR+ T+  Q  K H + V  + FN  +   F  +  + V I+   T ++++  +  +D V
Sbjct: 27  WRQYTS-AQLVKEH-NSVTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFKDVV 84

Query: 361 KAIYF--DGQKLITGSLDRMIRVWNYVTGACV------AAYPGHSDSVLSVDSYKKIIVS 412
            +  F  DG+ L  G    ++ V++      +      + +P H     + D+  KI+ +
Sbjct: 85  YSASFRSDGKLLCAGDATGLVSVYDSYNPRTILLSINASTHPTHVTKFHTQDN--KILAT 142

Query: 413 GSADKTVKVWHVES--RTCYTLRGHTEWVGTVKLHPKS-FTCFSGSDDTTIRMWDIRSNT 469
            S D+  ++W + +       L G T++V T+   P +     +GS D  IR++D RS+ 
Sbjct: 143 ASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHLVATGSYDGLIRLYDTRSSG 202

Query: 470 CVKVFR-GHVGQVQKVLPLT 488
              ++   H   V+ V+ ++
Sbjct: 203 STPIYSLNHDQPVENVIAVS 222

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 38/82 (46%), Gaps = 2/82 (2%)

Query: 526 LPYPSHLLSC-SLDNTIKLWEVRT-GKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKV 583
           +P   HL++  S D  I+L++ R+ G        H + + ++ A +   +        KV
Sbjct: 177 IPAAPHLVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVENVIAVSPTQIVSCGGNNFKV 236

Query: 584 WDLQSGKCIHTFDSHQAPITCV 605
           WDL S K ++   +    +TC+
Sbjct: 237 WDLTSNKKLYERGNFNKAVTCL 258

>Kwal_33.15475
          Length = 783

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 67/154 (43%), Gaps = 15/154 (9%)

Query: 335 YDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK-----LITGSLDRMIRVWNYVTGAC 389
           Y  T+    L   +L   L GH D VKA+ F  +      L TGS DR IR+W   T   
Sbjct: 176 YSFTLQDGTLNNFQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYIRLWRIRTNEL 235

Query: 390 VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCY--TLRGHTEWVGTVKLHPK 447
           +     +SD     D +K  ++     K      ++    +   + GH +W+  +K H +
Sbjct: 236 I----DNSDE----DEFKLNLLGNKQSKFFITPDLKVAINFDALIVGHDDWISCLKWHKE 287

Query: 448 SFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
                + + DT + +W+  +++ V +    +G++
Sbjct: 288 RPQLLASTADTAVMVWEPDADSGVWICASRLGEL 321

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 47/114 (41%), Gaps = 12/114 (10%)

Query: 329 LLFTGSYDSTVAIW---DLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWN 383
           L F G    T+A+W   D A   + R L GH   V  + F      +++ S D  +R+W 
Sbjct: 27  LAFAGG--KTIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWA 84

Query: 384 YVTG-----ACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTL 432
           +         CV     H  ++ S+     I+  G AD +V +W  E+     L
Sbjct: 85  FEEKDQDALKCVQVIDHHKHTITSLSVISNILSVGCADGSVSLWLTENNQAILL 138

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 9/77 (11%)

Query: 410 IVSGSADKTVKVWH----VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW-- 463
           I++ +  KT+ +W            TL+GH   V  VK  P +    S S+D+ +R+W  
Sbjct: 26  ILAFAGGKTIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAF 85

Query: 464 ---DIRSNTCVKVFRGH 477
              D  +  CV+V   H
Sbjct: 86  EEKDQDALKCVQVIDHH 102

>Kwal_27.12586
          Length = 509

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 62/158 (39%), Gaps = 12/158 (7%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTG 387
             TG     + +W     KL      H+  +  I +  D    +T  +D +  VWN  TG
Sbjct: 221 FLTGVESGEIRLW-THDAKLQNAFDFHKSSIVTIKWNSDATHFLTYDVDNVAIVWNAQTG 279

Query: 388 ACVAAYP----GHSDSVLSVDSY----KKIIVSGSADKTVKVWHVESRTCYTLRGHTEWV 439
             +  +     G  DS L VD+      K ++ G           ESR    L GH+  +
Sbjct: 280 TALQQFSFRENGTVDS-LGVDASWIGPDKFVIPGPQGSIYICGMGESRPLGKLNGHSATI 338

Query: 440 GTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477
                + ++    SGSDD T+R+W   S +    F G+
Sbjct: 339 TAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGN 376

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 57/124 (45%), Gaps = 11/124 (8%)

Query: 310 IQEFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV-KAIYFD 366
           + +  GH   + +  FN    +L +GS D T+ +W   +        G+  G+  A + D
Sbjct: 328 LGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFWID 387

Query: 367 GQKLITGSLDRMIRVWNYVTG-----ACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKV 421
             K+I  SLD  +R+W+++T      + V   P    S LS D  K  I  G  D  V V
Sbjct: 388 DDKVIATSLDGSVRLWSHLTNTLQAISMVDGVPIFCGS-LSPDKLKFAI--GKMDGEVTV 444

Query: 422 WHVE 425
           +++E
Sbjct: 445 YNIE 448

>Scas_706.24
          Length = 460

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 66/142 (46%), Gaps = 11/142 (7%)

Query: 328 RLLFTGSYDSTVAIWDLA--TGKLVRRLT--GHRDGVKAIYFD--GQKLITGSLDRMIRV 381
           + +F G     +A+ +++  TG++  +L    HR  +  I  D  G+ +ITGS D    +
Sbjct: 216 KFIFIGFRSGKLALLEVSDDTGEMTFKLIVQAHRSAISVIKMDPVGRFVITGSTDGSCAL 275

Query: 382 WNYVTGACVAAYPGHSDSVLS--VDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWV 439
           W+  T  C         +V+S  VD   KI+   S D  V+ +++   T +      ++ 
Sbjct: 276 WDTSTLTCSLIIDDMEGAVISMDVDHLGKILAVCSTDDLVRFYNINDGTLWKTENMQKFN 335

Query: 440 G--TVKLHP-KSFTCFSGSDDT 458
               V+ +P KS+   SG +DT
Sbjct: 336 SELVVRFYPRKSWFILSGENDT 357

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 43/106 (40%), Gaps = 12/106 (11%)

Query: 388 ACVAAYPGHS-----DSVLSV--DSYKKIIVSGSADKTVKVWHVESRTC-----YTLRGH 435
           + VA+ P HS     D++ S+  D+  K I  G     + +  V   T        ++ H
Sbjct: 189 SMVASLPVHSISDENDTIYSISWDNSGKFIFIGFRSGKLALLEVSDDTGEMTFKLIVQAH 248

Query: 436 TEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
              +  +K+ P      +GS D +  +WD  + TC  +     G V
Sbjct: 249 RSAISVIKMDPVGRFVITGSTDGSCALWDTSTLTCSLIIDDMEGAV 294

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 35/78 (44%), Gaps = 2/78 (2%)

Query: 390 VAAYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKS 448
           V  Y  H   VL +D S    ++S S DKT K+WH           H ++V  VK HP  
Sbjct: 405 VRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQHPDFVTCVKFHPTD 464

Query: 449 FTCF-SGSDDTTIRMWDI 465
              F SG  D   R+W I
Sbjct: 465 DRFFISGCLDQKCRLWSI 482

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 7/69 (10%)

Query: 552 VRTHFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI-- 607
           VRT+  H+  + D+  + +NF ++S + DKT K+W     + + +F  H   +TCV    
Sbjct: 405 VRTYKEHLHDVLDMDWSKNNF-LISASMDKTAKLWHPSKMRSLKSF-QHPDFVTCVKFHP 462

Query: 608 -GDSEFVSG 615
             D  F+SG
Sbjct: 463 TDDRFFISG 471

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNF--RIVSGAHDKTVKVWDLQSG 589
           + SC+ D+   +W    G+ + T  GH+  IW I  D F    V+G+ D +VK+W +  G
Sbjct: 25  IFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDG 84

Query: 590 KCIHTF 595
             ++T+
Sbjct: 85  SNVYTW 90

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 5/89 (5%)

Query: 353 LTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS--VDSYKK 408
           L GH   +  + +  +G  + + + D +  VW  + G  +  + GH  ++ S  VD + +
Sbjct: 6   LKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTE 65

Query: 409 IIVSGSADKTVKVWHV-ESRTCYTLRGHT 436
             V+GSAD +VK+W V +    YT +  T
Sbjct: 66  YAVTGSADFSVKLWKVCDGSNVYTWKTKT 94

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 4/82 (4%)

Query: 313 FKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQ 368
            KGH   +  +++N    L+F+ + DS  ++W    G+ +    GH   + +I  D   +
Sbjct: 6   LKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTE 65

Query: 369 KLITGSLDRMIRVWNYVTGACV 390
             +TGS D  +++W    G+ V
Sbjct: 66  YAVTGSADFSVKLWKVCDGSNV 87

>Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement
          Length = 569

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 91/230 (39%), Gaps = 52/230 (22%)

Query: 423 HVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQ 482
           ++E    +    HT  V  ++L+ K     SG  D  I  WD+ +  CV  F+G V Q+ 
Sbjct: 263 YMEGSISHYFSKHTSVVNQLRLNDKEDKFISGGWDKQILEWDLNTGDCVNEFKGSVAQLS 322

Query: 483 KV--LPL-TILDTENLVTD----------------------------------RTSDPPR 505
            +   PL + +D ++LV                                    ++ D  R
Sbjct: 323 SLEFRPLFSTVDIDSLVEKEPFQKQEQIQQKDDDMDSLFGDEDEEEKRMDLDTQSDDRNR 382

Query: 506 NEATTAQDPPDGQL-SALDDSLPYPSHLLSCSLDNTIKLWEVRT--GKCVRTHFGHVEGI 562
            E  + Q+     L ++ D+S+      L+ S++ +I +W+ RT     V    G     
Sbjct: 383 QEKQSMQEISKNTLKTSCDESI-----FLTSSINGSIHVWDRRTPAKPVVGLQRGPQVPP 437

Query: 563 WDIAA----DNFRIVSGAHDKTVKVWDLQSG---KCIHTFDSHQAPITCV 605
           W ++A    D  RI +G  +  V+ +DL+ G        F S   P++CV
Sbjct: 438 WCMSACWSMDGDRIYAGRRNAVVEEFDLKMGVKPSKTLKFPSISGPVSCV 487

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 62/122 (50%), Gaps = 9/122 (7%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRR--LTGHRDGVKAIYF 365
           +++F+GH   + +L+F  + +   + S+D +V IWD  TGK+  R  L      V++   
Sbjct: 199 LRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPT 258

Query: 366 DGQKLITG-SLDRMIRVWNYVT--GACVAAYPGHSDSVLSVDSYK--KIIVSGSADKTVK 420
           +  + I G S  +++   + V+     V  Y  H  S+L++  +      +S S DKTV+
Sbjct: 259 NPHEFIVGLSNSKILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVR 318

Query: 421 VW 422
           +W
Sbjct: 319 IW 320

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 85/215 (39%), Gaps = 51/215 (23%)

Query: 384 YVTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVW--HVESRTCYTLRGHTEW 438
           Y+    +  YPGH +   ++    K   +I+SG  D T+K+W  + +       +GH + 
Sbjct: 149 YLPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKP 208

Query: 439 VGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTD 498
           +  ++      +  S S D ++++WD  +           G+V+  L L    T   V  
Sbjct: 209 IKALRFTEDCQSFLSSSFDRSVKIWDTET-----------GKVKTRLHLN--STPADVES 255

Query: 499 RTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNT-IKLWEVRTGK---CVRT 554
           R ++P                           H     L N+ I  ++ R  +    V+T
Sbjct: 256 RPTNP---------------------------HEFIVGLSNSKILHYDDRVSENQGLVQT 288

Query: 555 HFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQ 587
           +  H+  I  +    D  + +S + DKTV++W+ Q
Sbjct: 289 YDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQ 323

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 8/97 (8%)

Query: 526 LPYPSHL-LSCSLDNTIKLWEV-RTGKCVRTHFGHVEGI--WDIAADNFRIVSGAHDKTV 581
           LP   HL LS   D+TIK+W+     +C+R   GH + I       D    +S + D++V
Sbjct: 171 LPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSV 230

Query: 582 KVWDLQSGKC---IHTFDSHQAPITCVGIGDSEFVSG 615
           K+WD ++GK    +H  +S  A +        EF+ G
Sbjct: 231 KIWDTETGKVKTRLH-LNSTPADVESRPTNPHEFIVG 266

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 86/228 (37%), Gaps = 61/228 (26%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE 425
           D Q+L TG LD  IR+W+       A+ P                 + S DK + +    
Sbjct: 28  DSQRLATGGLDGKIRIWSIPDILKFASNP-----------------NASTDKDILM---- 66

Query: 426 SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVL 485
            +   T+  H   V TVK  P      SGSDD  + +W++   T   +F           
Sbjct: 67  -KPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAEST------ 119

Query: 486 PLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSL------PYPSHLLSCSLDN 539
                D E+    R                  +L A D+ +      P  S ++S  LD 
Sbjct: 120 -----DIEHWNVRR------------------RLVAHDNDIQDICWAPDSSIMVSVGLDR 156

Query: 540 TIKLWEVRTGKCVR---THFGHVEGIWDIAADNFRIVSGAHDKTVKVW 584
            I +W   T + V+    H  HV+G+    A+ +   + + D+T+K++
Sbjct: 157 AIIIWNGSTFEKVKRFDVHQSHVKGVVFDPANKY-FATASDDRTIKMF 203

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNY 384
           ++ +   D  + IW+ +T + V+R   H+  VK + FD   +   T S DR I+++ Y
Sbjct: 148 IMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFRY 205

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 69/193 (35%), Gaps = 38/193 (19%)

Query: 309 HIQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLA-----------------TGKLVR 351
           H +E K +      +  + + L TG  D  + IW +                    K + 
Sbjct: 11  HREEHKSYEVYTCDVSPDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLS 70

Query: 352 RLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKK- 408
            ++ H   V  + F  DG+ L +GS DR++ +W    G     +   S  +   +  ++ 
Sbjct: 71  TMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRL 130

Query: 409 -----------------IIVSGSADKTVKVWHVES-RTCYTLRGHTEWVGTVKLHPKSFT 450
                            I+VS   D+ + +W+  +         H   V  V   P +  
Sbjct: 131 VAHDNDIQDICWAPDSSIMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHVKGVVFDPANKY 190

Query: 451 CFSGSDDTTIRMW 463
             + SDD TI+M+
Sbjct: 191 FATASDDRTIKMF 203

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 71/165 (43%), Gaps = 18/165 (10%)

Query: 329 LLFTGSYDSTVAIWDLATG-------KLVRRLTGHRDGVKAIYF----DGQKLI-TGSLD 376
           +L  G  +  V I+ L +        +   +L GH D +K++ F     G  L+ +GS D
Sbjct: 166 ILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETVPGDYLLASGSQD 225

Query: 377 RMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHT 436
           R IR+W   T   +       +  L++ S K      SAD      HV       + GH 
Sbjct: 226 RYIRLWRIRTNEKIDT-SEEDEKKLTLLSNKIYKFDISADV-----HVAINFEALIMGHD 279

Query: 437 EWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQV 481
           +W+ +++ H       + + DT + +W+  + + + +    +G++
Sbjct: 280 DWISSLQWHKTKLQLLTSTADTAVMVWEPDTISGIWICSSRLGEL 324

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 68/203 (33%), Gaps = 72/203 (35%)

Query: 338 TVAIW---DLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVT------ 386
           T+A+W   D +   + + L GH   V  + F      +++ S D  +RVWN+        
Sbjct: 34  TIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREGHM 93

Query: 387 --GACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVW---------------------- 422
               C+     H  ++      K ++V G AD ++ VW                      
Sbjct: 94  DEVECIQVIKHHKHTITVFAVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPL 153

Query: 423 ----HVESRTCYTL------------------------------RGHTEWVGTVKLH--- 445
               H   +T + L                               GH +W+ ++      
Sbjct: 154 CLSMHEIEKTQFILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETV 213

Query: 446 PKSFTCFSGSDDTTIRMWDIRSN 468
           P  +   SGS D  IR+W IR+N
Sbjct: 214 PGDYLLASGSQDRYIRLWRIRTN 236

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 410 IVSGSADKTVKVWHVESRTCY----TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           +V+  A KT+ +W     + +    TL+GHT  V  V+    +    S S+D  +R+W+ 
Sbjct: 26  VVAYGAGKTIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNF 85

Query: 466 RSNTCVKVFRGHVGQVQ 482
                 K+  GH+ +V+
Sbjct: 86  P-----KLREGHMDEVE 97

>Scas_670.21
          Length = 595

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 73/175 (41%), Gaps = 27/175 (15%)

Query: 310 IQEFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG 367
            +    H   V  LQ+N     L +G  D+ V ++D  +   + +   H+  VKA+ +  
Sbjct: 407 FERLNTHSQEVCGLQWNTEENKLASGGNDNVVCVYDGTSRNPMIKFIEHKAAVKALAWSP 466

Query: 368 QK---LITG--SLDRMIRVWNYVTG-----------ACVAAYPGHSDSVLSVDSYKKIIV 411
            K   L TG  ++DR +++WN  T             C   +  ++D +++   Y K  +
Sbjct: 467 HKRGILATGGGTVDRRLKIWNVNTSMKLSDVDTGSQVCNMIWSKNTDEIVTSHGYSKYHL 526

Query: 412 SGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           +        +W   +      L+GH+  V  + L     T  SG+ D T+R W +
Sbjct: 527 T--------LWDYPTMNPVAILKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKL 573

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 102/266 (38%), Gaps = 47/266 (17%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNY-VTGA 388
           L  G  +  V I+D+   K VR L+GH D V  + ++G  L +GS D  I   +  +   
Sbjct: 346 LAVGQGNGLVEIYDVVKRKCVRTLSGHVDRVACLSWNGHILTSGSRDHNILHRDVRMPDP 405

Query: 389 CVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLH 445
                  HS  V  L  ++ +  + SG  D  V V+   SR        H   V  +   
Sbjct: 406 FFERLNTHSQEVCGLQWNTEENKLASGGNDNVVCVYDGTSRNPMIKFIEHKAAVKALAWS 465

Query: 446 PKS---FTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD 502
           P          G+ D  +++W++  NT +K              L+ +DT + V +    
Sbjct: 466 PHKRGILATGGGTVDRRLKIWNV--NTSMK--------------LSDVDTGSQVCNMIWS 509

Query: 503 PPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI 562
              +E  T+                Y  + L+        LW+  T   V    GH   +
Sbjct: 510 KNTDEIVTSHG--------------YSKYHLT--------LWDYPTMNPVAILKGHSFRV 547

Query: 563 --WDIAADNFRIVSGAHDKTVKVWDL 586
               ++AD   +VSGA D+T++ W L
Sbjct: 548 LHLTLSADGTTVVSGAGDETLRYWKL 573

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 62/125 (49%), Gaps = 8/125 (6%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDL-ATGKLVRRLTGHRDGVKAIYFDGQ 368
           ++   GH+D V  L +N  +L +GS D  +   D+        RL  H   V  + ++ +
Sbjct: 366 VRTLSGHVDRVACLSWNGHILTSGSRDHNILHRDVRMPDPFFERLNTHSQEVCGLQWNTE 425

Query: 369 --KLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVS---GSADKTVKV 421
             KL +G  D ++ V++  +   +  +  H  +V  L+   +K+ I++   G+ D+ +K+
Sbjct: 426 ENKLASGGNDNVVCVYDGTSRNPMIKFIEHKAAVKALAWSPHKRGILATGGGTVDRRLKI 485

Query: 422 WHVES 426
           W+V +
Sbjct: 486 WNVNT 490

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTV 581
           SHL     +  +++++V   KCVRT  GHV+ +  ++ +   + SG+ D  +
Sbjct: 344 SHLAVGQGNGLVEIYDVVKRKCVRTLSGHVDRVACLSWNGHILTSGSRDHNI 395

>Scas_702.16
          Length = 816

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 91/224 (40%), Gaps = 50/224 (22%)

Query: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVE 425
           DG+++ TG LD  IR+W                   SVDS K+I+   S    V +    
Sbjct: 28  DGKRVATGGLDGKIRIW-------------------SVDSIKQIVKILSLKDEVPIDKEL 68

Query: 426 SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVK-VFRGHVGQVQKV 484
            +   ++  HT  V  +K  P      SGSDD  + +W +     ++ +F G   + +  
Sbjct: 69  KKPLASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERWA 128

Query: 485 LPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLW 544
           +   ++  +N + D    P                   D SL     L+S  LD  + +W
Sbjct: 129 VRKRLVAHDNDIQDICWAP-------------------DSSL-----LVSVGLDRAVIIW 164

Query: 545 EVRTGKCVR---THFGHVEG-IWDIAADNFRIVSGAHDKTVKVW 584
              T + ++    H  HV+G I+D A   F   + + D+T+K++
Sbjct: 165 NGITFEKLKRFDVHQSHVKGVIFDPANKYF--ATASDDRTMKIF 206

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGSLDRMIRVWNY 384
           LL +   D  V IW+  T + ++R   H+  VK + FD   +   T S DR ++++ Y
Sbjct: 151 LLVSVGLDRAVIIWNGITFEKLKRFDVHQSHVKGVIFDPANKYFATASDDRTMKIFRY 208

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 77/201 (38%), Gaps = 44/201 (21%)

Query: 423 HVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQ 482
           H+E    Y +        TV + P      +G  D  IR+W + S          + Q+ 
Sbjct: 11  HIEESRSYEIY-------TVDVSPDGKRVATGGLDGKIRIWSVDS----------IKQIV 53

Query: 483 KVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIK 542
           K+L L     + +  D+    P    +       G ++ L  S P   +L S S D  + 
Sbjct: 54  KILSLK----DEVPIDKELKKPLASMSRHT----GSVTCLKFS-PNGKYLASGSDDRILL 104

Query: 543 LWEVRTGKCVRTHFG----------------HVEGIWDI--AADNFRIVSGAHDKTVKVW 584
           +W +   + ++  FG                H   I DI  A D+  +VS   D+ V +W
Sbjct: 105 IWTLDEERPIQPIFGGESEKERWAVRKRLVAHDNDIQDICWAPDSSLLVSVGLDRAVIIW 164

Query: 585 DLQSGKCIHTFDSHQAPITCV 605
           +  + + +  FD HQ+ +  V
Sbjct: 165 NGITFEKLKRFDVHQSHVKGV 185

>KLLA0B11077g complement(970761..972464) similar to sgd|S0006341
           Saccharomyces cerevisiae YPR137w RRP9 protein associated
           with the U3 small nucleolar RNA, required for
           pre-ribosomal RNA processing, start by similarity
          Length = 567

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 70/320 (21%), Positives = 121/320 (37%), Gaps = 73/320 (22%)

Query: 280 ETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFK--------GHMDGVLSLQF--NYRL 329
           + T  K RP KV Y          + G  +I E K        GH D +L++    + + 
Sbjct: 196 DVTDFKARPKKVKY---------VKGGRKYIPEGKFEYENVTEGHYDEILTVAASPDGKY 246

Query: 330 LFTGSYDSTVAIWDLATGKLVRRL-TGHRDG-VKAIYF--DGQKLITGSLDRMIRVWNYV 385
           + +G  D  + +W   +   V+ + T  R G V  + F  +  +L     D  IR +   
Sbjct: 247 VVSGGRDRKLIVWSTESLAPVKIIPTKDRRGEVLGLAFKKNSDQLFAACADYKIRTYAIN 306

Query: 386 TGACVAAYPGHSDSVLSVDS--YKKIIVSGSADKTVKVWHVESRTCYTLRG-------HT 436
             + +    GH D V+ + +   ++ +  GS D+T  +W +   +  T RG         
Sbjct: 307 QFSQLEILYGHQDLVIDISALNMERCVTVGSRDRTAMLWKIADESRLTFRGGDDPERLRK 366

Query: 437 EWVGTVKLHPK-----------------SFTCFS---------GSDDTTIRMWDIRSNTC 470
           +W+   +L  +                 S  C S         GSD+  I +W +     
Sbjct: 367 KWLKNQQLSAEGGEDMHEQTPPHFYGEGSIDCISMVDDSHFVTGSDNGNISLWSLSKKKP 426

Query: 471 VKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNE----ATTAQDPPDGQLSALDDSL 526
           +   R   G    V+PL     +  ++   SD  RN      + AQ      L A    +
Sbjct: 427 LFTVRTAHG----VVPLV---EDKKISGEVSDELRNAQLQGGSIAQPFWITSLYA----V 475

Query: 527 PYPSHLLSCSLDNTIKLWEV 546
           PY    +S S + T+K+W++
Sbjct: 476 PYSDIFISGSWNGTLKVWKI 495

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 15/85 (17%)

Query: 355 GHRDGVKAI---YFDGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--------LSV 403
           GH+DGV  +   Y D  K+ +GS D +I+ W+  +   +A++  H  ++        +++
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNI 124

Query: 404 DSY----KKIIVSGSADKTVKVWHV 424
           DS     +  ++S S DKTVK+W V
Sbjct: 125 DSASSGNQNFVLSSSDDKTVKLWSV 149

 Score = 36.6 bits (83), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 557 GHVEGIWDIAA---DNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI 607
           GH +G++ +A    D  +I SG+ D  +K WD+ S + I +F +H   IT + I
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCI 118

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 99/251 (39%), Gaps = 41/251 (16%)

Query: 395 GHSDSVLSV-DSYKKI--IVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPK--- 447
           GH D V  +   Y  +  I SGS D  +K W + SR    + + H   +  + + PK   
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNI 124

Query: 448 --------SFTCFSGSDDTTIRMWDIR--------SNTCVKVFRGHVGQVQKVLPLTILD 491
                   +F   S SDD T+++W +         ++  +    G +           LD
Sbjct: 125 DSASSGNQNF-VLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLD 183

Query: 492 TENLVTDRTSDPPR-NEATTAQDPPDGQLSALDDSLPY-------PSHLLSCSLDNTIKL 543
              + ++  +  PR N     +  P   LS   D++          + L S   DN+I L
Sbjct: 184 HSRMTSNFVTGGPRINLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVL 243

Query: 544 WEVRTG----KCVRTHFGHVEGI-WDIAADNFRIVSGAHDKTVKVWDLQS-GKCIHTFDS 597
           +++RT     K V+T    V  + W+   + F  V  + D     +D+++  + ++ F  
Sbjct: 244 YDLRTNSATQKIVQTM--RVNSMCWN-PMEAFNFVVASEDHNAYYYDMRNMSRALNVFKD 300

Query: 598 HQAPITCVGIG 608
           H + +  V I 
Sbjct: 301 HVSAVMDVDIS 311

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 75/162 (46%), Gaps = 22/162 (13%)

Query: 318 DGVLSLQFNYR---LLFTGSYDSTVAIWDL----ATGKLVRRLTGHR---DGVKAIYFDG 367
           D + +++FN     +L +   D+++ ++DL    AT K+V+ +  +    + ++A  F  
Sbjct: 217 DNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKIVQTMRVNSMCWNPMEAFNF-- 274

Query: 368 QKLITGSLDRMIRVWNYVTGA-CVAAYPGHSDSVLSVD--SYKKIIVSGSADKTVKVWHV 424
              +  S D     ++    +  +  +  H  +V+ VD     + +V+ S DKT++++ +
Sbjct: 275 ---VVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPTGEEVVTASYDKTIRIFPI 331

Query: 425 E---SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMW 463
               SR  Y  +   + V   K    S    SGSDD  +R+W
Sbjct: 332 NKGHSREIYHTK-RMQHVFQAKFSMDSKYVMSGSDDGNVRLW 372

>Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement
          Length = 587

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 79/173 (45%), Gaps = 21/173 (12%)

Query: 311 QEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATG--KLVRRLTGHRDGVKAIYF--D 366
           QE  G + G LS + +   L +GS D++V IWD  T   + V+R   H   VKAI +  D
Sbjct: 372 QEHSGEVCG-LSYRKDGLQLASGSNDNSVMIWDTRTSMPQFVKR--NHTAAVKAISWCPD 428

Query: 367 GQKLIT---GSLDRMIRVWNYVTGACVAAYPGHS--DSVLSVDSYKKIIVS-------GS 414
              L+    G  D+ I  WN  TGA V++    S   S+    SY   I++       G+
Sbjct: 429 VPNLLATGGGQTDKYIHFWNTTTGARVSSINTGSQVSSLQWGQSYNGDIMNREIVATGGN 488

Query: 415 ADKTVKVWHVESR--TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
            +  + V++ E+R      ++ H   + + +L P   T  +   D  ++ + +
Sbjct: 489 PENAISVYNYETRFKVAEIVQAHDSRICSSQLSPDGTTLATVGGDENLKFYKV 541

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 63/149 (42%), Gaps = 26/149 (17%)

Query: 333 GSYDSTVAIWDLATGKLVRRL-------TGHRDGVKAIYFDGQKLITGSLD-RMIRVWNY 384
           G  D    IWD+ T  LVR +        G +  +  +   G K  +G +    +R+ N+
Sbjct: 309 GKSDGNTEIWDVETMSLVRTMRSGLGVRIGSQSWLDTLVACGTK--SGEIQINDVRIKNH 366

Query: 385 VTGACVAAYPGHSDSVLSVDSYKK---IIVSGSADKTVKVWHVESRTC---YTLRGHTEW 438
           +    V+A+  HS  V  + SY+K    + SGS D +V +W  ++RT    +  R HT  
Sbjct: 367 I----VSAWQEHSGEVCGL-SYRKDGLQLASGSNDNSVMIW--DTRTSMPQFVKRNHTAA 419

Query: 439 VGTVKL---HPKSFTCFSGSDDTTIRMWD 464
           V  +      P       G  D  I  W+
Sbjct: 420 VKAISWCPDVPNLLATGGGQTDKYIHFWN 448

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 63/158 (39%), Gaps = 20/158 (12%)

Query: 454 GSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPP------RNE 507
           G  D    +WD+ + + V+  R  +G   ++   + LDT      ++ +        +N 
Sbjct: 309 GKSDGNTEIWDVETMSLVRTMRSGLGV--RIGSQSWLDTLVACGTKSGEIQINDVRIKNH 366

Query: 508 ATTAQDPPDGQLSALD---DSLPYPSHLLSCSLDNTIKLWEVRTGK---CVRTHFGHVEG 561
             +A     G++  L    D L     L S S DN++ +W+ RT       R H   V+ 
Sbjct: 367 IVSAWQEHSGEVCGLSYRKDGL----QLASGSNDNSVMIWDTRTSMPQFVKRNHTAAVKA 422

Query: 562 I-WDIAADNFRIVSGAH-DKTVKVWDLQSGKCIHTFDS 597
           I W     N     G   DK +  W+  +G  + + ++
Sbjct: 423 ISWCPDVPNLLATGGGQTDKYIHFWNTTTGARVSSINT 460

>KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305
           Saccharomyces cerevisiae YMR093w singleton, start by
           similarity
          Length = 520

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 96/207 (46%), Gaps = 27/207 (13%)

Query: 276 PVASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQFN--YRLLFTG 333
           PV +    ++T P      +R+     WR  ++  Q  K H + V  + FN  +   F  
Sbjct: 10  PVKAPVLPKQTTP-----EQRY-----WRSYSS-TQLVKEH-NAVTHIAFNPQHPHDFAV 57

Query: 334 SYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWN------YV 385
           +  + V ++   T ++++  +  +D V +  F  DG+ L+ G    ++ V++       +
Sbjct: 58  TSSTRVQVFSSRTRQVIKTFSRFKDVVHSATFRQDGKLLVAGDATGLVSVYDSYNPRTLL 117

Query: 386 TGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR--GHTEWVGTVK 443
                +++P H       D+  K +V+ + D+ V++W V      TL+  G +++V +V 
Sbjct: 118 LSIQASSHPTHVTKFHDQDN--KTLVTANDDRVVRLWDVSHAYEPTLQLTGASDYVRSVC 175

Query: 444 LHPKS-FTCFSGSDDTTIRMWDIRSNT 469
             P +     +GS D  +R++DIR+ +
Sbjct: 176 FVPNAPHMVATGSYDGVVRLYDIRTKS 202

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 526 LPYPSHLLSC-SLDNTIKLWEVRT-GKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKV 583
           +P   H+++  S D  ++L+++RT     +T   H   + DI A +   ++       KV
Sbjct: 177 VPNAPHMVATGSYDGVVRLYDIRTKSDKPQTTLDHGLPVEDITAISPTQLASCGGNGFKV 236

Query: 584 WDLQSGKCIHTFDSHQAPITCVG 606
           WDL S + +    +    +TC+ 
Sbjct: 237 WDLTSDRALCERQNFAKTVTCLN 259

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 13/128 (10%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF---- 365
           I  F+ H   V +L  + R L +GS D  + I+DL   K +  L  H   + ++ F    
Sbjct: 34  IFHFQAHALSVKTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFSRAT 93

Query: 366 ---DGQK-----LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSY-KKIIVSGSAD 416
              DG++     L++ S D  I +W            GH+  +  +D +    + S S D
Sbjct: 94  TDKDGKQQGNKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSNRVASVSED 153

Query: 417 KTVKVWHV 424
            ++++W++
Sbjct: 154 HSIRLWNL 161

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 55/138 (39%), Gaps = 32/138 (23%)

Query: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512
           SGS+D  IR++D++    +     H G +      T L      TD+      N+     
Sbjct: 56  SGSNDEHIRIYDLQKRKELGTLLNHNGSI------TSLRFSRATTDKDGKQQGNKW---- 105

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNF 570
                              LLS S D+TI +W V+  +      GH   I   DI   N 
Sbjct: 106 -------------------LLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSN- 145

Query: 571 RIVSGAHDKTVKVWDLQS 588
           R+ S + D ++++W+L +
Sbjct: 146 RVASVSEDHSIRLWNLMT 163

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 23/34 (67%)

Query: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
           +VSG++D+ ++++DLQ  K + T  +H   IT +
Sbjct: 54  LVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSL 87

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 353 LTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKK 408
           L GH   +  + +  +G  + T   D +  VW  + G  +    GH+ S+  + VD + +
Sbjct: 6   LMGHERSLTQVKYNREGDLIFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTE 65

Query: 409 IIVSGSADKTVKVWHV 424
             V+GSAD +VKVW V
Sbjct: 66  YAVTGSADFSVKVWRV 81

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFR--IVSGAHDKTVKVWDLQSG 589
           + +   DN   +W    G+ + T  GH   IW I  D      V+G+ D +VKVW ++ G
Sbjct: 25  IFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTEYAVTGSADFSVKVWRVRDG 84

Query: 590 KCIHTFDS 597
              H++D+
Sbjct: 85  SIAHSWDT 92

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 315 GHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKL 370
           GH   +  +++N    L+FT   D+  ++W    G+ +  L GH   + +I  D   +  
Sbjct: 8   GHERSLTQVKYNREGDLIFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTEYA 67

Query: 371 ITGSLDRMIRVWNYVTGACVAAY 393
           +TGS D  ++VW    G+   ++
Sbjct: 68  VTGSADFSVKVWRVRDGSIAHSW 90

>Scas_660.8
          Length = 510

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 102/250 (40%), Gaps = 51/250 (20%)

Query: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGK---LVRRLTGHRDGVKAIY 364
           I+ F    D V S  F  + +LL  G     V+++D    +   L    + H   V   +
Sbjct: 74  IKTFSRFKDVVYSASFRSDGKLLVAGDATGLVSVYDSYNPRTILLSINASTHPTHVTKFH 133

Query: 365 -FDGQKLITGSLDRMIRVWN----YVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTV 419
             D + LIT S DR+IR+W+    Y     +     +  SV  V S   +IVSGS D  +
Sbjct: 134 PQDNKTLITASDDRVIRLWDISNAYQPQLELTGSTDYVRSVTCVPSAPHMIVSGSYDGII 193

Query: 420 KVWHVE---SRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVF-R 475
           +++      S   Y+L         + +         GS+    ++WD+ SN   K++ R
Sbjct: 194 RLYDTRASGSSPIYSLLHDQPIEDIISISATQIVSCGGSN---FKVWDLTSNK--KLYER 248

Query: 476 GHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSC 535
           G+  +      +T LD                           +S+LDDS P  S L++ 
Sbjct: 249 GNFNKT-----VTCLD--------------------------HVSSLDDS-PMNSALIAS 276

Query: 536 SLDNTIKLWE 545
           SLD  +K+++
Sbjct: 277 SLDGHVKVFD 286

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 90/233 (38%), Gaps = 43/233 (18%)

Query: 379 IRVWNYVTGACVAAYPGHSDSVLSVD--SYKKIIVSGSADKTVKVW-HVESRTCY-TLRG 434
           +++++  T   +  +    D V S    S  K++V+G A   V V+     RT   ++  
Sbjct: 63  VQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLVAGDATGLVSVYDSYNPRTILLSINA 122

Query: 435 HTEWVGTVKLHPK-SFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTE 493
            T      K HP+ + T  + SDD  IR+WDI SN             Q  L LT   + 
Sbjct: 123 STHPTHVTKFHPQDNKTLITASDDRVIRLWDI-SNA-----------YQPQLELT--GST 168

Query: 494 NLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVR-TGKCV 552
           + V   T  P                         P  ++S S D  I+L++ R +G   
Sbjct: 169 DYVRSVTCVPSA-----------------------PHMIVSGSYDGIIRLYDTRASGSSP 205

Query: 553 RTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605
                H + I DI + +   +        KVWDL S K ++   +    +TC+
Sbjct: 206 IYSLLHDQPIEDIISISATQIVSCGGSNFKVWDLTSNKKLYERGNFNKTVTCL 258

>YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown
           function, member of the WD (WD-40) repeat family [2238
           bp, 745 aa]
          Length = 745

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 52/114 (45%), Gaps = 18/114 (15%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDG---VKAIYFDGQKLI-TGSLDRMIRVWNY 384
           L+     D+ + +WD     L+++  G +     +++ +  G KL+ +GS D  I +W+ 
Sbjct: 629 LVLVSLQDNELQMWDYKENILIQKYFGQKQQHFIIRSCFAYGNKLVMSGSEDGKIYIWDR 688

Query: 385 VTGACVAAYPGHS--------------DSVLSVDSYKKIIVSGSADKTVKVWHV 424
           + G  V+   GHS              + V S  + K++  SG  D  +K+W +
Sbjct: 689 IRGNLVSVLSGHSTVMSNSTKPMGKNCNVVASNPADKEMFASGGDDGKIKIWKI 742

 Score = 36.2 bits (82), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 531 HLLSCSL-DNTIKLWEVRTGKCVRTHFGHVEGIWDI----AADNFRIVSGAHDKTVKVWD 585
           HL+  SL DN +++W+ +    ++ +FG  +  + I    A  N  ++SG+ D  + +WD
Sbjct: 628 HLVLVSLQDNELQMWDYKENILIQKYFGQKQQHFIIRSCFAYGNKLVMSGSEDGKIYIWD 687

Query: 586 LQSGKCIHTFDSH 598
              G  +     H
Sbjct: 688 RIRGNLVSVLSGH 700

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/313 (20%), Positives = 126/313 (40%), Gaps = 52/313 (16%)

Query: 315 GHMDGVLSLQFNYRL---LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAI-----YFD 366
           GH DGV ++  NY +   L T S D  +  W+++T + +     H   V  +     Y  
Sbjct: 65  GHRDGVYTIAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTPSYLS 124

Query: 367 GQK---LITGSLDRMIRVW----------------NYVTGACVAAYPGHSDSVLSVDSYK 407
            Q+   +++   D+ +++W                N   G     +  H+   L     K
Sbjct: 125 PQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQSLDHHRQK 184

Query: 408 KIIVSGSADKTVKVWHVE-SRTCYTLRGHTEWVGTVKLHPKSFTCF--SGSDDTTIRMWD 464
              V+G A   +++W    S+    L    + +  V+ +         +GSD++ + ++D
Sbjct: 185 SNFVTGGA--QIELWDTNRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVV-LYD 241

Query: 465 IRSNTCVKVFRGHVGQVQKVLPLTI----LDTENLVTDRTSDPP-----RNEATTAQDPP 515
           +R+N+  +        VQ +   +I    ++  N V             RN +       
Sbjct: 242 LRTNSPTQKI------VQTMRTNSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFK 295

Query: 516 DGQLSALD-DSLPYPSHLLSCSLDNTIKLWEVRTGKCVRT-HFGHVEGIWDI--AADNFR 571
           D   + +D D  P    +++ S D TI++++V+ G      H   ++ I+ +    D+  
Sbjct: 296 DHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGHSREIYHTKRMQHIFQVKYTMDSKY 355

Query: 572 IVSGAHDKTVKVW 584
           IVSG+ D  V++W
Sbjct: 356 IVSGSDDGNVRLW 368

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 9/86 (10%)

Query: 304 RKGTAHIQEFKGHMDGVLSLQFNYR--LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK 361
           R  +  +  FK H+  V+ + F+     + TGSYD T+ I+ +  G    R   H   ++
Sbjct: 285 RNMSKALHVFKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGH--SREIYHTKRMQ 342

Query: 362 AIY-----FDGQKLITGSLDRMIRVW 382
            I+      D + +++GS D  +R+W
Sbjct: 343 HIFQVKYTMDSKYIVSGSDDGNVRLW 368

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 7/65 (10%)

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK-----KIIVSGSADKTVKV 421
           G +++TGS D+ IR++    G     Y  H+  +  +   K     K IVSGS D  V++
Sbjct: 310 GDEVVTGSYDKTIRIYQVKHGHSREIY--HTKRMQHIFQVKYTMDSKYIVSGSDDGNVRL 367

Query: 422 WHVES 426
           W  ++
Sbjct: 368 WRAKA 372

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 10/66 (15%)

Query: 532 LLSCSLDNTIKLWEVRTGK---CVRTHFGHVEGI------WDIAADNFRIVSGAHDKTVK 582
           L + S D  IK W + T +     + H+G V G+           +NF ++S   DKTVK
Sbjct: 83  LATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTPSYLSPQRENF-MLSCGDDKTVK 141

Query: 583 VWDLQS 588
           +W + S
Sbjct: 142 LWSVNS 147

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 76/180 (42%), Gaps = 20/180 (11%)

Query: 313 FKGHMDGVLSLQF--NYRLLFTGSYDSTVAIW-DLATGKLVRRLTGHRDGVKAIYFDGQK 369
            K H   V S++F    +LL + S D+T+ +W      +L + L G +  V ++      
Sbjct: 75  LKAHNAEVTSVKFIGAEKLLVSASADATINVWRGDERWELAQTLEGPKSSVTSLAVAAGL 134

Query: 370 LITGSLDRMIRVWN-----YVTGACVAAYPGHSDSVLSV----DSYKKIIVSG-SADKTV 419
           ++ G  D  + VW+     +V  +      G     L++    D    + VSG S D  V
Sbjct: 135 IVAGFADGTLSVWSEHDDAFVLSSQFLIRKGFLPLALALQKLSDGCYMLAVSGTSTDLMV 194

Query: 420 K----VWHVESRTCYTLRGHTEWVGTVKLH---PKSFTCFSGSDDTTIRMWDIRSNTCVK 472
                   V+     T+ GH +W+  +      P  +   SG+ D  IR+W I++N  ++
Sbjct: 195 YSVCVAATVDVELSATVEGHEDWIKDLAFRSNGPGDWMLASGAQDRYIRLWRIKANNNIE 254

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 57/138 (41%), Gaps = 13/138 (9%)

Query: 348 KLVRRLTGHRDGVKAIYFDGQ-----KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLS 402
           +L   + GH D +K + F         L +G+ DR IR+W       +         +LS
Sbjct: 206 ELSATVEGHEDWIKDLAFRSNGPGDWMLASGAQDRYIRLWRIKANNNIEEEDPTKLKLLS 265

Query: 403 VDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462
              YK  +   +AD      H+       + GH +W+ +++ H       + + DT++ +
Sbjct: 266 NKIYKFQV---TADL-----HLSINFEALIMGHDDWISSLQWHESKCQLLAATADTSVML 317

Query: 463 WDIRSNTCVKVFRGHVGQ 480
           W+    + + V    +G+
Sbjct: 318 WEPDEISGIWVCASRLGE 335

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 60/136 (44%), Gaps = 10/136 (7%)

Query: 335 YDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVWNYVTGACVAAY- 393
           Y  +++I ++AT + V      +  V   Y   + +  G+  + I +WN +       Y 
Sbjct: 15  YLKSLSIDNMATQEAVFIGANRQTKVADFYLPTKTVAFGA-GKCIALWNPLDEHNAGVYC 73

Query: 394 --PGHSDSVLSVD--SYKKIIVSGSADKTVKVWHVESR--TCYTLRGHTEWVGTVKLHPK 447
               H+  V SV     +K++VS SAD T+ VW  + R     TL G    V ++ +   
Sbjct: 74  TLKAHNAEVTSVKFIGAEKLLVSASADATINVWRGDERWELAQTLEGPKSSVTSLAV--A 131

Query: 448 SFTCFSGSDDTTIRMW 463
           +    +G  D T+ +W
Sbjct: 132 AGLIVAGFADGTLSVW 147

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 75/175 (42%), Gaps = 11/175 (6%)

Query: 310 IQEFKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG 367
            +  + H   V  L++N     L +G  D+ V +++  +   +     H+  VKA+ +  
Sbjct: 378 FETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSP 437

Query: 368 QK---LITG--SLDRMIRVWNYVTGACVAAYPGHS---DSVLSVDSYKKIIVSGSADKTV 419
            K   L TG  + DR +++WN  T   ++     S   + V S ++ + +   G +   +
Sbjct: 438 HKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHGYSKYNL 497

Query: 420 KVWHVESR-TCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKV 473
            +W   S      L+GH+  V  + L     T  SG+ D T+R W +      KV
Sbjct: 498 TLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDKPKAKV 552

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 80/182 (43%), Gaps = 10/182 (5%)

Query: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDL-ATGKLVRRLTGHRDGVKAIYFD-- 366
           I+   GH+D V  L +N  +L +GS D  +   D+         +  H   V  + ++  
Sbjct: 337 IRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVA 396

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSV--LSVDSYKKIIVS---GSADKTVKV 421
             KL +G  D ++ V+   + + +  +  H  +V  ++   +K+ +++   G+AD+ +K+
Sbjct: 397 DNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKI 456

Query: 422 WHVESRTCYT-LRGHTEWVGTV-KLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVG 479
           W+V +    + +   ++    V   +        G     + +WD  S   + + +GH  
Sbjct: 457 WNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSF 516

Query: 480 QV 481
           +V
Sbjct: 517 RV 518

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 53/122 (43%), Gaps = 6/122 (4%)

Query: 367 GQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVES 426
           G  L  G  + ++ +++ +   C+    GH D V  +     ++ SGS D   ++ H + 
Sbjct: 314 GSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDH--RILHRDV 371

Query: 427 RT----CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQ 482
           R       T+  HT+ V  +K +       SG +D  + +++  S + +  F  H   V+
Sbjct: 372 RMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVK 431

Query: 483 KV 484
            +
Sbjct: 432 AM 433

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 64/151 (42%), Gaps = 9/151 (5%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLD-RMIRVWNYVTGA 388
           L  G  +  V I+D+   K +R L+GH D V  + ++   L +GS D R++     +   
Sbjct: 317 LAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDP 376

Query: 389 CVAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLH 445
                  H+  V  L  +     + SG  D  V V+   S++   T   H   V  +   
Sbjct: 377 FFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWS 436

Query: 446 PKSFTCFS---GSDDTTIRMWDIRSNTCVKV 473
           P      +   G+ D  +++W++  NT +K+
Sbjct: 437 PHKRGVLATGGGTADRRLKIWNV--NTSIKM 465

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 45/89 (50%), Gaps = 3/89 (3%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQ-S 588
           SHL     +  +++++V   KC+RT  GH++ +  ++ +N  + SG+ D  +   D++  
Sbjct: 315 SHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMP 374

Query: 589 GKCIHTFDSHQAPITCV--GIGDSEFVSG 615
                T +SH   +  +   + D++  SG
Sbjct: 375 DPFFETIESHTQEVCGLKWNVADNKLASG 403

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 8/87 (9%)

Query: 526 LPYPSHLL-SCSLDNTIKLWEVRTG----KCVRTHFGHVEGI-WDIAADNFRIVSGAHDK 579
           L + +H+L S S D+ I   +VR      + + +H   V G+ W++A DN ++ SG +D 
Sbjct: 350 LSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVA-DN-KLASGGNDN 407

Query: 580 TVKVWDLQSGKCIHTFDSHQAPITCVG 606
            V V++  S   I TFD H+A +  + 
Sbjct: 408 VVHVYEGTSKSPILTFDEHKAAVKAMA 434

>Kwal_33.13515
          Length = 398

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 57/120 (47%), Gaps = 7/120 (5%)

Query: 317 MDGVLSLQFNY--RLLFTGSYDSTVAIWD--LATGKLVRRLTGHRDGVKAIYFD--GQKL 370
           ++ V +LQ+++  + L+ G     + +++  +A  KL  R  GH   +  +  D   + L
Sbjct: 192 LNKVTALQWSHDGKWLYAGFESGEIVLFEVEMAAVKLKVRACGHTGAITCMKLDPDNRFL 251

Query: 371 ITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTC 429
           + GSLD +   W+  +  C     G   S+L +D S   + V   +D   +++ +ES  C
Sbjct: 252 VAGSLDTICSFWDLSSMCCERVINGFDTSILDLDLSRDGVAVGLCSDNQTRIYLIESGAC 311

 Score = 36.6 bits (83), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 62/160 (38%), Gaps = 24/160 (15%)

Query: 337 STVAIWDLATGKLVRRL-TGHRDGVKAIYFD------GQKLITGSLDRMIRVWNY----V 385
           S ++IWD +TG L++   TG   G    Y+       G  +  G         NY    V
Sbjct: 121 SRISIWDASTGALIKSFETGLSSGNYKCYYSPNGKWFGALVENGEFCLFDVDKNYELCSV 180

Query: 386 TGACVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVES-------RTCYTLRGHT 436
           +  C        + V ++      K + +G     + ++ VE        R C    GHT
Sbjct: 181 SQLCAGENLASLNKVTALQWSHDGKWLYAGFESGEIVLFEVEMAAVKLKVRAC----GHT 236

Query: 437 EWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRG 476
             +  +KL P +    +GS DT    WD+ S  C +V  G
Sbjct: 237 GAITCMKLDPDNRFLVAGSLDTICSFWDLSSMCCERVING 276

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 527 PYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSG-AHDKTVKVWD 585
           P    L++ SLD     W++ +  C R   G    I D+      +  G   D   +++ 
Sbjct: 246 PDNRFLVAGSLDTICSFWDLSSMCCERVINGFDTSILDLDLSRDGVAVGLCSDNQTRIYL 305

Query: 586 LQSGKCIHTFDS 597
           ++SG C++ F+S
Sbjct: 306 IESGACLYEFES 317

>Kwal_27.10785
          Length = 367

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 69/138 (50%), Gaps = 27/138 (19%)

Query: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF------DGQKLITGSLDRMIRVWN 383
           + +G  D+ V ++D+++G+  +++  H   VK++ F      + + L+TGS D+ I+ W+
Sbjct: 94  IASGGCDNAVMVFDVSSGQ-SQQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWD 152

Query: 384 YVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKV------------------WHVE 425
                 V+      + V ++DS +K++V G+A++ + V                  W   
Sbjct: 153 LRQPQPVSTL-AMPERVYTMDSKQKLLVVGTAERHIVVIDLNNPAAIFKTTTSPLKWQTR 211

Query: 426 SRTCYTLRGHTEWVGTVK 443
           S +CY + G+   VG+++
Sbjct: 212 SVSCY-IEGNGYAVGSIE 228

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 53/122 (43%), Gaps = 16/122 (13%)

Query: 358 DGVKAIYFDGQK---LITGSLDRMIRVWNYVTGA--CVAAYPGHSDSVL----SVDSYKK 408
           D +  I F  Q+       S D+ +RVW+   G   C A Y  H   VL    S D  K 
Sbjct: 36  DSISDIAFSPQQDFLFSVSSWDKKVRVWDVNGGQAQCRAEYQ-HQAPVLATRWSTDGTK- 93

Query: 409 IIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKL---HPKSFTCF-SGSDDTTIRMWD 464
            I SG  D  V V+ V S     +  H   V +++     P +  C  +GS D TI+ WD
Sbjct: 94  -IASGGCDNAVMVFDVSSGQSQQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWD 152

Query: 465 IR 466
           +R
Sbjct: 153 LR 154

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 329 LLFTGSYDSTVAIWDLATGKL-VRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYV 385
           L    S+D  V +WD+  G+   R    H+  V A  +  DG K+ +G  D  + V++  
Sbjct: 50  LFSVSSWDKKVRVWDVNGGQAQCRAEYQHQAPVLATRWSTDGTKIASGGCDNAVMVFDVS 109

Query: 386 TGAC--VAAYPGHSDSVLSVD---SYKKIIVSGSADKTVKVW 422
           +G    V A+     S+  V    S  + +V+GS DKT+K W
Sbjct: 110 SGQSQQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYW 151

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 513 DPPDGQLSALDDSLPYPSHLLSCS-LDNTIKLWEVRTGKC-VRTHFGHVEGIWDI--AAD 568
           +P +  +S +  S P    L S S  D  +++W+V  G+   R  + H   +     + D
Sbjct: 32  NPAEDSISDIAFS-PQQDFLFSVSSWDKKVRVWDVNGGQAQCRAEYQHQAPVLATRWSTD 90

Query: 569 NFRIVSGAHDKTVKVWDLQSGK 590
             +I SG  D  V V+D+ SG+
Sbjct: 91  GTKIASGGCDNAVMVFDVSSGQ 112

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 51/112 (45%), Gaps = 3/112 (2%)

Query: 395 GHSDSVLSVDSY--KKIIVSGSADKTVKVWHVESRTC-YTLRGHTEWVGTVKLHPKSFTC 451
           GHS  + S+  +   K+++S S D  +K+W     T   TL GHT  +    L  +    
Sbjct: 144 GHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNV 203

Query: 452 FSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDP 503
            S S D ++R+W+  S + ++ F         V  L +L+ ++   +   +P
Sbjct: 204 LSSSKDGSVRLWECGSGSMLRAFHRRDRHSDGVNALQVLNVQSHSHNGLGNP 255

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 3/85 (3%)

Query: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIW--DIAADNF 570
           D   G +++L    P    LLS S+D  +K+W    G   RT FGH   I    +     
Sbjct: 143 DGHSGHITSLH-YFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGR 201

Query: 571 RIVSGAHDKTVKVWDLQSGKCIHTF 595
            ++S + D +V++W+  SG  +  F
Sbjct: 202 NVLSSSKDGSVRLWECGSGSMLRAF 226

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 13/107 (12%)

Query: 307 TAHIQEFK------GHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRD 358
           T H  EF       GH   + SL +  + ++L + S D  + IW  A G   R L GH  
Sbjct: 130 TLHNAEFSDCRSLDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTA 189

Query: 359 GVK--AIYFDGQKLITGSLDRMIRVWNYVTGACVAAY---PGHSDSV 400
            +    +   G+ +++ S D  +R+W   +G+ + A+     HSD V
Sbjct: 190 PITGCGLIERGRNVLSSSKDGSVRLWECGSGSMLRAFHRRDRHSDGV 236

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/69 (20%), Positives = 28/69 (40%)

Query: 413 GSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVK 472
           G  +  + + + E   C +L GH+  + ++   P      S S D  +++W     T  +
Sbjct: 123 GDTEGRLTLHNAEFSDCRSLDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPR 182

Query: 473 VFRGHVGQV 481
              GH   +
Sbjct: 183 TLFGHTAPI 191

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 51/104 (49%), Gaps = 12/104 (11%)

Query: 329 LLFTGSYDSTVAIWDLATGKLVRRLT-GHRDGVKAIYF--DGQKLITGSLDRMIRVWNYV 385
           L    ++D+TV IWD+  G    R    H+  V    +  DG K+ +G  D ++++++  
Sbjct: 48  LFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVA 107

Query: 386 TGACVAAYPGHSDSVLSV-------DSYKKIIVSGSADKTVKVW 422
           +G   A   G  DS +          S ++ IV+GS DKT+K W
Sbjct: 108 SGQ--AQQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYW 149

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 67/136 (49%), Gaps = 27/136 (19%)

Query: 332 TGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF------DGQKLITGSLDRMIRVWNYV 385
           +G  D+ + ++D+A+G+  +++  H   V+A+ F      + + ++TGS D+ I+ W+  
Sbjct: 94  SGGCDNILKLYDVASGQ-AQQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMR 152

Query: 386 TGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKV------------------WHVESR 427
               ++      + V ++DS +K++V G+A++ + V                  W   + 
Sbjct: 153 QPQPISTV-AMPERVYALDSKQKLLVVGTAERHIVVIDLNNPAQVFRTSMSPLKWQTRTV 211

Query: 428 TCYTLRGHTEWVGTVK 443
            CY + G+   +G+V+
Sbjct: 212 ACY-IEGNGFAIGSVE 226

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 49/119 (41%), Gaps = 10/119 (8%)

Query: 358 DGVKAIYFDGQK---LITGSLDRMIRVWNYVTGACVA-AYPGHSDSVLSV--DSYKKIIV 411
           D V  I F  Q+       + D  +R+W+   G     A   H   VL+    S    + 
Sbjct: 34  DSVSDIAFSPQQDFLFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVA 93

Query: 412 SGSADKTVKVWHVESRTCYTLRGHTEWVGTVKL---HPKSFTCF-SGSDDTTIRMWDIR 466
           SG  D  +K++ V S     +  H   V  ++     P +  C  +GS D TI+ WD+R
Sbjct: 94  SGGCDNILKLYDVASGQAQQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMR 152

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 7/108 (6%)

Query: 510 TAQDPPDGQLSALDDSLPYPSHLLSCSL-DNTIKLWEVRTGKCV-RTHFGHVEGIWDI-- 565
           T  +P +  +S +  S P    L S +  DNT+++W+V+ G    R  + H   +     
Sbjct: 27  TINNPANDSVSDIAFS-PQQDFLFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRW 85

Query: 566 AADNFRIVSGAHDKTVKVWDLQSGKC--IHTFDSHQAPITCVGIGDSE 611
           ++D  ++ SG  D  +K++D+ SG+   I + DS    +  V  G S 
Sbjct: 86  SSDGTKVASGGCDNILKLYDVASGQAQQIGSHDSAVRALRFVQCGPSN 133

 Score = 32.3 bits (72), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 530 SHLLSCSLDNTIKLWEVRTGKC--VRTHFGHVEGIWDI---AADNFRIVSGAHDKTVKVW 584
           + + S   DN +KL++V +G+   + +H   V  +  +    ++   IV+G+ DKT+K W
Sbjct: 90  TKVASGGCDNILKLYDVASGQAQQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYW 149

Query: 585 DLQSGKCIHT 594
           D++  + I T
Sbjct: 150 DMRQPQPIST 159

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 66/143 (46%), Gaps = 18/143 (12%)

Query: 348 KLVRRLTGHRDGVKAIYFDGQK------LITGSLDRMIRVWNYVTGACVAAYPGHSD--S 399
           ++V  L GH D VK++ F  Q+      L +GS DR IR+W       +      S   +
Sbjct: 193 RVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIDDSEEDSKKLT 252

Query: 400 VLSVDSYKKIIVSGSADKTVKV-WHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDT 458
           +LS   YK  I     D  ++V  + E+     + GH +W+ +++ H       + + DT
Sbjct: 253 LLSNKQYKFQI-----DDELRVGINFEA----LIMGHDDWISSLQWHESRLQLLAATADT 303

Query: 459 TIRMWDIRSNTCVKVFRGHVGQV 481
           ++ +W+    + + V    +G++
Sbjct: 304 SLMVWEPDETSGIWVCSLRLGEM 326

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 44/93 (47%), Gaps = 8/93 (8%)

Query: 338 TVAIWDLA---TGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGA---C 389
           T+A+WD        +   L GH   V  + F  D   +++ S D  +++W +   +   C
Sbjct: 37  TIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQC 96

Query: 390 VAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVW 422
           +     +S +++++ +   +I  G AD T+ +W
Sbjct: 97  IQTIQHYSKTIVALSALPSLISVGCADGTISIW 129

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 400 VLSVDSYKKIIVSGSADKTVKVW---HVESRTCY-TLRGHTEWVGTVKLHPKSFTCFSGS 455
           V  +   KKI+  G A KT+ +W      ++  Y TL+GH   V  V+  P S    S S
Sbjct: 20  VSDIHKVKKIVAFG-AGKTIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDSDFMVSAS 78

Query: 456 DDTTIRMW 463
           +D  +++W
Sbjct: 79  EDHHVKIW 86

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 531 HLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAA--DNFRIVSGAHDKTVKVWDL 586
           ++ SCS D +I+LW++ TGK +   + H   IW++    ++ +++S + D T +VW++
Sbjct: 193 YVASCSDDRSIRLWDLETGKQLSVGWSHTARIWNLMFFDNDSKLISVSEDCTCRVWNI 250

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 7/101 (6%)

Query: 333 GSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTGACV 390
           G+    V IWDL +   +  L GH   +  +    +G+ + + S DR IR+W+  TG  +
Sbjct: 155 GTVMGGVIIWDLFSETKIHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQL 214

Query: 391 AAYPGHSD---SVLSVDSYKKIIVSGSADKTVKVWH-VESR 427
           +    H+    +++  D+  K+I S S D T +VW+ +ESR
Sbjct: 215 SVGWSHTARIWNLMFFDNDSKLI-SVSEDCTCRVWNIIESR 254

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 310 IQEFKGHMDGVL--SLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGV-KAIYFD 366
           I    GH   +   +L  N R + + S D ++ +WDL TGK +     H   +   ++FD
Sbjct: 172 IHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQLSVGWSHTARIWNLMFFD 231

Query: 367 G-QKLITGSLDRMIRVWNYV 385
              KLI+ S D   RVWN +
Sbjct: 232 NDSKLISVSEDCTCRVWNII 251

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 407 KKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465
           K  + +