Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.576446245622810.0
Sklu_2260.63994627311e-92
YER054C (GIP2)5485314771e-53
ADL083C3544344161e-46
Scas_715.465702003613e-37
CAGL0J02904g5431933524e-36
YIL045W (PIG2)5381733472e-35
Scas_704.415821873385e-34
CAGL0L00803g8271873096e-30
KLLA0F27533g4981342393e-21
YLR273C (PIG1)6481231316e-08
YOR178C (GAC1)7931371282e-07
Kwal_56.23262429891032e-04
CAGL0H04037g91573995e-04
Scas_526.491561910.005
AGR275C67973900.007
CAGL0F04917g682123880.011
Scas_659.2159498870.014
Scas_521.157998850.021
KLLA0C06974g44685730.70
KLLA0D09240g74868701.7
KLLA0B03850g165177664.8
ACR012C54152665.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5764
         (456 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5764                                                          883   0.0  
Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement       286   1e-92
YER054C (GIP2) [1483] chr5 complement(262051..263697) Glc7p-inte...   188   1e-53
ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C (...   164   1e-46
Scas_715.46                                                           143   3e-37
CAGL0J02904g complement(279516..281147) similar to sp|P40036 Sac...   140   4e-36
YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interac...   138   2e-35
Scas_704.41                                                           134   5e-34
CAGL0L00803g 98548..101031 some similarities with sp|P40036 Sacc...   123   6e-30
KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036 Saccha...    97   3e-21
YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein t...    55   6e-08
YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulator...    54   2e-07
Kwal_56.23262                                                          44   2e-04
CAGL0H04037g complement(379169..381916) weakly similar to sp|P28...    43   5e-04
Scas_526.4                                                             40   0.005
AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C (...    39   0.007
CAGL0F04917g complement(499132..501180) weakly similar to sp|P28...    39   0.011
Scas_659.21                                                            38   0.014
Scas_521.1                                                             37   0.021
KLLA0C06974g complement(604344..605684) similar to sp|P50102 Sac...    33   0.70 
KLLA0D09240g complement(775848..778094) some similarities with s...    32   1.7  
KLLA0B03850g 345635..350590 similar to sp|P47171 Saccharomyces c...    30   4.8  
ACR012C [1060] [Homologous to ScYEL060C (PRB1) - SH; ScYOR003W (...    30   5.0  

>Kwal_23.5764
          Length = 462

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/456 (94%), Positives = 429/456 (94%)

Query: 1   MYIRRPPSDLRREGSNGAFTDRSLAFLHKPQRVTQPRALYADEWLRRNTDMNRGNVKVEN 60
           MYIRRPPSDLRREGSNGAFTDRSLAFLHKPQRVTQPRALYADEWLRRNTDMNRGNVKVEN
Sbjct: 1   MYIRRPPSDLRREGSNGAFTDRSLAFLHKPQRVTQPRALYADEWLRRNTDMNRGNVKVEN 60

Query: 61  CPEDYFSQNFKGDGPTKQTAASEANGFDPSASNASAGDTASPLRVNPYFXXXXXXXXXXX 120
           CPEDYFSQNFKGDGPTKQTAASEANGFDPSASNASAGDTASPLRVNPYF           
Sbjct: 61  CPEDYFSQNFKGDGPTKQTAASEANGFDPSASNASAGDTASPLRVNPYFPAEEDSVVADA 120

Query: 121 XXXPLVRKKSGEVVRPSLKMAQRSRSLPATPSDREPDKRLGGPPAAGPKRSKSVHFDQRD 180
              PLVRKKSGEVVRPSLKMAQRSRSLPATPSDREPDKRLGGPPAAGPKRSKSVHFDQRD
Sbjct: 121 AAPPLVRKKSGEVVRPSLKMAQRSRSLPATPSDREPDKRLGGPPAAGPKRSKSVHFDQRD 180

Query: 181 VVKFKYFWQEDSPLDVAEQDVLEGPLDDQRAKTVVGPTSMARXXXXXXXXXXXXXRAVQR 240
           VVKFKYFWQEDSPLDVAEQDVLEGPLDDQRAKTVVGPTSMAR             RAVQR
Sbjct: 181 VVKFKYFWQEDSPLDVAEQDVLEGPLDDQRAKTVVGPTSMARDLTVDDDDDGNDDRAVQR 240

Query: 241 DLTMSLSNLTFERRMSNTSGGGLRRSRRYQKLKAQGATPPTRPGLYHANFATLADDDQCS 300
           DLTMSLSNLTFERRMSNTSGGGLRRSRRYQKLKAQGATPPTRPGLYHANFATLADDDQCS
Sbjct: 241 DLTMSLSNLTFERRMSNTSGGGLRRSRRYQKLKAQGATPPTRPGLYHANFATLADDDQCS 300

Query: 301 LKSNIFLNIAHNSSCFLQELSLIGDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIE 360
           LKSNIFLNIAHNSSCFLQELSLIGDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIE
Sbjct: 301 LKSNIFLNIAHNSSCFLQELSLIGDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIE 360

Query: 361 CVWASSGDDVLPGMHMDRFKLVIDLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQ 420
           CVWASSGDDVLPGMHMDRFKLVIDLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQ
Sbjct: 361 CVWASSGDDVLPGMHMDRFKLVIDLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQ 420

Query: 421 YVSRDANSRVEYWDNNAGRNYVVDVVSSAPRMGFTN 456
           YVSRDANSRVEYWDNNAGRNYVVDVVSSAPRMGFTN
Sbjct: 421 YVSRDANSRVEYWDNNAGRNYVVDVVSSAPRMGFTN 456

>Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement
          Length = 399

 Score =  286 bits (731), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 183/462 (39%), Positives = 253/462 (54%), Gaps = 94/462 (20%)

Query: 1   MYIRRPPSDLRREGSNGAFTDRSLAFLHKPQRVTQPRALYADEWLRRNTDMNRGNVKVEN 60
           MYI++  ++      +G    RSL FLHKPQRVTQ + LYA++ L+RNT++NRG      
Sbjct: 1   MYIKKLTNNY-----SGENKPRSLDFLHKPQRVTQLKTLYAEDSLQRNTNLNRG------ 49

Query: 61  CPEDYF------SQNFKGDGPTKQTAASEANGFDPSASNASAGDTASPLRVNPYFXXXXX 114
            P DY       S+ + GDG   + +    N + P               V+ Y+     
Sbjct: 50  PPPDYENVAPTDSREYYGDGTLHRGSIGSLNSYFPD--------------VDEYYPPKP- 94

Query: 115 XXXXXXXXXPLVRKKSGEVVRPSLKMAQRSRSLPATPSDREPDKRLGGPPAAGPKRSKSV 174
                      +RKKSGE+V+ SLK   RS+SLPATP+ REP   +       PKRSKSV
Sbjct: 95  -----------IRKKSGELVKSSLKQHHRSKSLPATPTGREPRTEIII--MEPPKRSKSV 141

Query: 175 HFDQRDVVKFKYFWQEDSPLDVAEQDVLEGPLDDQRAKTVVGPTSMARXXXXXXXXXXXX 234
           HFDQRDVV  KYF +++ P++VA+++V E    DQ + T   P  ++             
Sbjct: 142 HFDQRDVVSVKYFQKDERPVEVAQREVEE----DQLSFT---PKQLSF------------ 182

Query: 235 XRAVQRDLTMSLSNLTFERRMSNTSGGGLRRSRRYQKL----------KAQGATPPTRPG 284
                  +   LSN T E      +   LRRS+++  +           A G++ P  PG
Sbjct: 183 -------MNSWLSNSTPEE-----TKRPLRRSKKHMMMMNGSGPSPATTASGSSMPPVPG 230

Query: 285 LYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSLIGDQHYLVGHVLVKNVYYEKTV 344
           LY+ NF  L++ +  SLK NIFLNIAH    FLQ+LSL+GD +Y+VG VLVKN+ Y+K V
Sbjct: 231 LYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSLLGDGNYVVGKVLVKNICYDKQV 290

Query: 345 LVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVIDLAGLQEGDTSRDSTPSHDSA 404
           +VRYT D W T+ D++CVW SSGD VLPGM+MD FK V+D+  +   + +  +T      
Sbjct: 291 IVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVP-VDSAEATLATTDPDKEG 349

Query: 405 GHACQLSTVRLQFCIQYVSRDANSRVEYWDNNAGRNYVVDVV 446
           G         +QFCI+Y +RD N R E+WDNN G+NY+V VV
Sbjct: 350 GR-------EVQFCIRYTTRDGNYREEHWDNNNGKNYIVAVV 384

>YER054C (GIP2) [1483] chr5 complement(262051..263697)
           Glc7p-interacting protein, possible regulatory subunit
           for the PP1 family protein phosphatase Glc7p [1647 bp,
           548 aa]
          Length = 548

 Score =  188 bits (477), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 167/531 (31%), Positives = 240/531 (45%), Gaps = 127/531 (23%)

Query: 8   SDLRREGSNGAF--TDRSLAFLHKPQRVTQPRA-LYADEWLRRNTDMNRGNVKVENCPED 64
           SDL  +  +G+   T  SL FLHKPQRVTQ RA  + +E ++RNTD+N+   ++ +   D
Sbjct: 41  SDLYNKERDGSTEETLNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNK---RIFSAGND 97

Query: 65  YFSQNFKG----------------DGPTKQTAASEANGFDPSASNASAGDTASPLRVNPY 108
               N  G                +G T+     E     P ++   +     P   +P 
Sbjct: 98  ENVDNESGWSKIAAAKNHTSVESLNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPG 157

Query: 109 FXXXXXXXXXXXX-XXPLVRKKSGEVVRPSLKMAQRSRSLPATPSDREPD---KRLGGPP 164
                           P V KKSGE+++ SLK  +RS+SLP TP  R  +    R G P 
Sbjct: 158 NDMNFEYDEEILIPFAPPVYKKSGELLKSSLK--RRSKSLPTTPGIRSGNGVQARDGSPM 215

Query: 165 AAGPKRSKSVHFDQRDVVKFKYFWQEDSPLDVAEQDVLEGPLDDQR--AKTVVGPTSMAR 222
                RSKSVHFDQ   VK  YF +++SP++V + +  +  L  +      +V P    +
Sbjct: 216 LI---RSKSVHFDQAAPVK--YFAEDESPINVNKTEQHDNCLSFKHKPVNLMVDPEEETK 270

Query: 223 XXXXXXXXXXXXXRAVQRDLT-MSLSNLTFERRMSNTSGGG------LRRSRRYQKL-KA 274
                         ++  DLT ++        ++SN + G       LR+S+R+Q L K 
Sbjct: 271 MLSSGLETT-----SIDDDLTTVAPKGFAHPAKISNPNNGKGTNNTKLRKSKRFQNLLKN 325

Query: 275 QGATPPTRP------------------------GLYHANFATLADDDQCSLKSNIFLNIA 310
           +   PP++                         GLY  NF  L++ +  SLK NIF+N++
Sbjct: 326 RTDMPPSKSNKKFVNGGGAHEISDRNSKNYHVVGLYSKNFPILSNKNPKSLKLNIFINLS 385

Query: 311 HNSSCFLQELSL-----------------IGDQH------------------YLVGHVLV 335
            N   FLQELSL                 I + H                   + G +LV
Sbjct: 386 QNKKVFLQELSLYIHRDNNYFSNSSSFYNIPNSHNGNDCNGVAKGYNAGCTRLIAGRILV 445

Query: 336 KNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVIDLAGLQEGDTSR 395
           KN++Y+K V+VRYT DSWRT+ ++ECV+ S GD +LPG +MD F  +ID       D S+
Sbjct: 446 KNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGILPGTNMDIFHFIID-------DVSK 498

Query: 396 DSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYWDNNAGRNYVVDVV 446
                 D  G        +L+FCI Y +R+   R EYWDNN G NY VDVV
Sbjct: 499 -----VDPRG--------KLEFCIHYSTRNDYEREEYWDNNNGNNYKVDVV 536

>ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C
           (GIP2) - SH] (537421..538485) [1065 bp, 354 aa]
          Length = 354

 Score =  164 bits (416), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 142/434 (32%), Positives = 182/434 (41%), Gaps = 99/434 (22%)

Query: 12  REGSNGAFTDRSLAFLHKPQRVTQPRALYADE-WLRRNTDMNRGNVKVENCPEDYFSQNF 70
           R    G ++  SLA L KPQR++        E  L+RNTD NR                 
Sbjct: 17  RSSQEGKYS--SLALLRKPQRISSRTEREEQENILKRNTDYNRK---------------- 58

Query: 71  KGDGPTKQTAASEANGFDPSASNASAGDTASPLRVNPYFXXXXXXXXXXXXXXPLVRKKS 130
           +G G    T A++ N  DP   + S     SP+ +  YF                V    
Sbjct: 59  RGGG----TWAADEN-IDPLDGDESPRRAGSPVVLTDYFSQSHA-----------VYDNV 102

Query: 131 GEVVRPSLKMAQRSRSLPATPSDREPDKRLGGPPAAGPKRSKSVHFDQRDVVKFKYFWQE 190
           G          QRS SLP TP+     KR GG      +RSKSVHFD RDVV  KYF  +
Sbjct: 103 GH---------QRSNSLPGTPT--SALKRPGGV-----RRSKSVHFDNRDVVSVKYFNSD 146

Query: 191 DSPLDVAEQDVLEGPLDDQRAKTVVGPTSMARXXXXXXXXXXXXXRAVQRDLTMSLSNLT 250
           +S L VA     E  L  ++    + P  +                            L 
Sbjct: 147 ESTLLVAHAQSFEDQLRLRQDARELAPNGLT---------------------------LV 179

Query: 251 FERRMSNTSGGGLRRSRRYQKLKAQGATPPTRPGLYHANFATLADDDQCSLKSNIFLNIA 310
                        R+  R  K   Q    P    L + NF  LA+ D   L  NIFLNIA
Sbjct: 180 APAGGMAGGAKSPRKPLRKSKCFRQYQLRPQLRTLRNVNFPILANKDPAVLTLNIFLNIA 239

Query: 311 HNSSCFLQELSLIGDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDV 370
           +N   FLQ+LSL      + G VLVKN++Y+K+V+VRYT D+W  + D   VW SSG+ V
Sbjct: 240 YNRKVFLQDLSL-DSMLVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAV 298

Query: 371 LPGMHMDRFKLVIDLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRV 430
           LPG  MD F+  ID+     G                    T RL+FCI+Y  RD +   
Sbjct: 299 LPGKDMDLFEFAIDVPAPVSG--------------------TPRLEFCIRYQVRDNSDFQ 338

Query: 431 EYWDNNAGRNYVVD 444
            +WDNN G NYVV+
Sbjct: 339 THWDNNHGNNYVVE 352

>Scas_715.46
          Length = 570

 Score =  143 bits (361), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 107/200 (53%), Gaps = 51/200 (25%)

Query: 284 GLYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSLIGDQH---------------- 327
           GLY+ NF  L++ +  SLK NIF+ ++ +  CFLQE++L  ++                 
Sbjct: 390 GLYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSNSEF 449

Query: 328 -----------YLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHM 376
                       + G +LVKN++Y+K V+VRYT + WRT  D+EC+W S GD ++PG +M
Sbjct: 450 GQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGTNM 509

Query: 377 DRFKLVIDLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYWDNN 436
           D F+ +ID A   E                    +  +L+FCIQY +R+   R+EYWDNN
Sbjct: 510 DVFRFLIDDANKLE--------------------ARAKLEFCIQYTARNDTERLEYWDNN 549

Query: 437 AGRNYVVDVVSSAPRMGFTN 456
            G+NY V V+ +    GFTN
Sbjct: 550 DGKNYKVGVIMN----GFTN 565

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/176 (32%), Positives = 89/176 (50%), Gaps = 17/176 (9%)

Query: 23  SLAFLHKPQRVTQPRA-LYADEWLRRNTDMNRGNVKVENCPEDYFSQNFKGDGPTKQTAA 81
           S+ FL+KPQRVTQ     + +E ++RNTD+N+ N+++        S +   D   ++T  
Sbjct: 89  SMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNK-NIRL------VTSGSVAKD--EEETGR 139

Query: 82  SEANGFD-PSASNASAGDTASPLRVNPYFXXXXXXXXXXXXXXPLVRKKSGEVVRPSLKM 140
              +  D P  S  S   ++  ++ N                 P + KKSGE+++ SLK 
Sbjct: 140 EYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITPLSP-IYKKSGELLKSSLK- 197

Query: 141 AQRSRSLPATPSDREPDKRLGGPPAAGPKRSKSVHFDQRDVVKFKYFWQEDSPLDV 196
            +RS+SLP+T    +   R     A    RSKSVHFDQ+  V  KYF +++SP  V
Sbjct: 198 -RRSKSLPSTSEILQKSLRFEND-AMEMVRSKSVHFDQKAPV--KYFREDESPSTV 249

>CAGL0J02904g complement(279516..281147) similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2, hypothetical
           start
          Length = 543

 Score =  140 bits (352), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 79/193 (40%), Positives = 102/193 (52%), Gaps = 40/193 (20%)

Query: 284 GLYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSL----------------IG--- 324
           GLY+ NF  L++ +  SLK NIF+N++     FLQELSL                IG   
Sbjct: 368 GLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFYSPGSGVDIGTPI 427

Query: 325 DQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLP-GMHMDRFKLVI 383
           +   L G VLVKN++++K VL+RYT D WR  +D+E VW SS   ++P G  MD F  VI
Sbjct: 428 NTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVI 487

Query: 384 DLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYWDNNAGRNYVV 443
           D A   EG  S                    L+FCIQY +RD   R+E+WDNN G+NY V
Sbjct: 488 DDATKWEGKAS--------------------LEFCIQYTTRDDTQRLEFWDNNCGKNYCV 527

Query: 444 DVVSSAPRMGFTN 456
           D+V    R  F N
Sbjct: 528 DLVMDGFRNPFAN 540

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 81/280 (28%), Positives = 116/280 (41%), Gaps = 38/280 (13%)

Query: 14  GSNGAFTDRSLAFLHKPQRVTQ-PRALYADEWLRRNTDMNRGNVKVENCPEDYFSQNFKG 72
           G +G  T  SL FLHKPQRV+Q  +  + +E L RNT +N+   +V++   +Y      G
Sbjct: 35  GGSGKLT--SLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYREYSQGPGDG 92

Query: 73  DGPTKQTAASEANGFDPSASNASAGDTASPLRVNPYFXXXXXXXXXXXXX--XPLVRKKS 130
               +Q A  +     P +       T   L  N                   P V KKS
Sbjct: 93  GASERQQARDDLIPLSPKS-------TLPELDTNMLDNTLDSDNSSNDLAPFSPPVYKKS 145

Query: 131 GEVVRPSLKMAQRSRSLPATPSDREPDKRLGGPPAAGPKRSKSVHFDQRDVVKFKYFWQE 190
           GE V+  LK  +RS+SLP TP         G  P     RSKSVHFDQ   V  +YF + 
Sbjct: 146 GEPVKSVLK--RRSKSLPGTPGLNT--SMHGASPPNKLMRSKSVHFDQTAPV--RYFNEN 199

Query: 191 DSPLDVAEQDVL--------EGPLDDQRAKTVVGPTSMARXXXXXXXXXXXXXRAVQRDL 242
           + P+DV+  D+         E  ++D+R     G  S                RA++ + 
Sbjct: 200 ERPIDVSNADIYQQYGAYLNEYGIEDRRKAGRAGGLSAMMQEMSLDDKTKERLRALELE- 258

Query: 243 TMSLSNLTFERRMSNTSGGG-------LRRSRRYQKLKAQ 275
               S    E   S  + GG       LR+S+R+  +K +
Sbjct: 259 ----SKRVDEGYDSTIAAGGQGNAGPKLRKSKRFHAIKKK 294

>YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interacts
           with Gsy2p, possible regulatory subunit for the
           PP1-family protein phosphatase Glc7p [1617 bp, 538 aa]
          Length = 538

 Score =  138 bits (347), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 105/173 (60%), Gaps = 19/173 (10%)

Query: 284 GLYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSLIGDQH--YLVGHVLVKNVYYE 341
           GLY+ NF  L+D ++ SLK NIFLN++     FLQE++L+   H   ++G V VKN+Y++
Sbjct: 361 GLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLTGFHNMVIIGKVFVKNIYFD 420

Query: 342 KTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVIDLAGLQEGDTSRDSTPSH 401
           K ++VRYT D+WRT  + ECV+ S+ + +LPG +MD FK  ID           D    +
Sbjct: 421 KKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSID-----------DIHNPN 469

Query: 402 DSAGHACQLSTVRLQFCIQYVSRDAN-SRVEYWDNNAGRNYVVDVVSSAPRMG 453
           D   +  Q     L+FCIQY++   + SR EYWDNN   NY +DVV++  R G
Sbjct: 470 DKDSNISQ-----LEFCIQYLTWGVDRSRKEYWDNNDSANYKIDVVTNETRTG 517

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 90/195 (46%), Gaps = 28/195 (14%)

Query: 23  SLAFLHKPQRVTQPRA--LYADEWLRRNTDMNRGNVKVENCPEDYFS-QNFKGDGPTKQT 79
           SL FLHKP+R++  +   L  DE L+RNTDMN+G          YF+ +      P   +
Sbjct: 52  SLEFLHKPRRLSNVKLHRLPQDE-LQRNTDMNKGM---------YFNGKQVHAHHPFINS 101

Query: 80  AASEANGFDPSASNASAGDTASPLRVNPYFXXXXXXXXXXXXXXPLVRKKSGEVVRPSLK 139
            A+        +      D  SPL  + +               P + KKSGE+V+ SLK
Sbjct: 102 GANFNAHHQDVSKLGEEEDEISPLSHDNF----QYESEENGNPSPPIYKKSGELVKSSLK 157

Query: 140 MAQRSRSLPATPS-------DREPDKRLGGPPAAGPKRSKSVHFDQRDVVKFKYFWQEDS 192
             +RS+SLP TP         +     L        +RSKSVHFD+  V+  K F + + 
Sbjct: 158 --RRSKSLPITPKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDR--VLPIKLFNENEK 213

Query: 193 PLDVAEQDVLEGPLD 207
           P+DV +Q V +  L+
Sbjct: 214 PIDVGKQMVQQDVLN 228

>Scas_704.41
          Length = 582

 Score =  134 bits (338), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 105/187 (56%), Gaps = 34/187 (18%)

Query: 284 GLYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSL----------IGDQH----YL 329
           GLY  NF TL + +  SLK NIF+N +     FLQ+L+L          +G+ +    Y+
Sbjct: 413 GLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYINNHVGNNNKQNKYI 472

Query: 330 VGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVIDLAGLQ 389
           +G  LV+N+Y++K V+++YT D+WR+ RDIE ++ S    ++PG +MD FK +ID     
Sbjct: 473 IGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLID----- 527

Query: 390 EGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYWDNNAGRNYVVDVVSSA 449
             D ++  +  H             L+FCIQY +R+   R E+WDNN  +NY VDVV+  
Sbjct: 528 --DVNKSVSKCH-------------LEFCIQYQTRNEKERKEFWDNNDDKNYKVDVVTEV 572

Query: 450 PRMGFTN 456
            R  F N
Sbjct: 573 FRNPFEN 579

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 93/197 (47%), Gaps = 26/197 (13%)

Query: 23  SLAFLHKPQRVTQPR--ALYADEWLRRNTDMNRGN--VKVENCPEDYFSQNFKGDGPTKQ 78
           SL FL +P+++ Q +  AL  +E LRRNT++N+    +     P  Y +  +  D  T  
Sbjct: 99  SLNFLQEPRKLDQLKLNALPQEE-LRRNTNLNKNINPIPTPIKPTIYKNSYYLNDNDTDA 157

Query: 79  TAASEANGFDPSASNASAGDTASPLRV--NPYFXXXXXXXXXXXXXXPLVRKKSGEVVRP 136
               + N  + S       +   P  V  N Y                 V KKSGE+++P
Sbjct: 158 FKEEQENEDEISPITQVPANAKIPFPVPNNAYMEVNRIKP---------VYKKSGELLKP 208

Query: 137 SLKMAQRSRSLPATPSDREPD-KRLGGPPAAGPK-----RSKSVHFDQRDVVKFKYFWQE 190
           SLK  +RS+SLP TP+    + +R+ G      +     RSKSVHF   + +  ++F ++
Sbjct: 209 SLK--RRSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSKSVHF--ANTLPVRFFSKD 264

Query: 191 DSPLDVAEQDVLEGPLD 207
           +SP+ VAE   +   L+
Sbjct: 265 ESPIIVAESHEITNELN 281

>CAGL0L00803g 98548..101031 some similarities with sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 or sp|P40187
           Saccharomyces cerevisiae YIL045w PIG2, hypothetical
           start
          Length = 827

 Score =  123 bits (309), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 93/187 (49%), Gaps = 40/187 (21%)

Query: 285 LYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSL------------------IG-- 324
           L   NF TL      SLK NIFLN   +    LQE+SL                  IG  
Sbjct: 654 LVSKNFPTLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYYNSNFGGPGIGFS 713

Query: 325 ------DQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDR 378
                 D+  + G VLVKN+Y++K V +RYT D WR+  ++E ++  SG++ LPG  MD 
Sbjct: 714 TGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDI 773

Query: 379 FKLVIDLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYWDNNAG 438
           F+ +ID   L              S G      +  L+FCIQY +R   +R EYWDNN G
Sbjct: 774 FRFMIDNTVL--------------SNGQYVSNRSRELEFCIQYTTRSNTAREEYWDNNNG 819

Query: 439 RNYVVDV 445
           +NY+V++
Sbjct: 820 KNYIVEI 826

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 102/230 (44%), Gaps = 58/230 (25%)

Query: 23  SLAFLHKPQRVTQPRA--LYADEWLRRNTDMN------------RGNVKVENC--PEDYF 66
           SL FLHKPQRVTQ ++    + E L+RNTDMN            R N K+++   PE+  
Sbjct: 312 SLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRINDKIDDITTPEEEI 371

Query: 67  SQ-----------NFKGDGPTKQTAASEA-------NGFDPSA--------SNASAGDTA 100
           +            N   + P   +  +E            P+         +N +  D  
Sbjct: 372 TGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDESISPTEHHYPILNRANQAQQDVC 431

Query: 101 SPLRVNPYFXXXXXXXXXXXXXXPLVRKKSGEVVRPSLKMAQRSRSLPATPSDREPDKRL 160
            PL    +               P V KKSGE+V+ SLK  +RS+SLP TP+     +  
Sbjct: 432 LPL----HDSYDQSPVEDHMMPLPPVYKKSGELVKSSLK--RRSKSLPVTPNSNRRTQNS 485

Query: 161 GGPPAAGPK----RSKSVHFDQRDVVKFKYFWQEDSPLDVA----EQDVL 202
            G     P+    RSKSVHFDQR  +  KYF++E+SP  V+    E DVL
Sbjct: 486 RGVRMNNPRDQLIRSKSVHFDQR--LPVKYFFKEESPSVVSIRDEEDDVL 533

>KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 GLC7P-interacting
           protein, hypothetical start
          Length = 498

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 78/134 (58%), Gaps = 24/134 (17%)

Query: 315 CFLQELSLIGDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPG- 373
           C LQ+L L    H L+G+V+V+N+ YEK V+VRYT DSW++ +D+E VW ++  ++  G 
Sbjct: 383 CHLQDLRLDTQGHMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGT 442

Query: 374 --MHMDRFKLVIDLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVE 431
             + +D F+  IDL  +        +T  H             ++ CI Y +R+ +S ++
Sbjct: 443 GAIDIDVFQFAIDLGKI--------NTIEH-------------IEMCILYQTREGSSWID 481

Query: 432 YWDNNAGRNYVVDV 445
           +WDNN+G+NY V V
Sbjct: 482 HWDNNSGQNYKVSV 495

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 95/229 (41%), Gaps = 46/229 (20%)

Query: 1   MYIRRPPSDLRREGSNGAFTDRSLAFLHKPQRVT-QPRALYADEWLRRNTDMNRGNVKVE 59
           MY R    +L+    +G F+  SL FL KPQR++ Q      ++ L+RNTD+N+  + V+
Sbjct: 1   MYQRDAVQNLQ----SGKFS--SLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVD 54

Query: 60  NCPEDYFSQNFKGDGPTKQTAA--SEANGF----------------DPSASNASAGDTAS 101
              +D  SQ+ + D    + A   +E   F                DP    A   +T  
Sbjct: 55  KSLQD--SQHDEHDPVGNELAGRLNEKLNFNKDADPSKKEDWDVETDPLKKEAWESETDP 112

Query: 102 PLRVNPYF------------XXXXXXXXXXXXXXP----LVRKKSGEVVRPSLKMAQRSR 145
            L +  YF                          P    L  +K   +  P   +  RS+
Sbjct: 113 SLSMQDYFPVSKPDVPEVEINNNSNDDNDDDDDEPEDRYLDSRKLSAIFNPPSILLTRSK 172

Query: 146 SLPATPSDREPDKRLGGPPAAGPKRSKSVHFDQRDVVKFKYFWQEDSPL 194
           SLP +P +    +    PP    KRSKSVHF Q +  + KYF +++SPL
Sbjct: 173 SLPTSPLEGRVSQE-QRPPVF--KRSKSVHFAQSEKFEVKYFREDESPL 218

>YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein that
           interacts with Gsy2p, possible regulatory subunit for
           the PP1 family protein phosphatase Glc7p [1947 bp, 648
           aa]
          Length = 648

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 61/123 (49%), Gaps = 8/123 (6%)

Query: 331 GHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVIDLAGLQE 390
           G + V N+ +EK + +++T ++W    DI  + A     V P  H+D FK +ID++ L+ 
Sbjct: 226 GLIFVNNLNFEKKIEIKFTLNNW---ADIHYINAHYNKSVTP--HVDEFKFIIDISALKL 280

Query: 391 GDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYWDNNAGRNYVVDVVSSAP 450
              S++   ++        L  + LQFC +Y       R  ++DNN  +NY + +  SA 
Sbjct: 281 NLISKNLIYTNFFERKTTCL--LNLQFCCRYDVNGFEYR-SFYDNNDYKNYEITISLSAI 337

Query: 451 RMG 453
            + 
Sbjct: 338 NLN 340

>YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulatory
           subunit for protein serine/threonine phosphatase Glc7p
           [2382 bp, 793 aa]
          Length = 793

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 66/137 (48%), Gaps = 36/137 (26%)

Query: 317 LQELSLIGD-QHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMH 375
           L  L+ +GD    + G V VKN+ +EK + +++T +SW   RDI  V A+    +    +
Sbjct: 245 LHSLTQLGDDSSKITGLVYVKNLSFEKYLEIKFTFNSW---RDIHYVTANFNRTI--NSN 299

Query: 376 MDRFKLVIDLAGLQ-----------EGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSR 424
           +D FK  IDL  L+           E +TS            +C L+   ++ C +Y   
Sbjct: 300 VDEFKFTIDLNSLKYILLIKRIITMEKNTS------------SCPLN---IELCCRY--- 341

Query: 425 DANSRVEYWDNNAGRNY 441
           D N+   Y+DNN G+NY
Sbjct: 342 DVNNET-YYDNNNGKNY 357

>Kwal_56.23262
          Length = 429

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 47/89 (52%), Gaps = 8/89 (8%)

Query: 301 LKSNIFLNI-AHNSSCFLQELSLIGDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDI 359
           L+S+I  ++  HN    L  +S   D   L G + V N+ +EK++ +++T ++W   RD+
Sbjct: 9   LQSHILAHLQGHNIK--LNRISACLDSKKLQGLIYVANLNFEKSLEIKFTFNNW---RDV 63

Query: 360 ECVWASSGDDVLPGMHMDRFKLVIDLAGL 388
             V A     +     +D FK  IDLAGL
Sbjct: 64  HYVAAHHHRSITDA--IDEFKFTIDLAGL 90

>CAGL0H04037g complement(379169..381916) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 915

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 7/73 (9%)

Query: 317 LQELSLIGDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHM 376
           L + S I D+  +VG +LVKN+ YEK + V+YT ++W    DI  + A     +     +
Sbjct: 288 LAQDSTIDDK--IVGKILVKNLNYEKFIEVKYTFNNW---NDIHYITAYFTKSI--SAEI 340

Query: 377 DRFKLVIDLAGLQ 389
           D F+  I+L+ L+
Sbjct: 341 DEFEFKINLSSLK 353

>Scas_526.4
          Length = 915

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 329 LVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVIDLAGL 388
           L+G + V N+ +EK + ++++ + W   +DI  V A     V     +D FK VIDL  L
Sbjct: 308 LIGLIYVNNLNFEKFIEIKFSFNHW---KDIHYVTAFLNKSVTSN--IDEFKFVIDLNSL 362

Query: 389 Q 389
           +
Sbjct: 363 K 363

>AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C
           (PIG1) - SH] (1254768..1256807) [2040 bp, 679 aa]
          Length = 679

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 6/73 (8%)

Query: 317 LQELSLIGDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHM 376
           L ++SL+ D H + G + V N+++EK + V+++ D W   ++I  V A     V     +
Sbjct: 275 LNKVSLV-DMHTIKGSLYVTNLHFEKFIEVKFSFDEW---KNIHYVTAQYLKTVTS--KV 328

Query: 377 DRFKLVIDLAGLQ 389
           D F+ +IDL+  +
Sbjct: 329 DEFQFIIDLSSYK 341

>CAGL0F04917g complement(499132..501180) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 682

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 55/123 (44%), Gaps = 8/123 (6%)

Query: 329 LVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVIDLAGL 388
           L G + V N+ +EK + V+++ ++W   +DI    A+    +    H+D F+  ID+   
Sbjct: 192 LKGLIYVNNLNFEKFIEVKFSFNNW---KDIHYATATYNKSITD--HIDEFRFTIDVMTF 246

Query: 389 QEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYWDNNAGRNYVVDVVSS 448
           +    S+        +   C    + +  C +Y   D N+   Y +NN    ++  VV +
Sbjct: 247 KYILKSKGLIYCDSYSNEDCTYCDLSMDLCCRY---DVNNETYYDNNNYKNYHISMVVVT 303

Query: 449 APR 451
           AP 
Sbjct: 304 APN 306

>Scas_659.21
          Length = 594

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 9/98 (9%)

Query: 324 GDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVI 383
           G    LVG +LV N+ +EK + V++T ++W       C   +  +  L  +  D FK  I
Sbjct: 218 GQAFKLVGLILVNNIQFEKNIEVKFTFNNWENI----CYQVAYFNRSL-NVKFDEFKFTI 272

Query: 384 DLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQY 421
           DL   +     +    + D   H      + ++ C +Y
Sbjct: 273 DLTSFKSLLKLQKILYTKDPVTHC----PINIEMCCRY 306

>Scas_521.1
          Length = 579

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 9/98 (9%)

Query: 324 GDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVI 383
           G    LVG +LV N+ +EK + V++T ++W       C   +  +  L     D FK  I
Sbjct: 200 GQAFKLVGLILVNNIQFEKNIEVKFTFNNWENI----CYQVAYFNRSL-NAKFDEFKFTI 254

Query: 384 DLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQY 421
           DL   +     +    + D   H      + ++ C +Y
Sbjct: 255 DLTSFKSLLKLQKILYTKDPVTHC----PINIEMCCRY 288

>KLLA0C06974g complement(604344..605684) similar to sp|P50102
           Saccharomyces cerevisiae YMR223w UBP8, start by
           similarity
          Length = 446

 Score = 32.7 bits (73), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 36/85 (42%), Gaps = 5/85 (5%)

Query: 7   PSDLRREGSNGAFTDRSLAFLHKPQRVTQPRALYADEWLRR----NTDMNRGNVKVENCP 62
           P+ L R+G  G     S  F+    +       + ++ L      N D+  G  K  +C 
Sbjct: 124 PASLHRDGLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSG-TKCVSCA 182

Query: 63  EDYFSQNFKGDGPTKQTAASEANGF 87
            D  + +F G+GP    ++S + GF
Sbjct: 183 LDEIACDFYGNGPGTGKSSSVSKGF 207

>KLLA0D09240g complement(775848..778094) some similarities with
           sp|P28006 Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, regulatory chain,
           hypothetical start
          Length = 748

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 321 SLIGDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFK 380
           SL   Q  L G + V N+ +EK + ++++ + W   +DI  V A+    +     +D F+
Sbjct: 464 SLQLSQGKLTGLIYVNNLSFEKFIEIKFSFNGW---KDIHYVTANFKRTITDT--VDEFQ 518

Query: 381 LVIDLAGL 388
            +I+L+  
Sbjct: 519 FLINLSSF 526

>KLLA0B03850g 345635..350590 similar to sp|P47171 Saccharomyces
            cerevisiae YJR140c HIR3 involved in cell cycle regulation
            of histone transcription singleton, start by similarity
          Length = 1651

 Score = 30.0 bits (66), Expect = 4.8,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 11/77 (14%)

Query: 307  LNIAHNSSCFLQ----ELSLIGDQHYLVGHVLVK-----NVYYEKTVLVRYTRDSWRTSR 357
            L +++N S F Q     + LIGD  Y   HVL +     N Y+   + ++  RD++    
Sbjct: 987  LVLSNNRSNFKQFFETVMELIGDIDYEANHVLSRNEYFFNQYFTAPITLKTIRDAYAGEF 1046

Query: 358  DIECVWASSGDDVLPGM 374
            +IE  + S  DD+  G+
Sbjct: 1047 EIE--FTSPNDDLQSGV 1061

>ACR012C [1060] [Homologous to ScYEL060C (PRB1) - SH; ScYOR003W
           (YSP3) - SH] (378750..380375) [1626 bp, 541 aa]
          Length = 541

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%)

Query: 16  NGAFTDRSLAFLHKPQRVTQPRALYADEWLRRNTDMNRGNVKVENCPEDYFS 67
           NG   D S  + +KP++V+ P+  YAD+     +D++R   ++E+  +  FS
Sbjct: 478 NGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFS 529

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,431,913
Number of extensions: 590261
Number of successful extensions: 1328
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1316
Number of HSP's successfully gapped: 41
Length of query: 456
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 351
Effective length of database: 12,961,219
Effective search space: 4549387869
Effective search space used: 4549387869
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)