Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.575730730316150.0
Sklu_2260.530230312041e-168
Scas_715.4530529311021e-152
YER053C30029210351e-142
Sklu_1119.13072916072e-77
CAGL0F00231g3072916022e-76
YJR077C (MIR1)3112915924e-75
Kwal_33.155973052915915e-75
Scas_673.173142915701e-71
KLLA0B14454g3052935682e-71
AER450C3082915561e-69
Sklu_2359.69022692094e-18
CAGL0K02365g9192842032e-17
ADL049W9122832005e-17
CAGL0K08250g2972861912e-16
Kwal_47.173218812891892e-15
Sklu_2334.23192831852e-15
YPR021C (AGC1)9022861882e-15
AEL253W3652031843e-15
YJL133W (MRS3)3142771824e-15
Sklu_2432.52882371805e-15
Scas_602.88852891792e-14
KLLA0E13453g9062681766e-14
Kwal_26.86692962581664e-13
Sklu_2431.53701881666e-13
Scas_379.23012861656e-13
Scas_721.273741911641e-12
YJR095W (SFC1)3222811631e-12
YKR052C (MRS4)3042881622e-12
KLLA0E23705g3681961622e-12
Kwal_27.120813691901604e-12
Kwal_23.47313143021585e-12
YMR166C3682481596e-12
Scas_691.43342901587e-12
KLLA0D07073g2972581569e-12
Sklu_1149.22962761569e-12
Kwal_33.140503142851551e-11
YBR291C (CTP1)2992901541e-11
Scas_582.73292901542e-11
KLLA0F03212g3052781532e-11
KLLA0D09889g3643161543e-11
AGL311C3622791524e-11
Scas_640.253062631498e-11
ADL009W3792781481e-10
CAGL0M05225g3811821481e-10
CAGL0M09020g3482511481e-10
AFL196W3613231472e-10
Kwal_23.35293953011462e-10
CAGL0F08305g3742651462e-10
YGR257C (MTM1)3662501463e-10
KLLA0B12826g3192101453e-10
ACR109W2992581443e-10
Scas_489.42972631443e-10
Kwal_26.79672972901434e-10
YOR130C (ORT1)2922521434e-10
CAGL0L05742g3053131435e-10
KLLA0E18810g3772701436e-10
YOR222W (ODC2)3072911427e-10
CAGL0L02079g2972721417e-10
YPL134C (ODC1)3103001418e-10
YBR192W (RIM2)3771841428e-10
Scas_709.93652881382e-09
Scas_721.1293231951373e-09
ACR260W3113041364e-09
Kwal_26.76533251741355e-09
CAGL0F07711g3682501356e-09
YGR096W (TPC1)3141831347e-09
CAGL0G01166g2951811338e-09
AFR131C3442661348e-09
Sklu_2430.103241971348e-09
CAGL0G08910g2892851321e-08
YIL006W3731891321e-08
Scas_702.103022711321e-08
YEL006W3351721293e-08
CAGL0J09790g3002881293e-08
Kwal_47.182163333061293e-08
Kwal_23.39653071721284e-08
Scas_669.63732441285e-08
YDL198C (YHM1)3002751275e-08
Sklu_2037.23103001259e-08
Sklu_2363.23233231251e-07
CAGL0H03839g2822641241e-07
KLLA0F13464g3002231241e-07
KLLA0E02772g2842711232e-07
KLLA0A00979g3431321222e-07
YKL120W (OAC1)3242811213e-07
Scas_589.103161621205e-07
Kwal_55.213353171901195e-07
KLLA0C13431g3282871196e-07
Kwal_23.43543432471196e-07
YPR011C3262951188e-07
CAGL0J01661g3272981171e-06
Scas_562.123002861161e-06
Kwal_14.22103153021161e-06
CAGL0J02002g3612941161e-06
ABL023W3091771161e-06
CAGL0K11616g3201901152e-06
Kwal_55.208683801931152e-06
KLLA0E15532g3262941142e-06
Sklu_2117.22982751133e-06
CAGL0G03135g3072021133e-06
YOR100C (CRC1)3272881124e-06
YIL134W (FLX1)3113041124e-06
Kwal_47.192282811341115e-06
Scas_697.473282711107e-06
Kwal_55.211063283181107e-06
YLR348C (DIC1)2981831108e-06
Sklu_2433.84201301108e-06
AAR036W3171261091e-05
Sklu_2127.52782011081e-05
Kwal_27.116262992341081e-05
KLLA0A09383g3662461091e-05
KLLA0F17864g3072131072e-05
AFR253W3441341082e-05
Scas_716.293161851072e-05
CAGL0J04114g3032821072e-05
Scas_632.92922091062e-05
Scas_645.93912551072e-05
CAGL0B04543g3171821036e-05
ADR036C3402461027e-05
KLLA0D15015g3171991028e-05
Scas_558.22892791028e-05
YNL003C (PET8)2842651019e-05
YFR045W2851491019e-05
CAGL0C02013g3291511011e-04
AGL047C316308982e-04
AGR191W298187982e-04
Scas_687.15*328132974e-04
CAGL0K02915g342335974e-04
KLLA0B11319g355236965e-04
KLLA0F04697g307293920.001
Sklu_1275.1311193920.001
AFR146W281180910.002
Sklu_2442.8275269910.002
Kwal_33.15446305192910.002
Scas_578.3*524285910.002
Sklu_2115.4299286890.003
CAGL0H10538g297293890.003
AER366W293250890.003
AGR383W293297890.003
KLLA0D14036g431252890.003
AAL014C271179880.004
Kwal_0.232274260880.004
KLLA0D04950g274184880.004
Sklu_1926.2305261880.004
Scas_718.24337180870.006
Kwal_33.12988303208860.006
CAGL0K10362g301182860.008
Kwal_27.11419298132850.010
CAGL0J05522g519258850.012
Scas_662.12308307840.012
KLLA0C11363g517214850.013
Kwal_56.23011303193840.014
KLLA0E09680g307193840.014
Kwal_27.12481304181830.019
Sklu_2435.2344304820.023
YDL119C30762820.023
Kwal_26.7972358146820.025
KLLA0E08877g294191800.037
Sklu_2075.3345195810.038
AER419W493197810.043
YNL083W545196810.044
KLLA0D04290g188163780.044
Scas_714.18305228790.053
Sklu_2374.7513217800.056
Kwal_34.15907312141780.064
Sklu_2398.4309173780.064
Kwal_55.21338323261780.072
YMR056C (AAC1)30966770.086
Scas_667.430868770.095
Sklu_2194.3312141770.10
Kwal_27.12599304193760.12
YHR002W (LEU5)357152760.12
AER184W30568760.14
AGL064W29685750.15
KLLA0E12353g30568750.16
Scas_667.22306191750.16
YPR058W (YMC1)307199750.18
AGL065C335322750.20
Scas_718.532468740.21
Scas_328.122777720.31
KLLA0F08547g308174720.37
KLLA0E02750g304264720.44
YBL030C (PET9)318185700.65
Kwal_23.2913320191700.69
CAGL0D04774g322280690.90
Scas_696.9312152690.97
Kwal_23.3042542213681.3
Scas_717.20356338671.6
CAGL0F04213g306186671.7
KLLA0B08503g303183662.0
KLLA0D04312g103100632.1
Scas_712.837921653.4
AFR542W310173635.1
CAGL0D01606g30563635.8
CAGL0K12210g31152626.3
AFR147C315254619.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5757
         (303 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5757                                                          626   0.0  
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement        468   e-168
Scas_715.45                                                           429   e-152
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...   403   e-142
Sklu_1119.1 YJR077C, Contig c1119 366-1289                            238   2e-77
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...   236   2e-76
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...   232   4e-75
Kwal_33.15597                                                         232   5e-75
Scas_673.17                                                           224   1e-71
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...   223   2e-71
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...   218   1e-69
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          85   4e-18
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    83   2e-17
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    82   5e-17
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    78   2e-16
Kwal_47.17321                                                          77   2e-15
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         76   2e-15
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    77   2e-15
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    75   3e-15
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    75   4e-15
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       74   5e-15
Scas_602.8                                                             74   2e-14
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    72   6e-14
Kwal_26.8669                                                           69   4e-13
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            69   6e-13
Scas_379.2                                                             68   6e-13
Scas_721.27                                                            68   1e-12
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    67   1e-12
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    67   2e-12
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    67   2e-12
Kwal_27.12081                                                          66   4e-12
Kwal_23.4731                                                           65   5e-12
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    66   6e-12
Scas_691.4                                                             65   7e-12
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    65   9e-12
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         65   9e-12
Kwal_33.14050                                                          64   1e-11
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    64   1e-11
Scas_582.7                                                             64   2e-11
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    64   2e-11
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    64   3e-11
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    63   4e-11
Scas_640.25                                                            62   8e-11
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    62   1e-10
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    62   1e-10
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    62   1e-10
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    61   2e-10
Kwal_23.3529                                                           61   2e-10
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    61   2e-10
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    61   3e-10
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    60   3e-10
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    60   3e-10
Scas_489.4                                                             60   3e-10
Kwal_26.7967                                                           60   4e-10
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    60   4e-10
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    60   5e-10
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    60   6e-10
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    59   7e-10
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    59   7e-10
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    59   8e-10
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    59   8e-10
Scas_709.9                                                             58   2e-09
Scas_721.129                                                           57   3e-09
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    57   4e-09
Kwal_26.7653                                                           57   5e-09
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    57   6e-09
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    56   7e-09
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    56   8e-09
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    56   8e-09
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         56   8e-09
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    55   1e-08
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    55   1e-08
Scas_702.10                                                            55   1e-08
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    54   3e-08
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    54   3e-08
Kwal_47.18216                                                          54   3e-08
Kwal_23.3965                                                           54   4e-08
Scas_669.6                                                             54   5e-08
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    54   5e-08
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         53   9e-08
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          53   1e-07
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    52   1e-07
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    52   1e-07
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    52   2e-07
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    52   2e-07
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    51   3e-07
Scas_589.10                                                            51   5e-07
Kwal_55.21335                                                          50   5e-07
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    50   6e-07
Kwal_23.4354                                                           50   6e-07
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    50   8e-07
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    50   1e-06
Scas_562.12                                                            49   1e-06
Kwal_14.2210                                                           49   1e-06
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    49   1e-06
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    49   1e-06
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    49   2e-06
Kwal_55.20868                                                          49   2e-06
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    49   2e-06
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            48   3e-06
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    48   3e-06
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    48   4e-06
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    48   4e-06
Kwal_47.19228                                                          47   5e-06
Scas_697.47                                                            47   7e-06
Kwal_55.21106                                                          47   7e-06
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    47   8e-06
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       47   8e-06
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    47   1e-05
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         46   1e-05
Kwal_27.11626                                                          46   1e-05
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    47   1e-05
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    46   2e-05
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    46   2e-05
Scas_716.29                                                            46   2e-05
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    46   2e-05
Scas_632.9                                                             45   2e-05
Scas_645.9                                                             46   2e-05
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    44   6e-05
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    44   7e-05
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    44   8e-05
Scas_558.2                                                             44   8e-05
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    44   9e-05
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    44   9e-05
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    44   1e-04
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    42   2e-04
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    42   2e-04
Scas_687.15*                                                           42   4e-04
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    42   4e-04
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    42   5e-04
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    40   0.001
Sklu_1275.1 , Contig c1275 314-1249                                    40   0.001
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    40   0.002
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          40   0.002
Kwal_33.15446                                                          40   0.002
Scas_578.3*                                                            40   0.002
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            39   0.003
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    39   0.003
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    39   0.003
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    39   0.003
KLLA0D14036g complement(1203522..1204817) some similarities with...    39   0.003
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    39   0.004
Kwal_0.232                                                             39   0.004
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    39   0.004
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          39   0.004
Scas_718.24                                                            38   0.006
Kwal_33.12988                                                          38   0.006
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    38   0.008
Kwal_27.11419                                                          37   0.010
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    37   0.012
Scas_662.12                                                            37   0.012
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    37   0.013
Kwal_56.23011                                                          37   0.014
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    37   0.014
Kwal_27.12481                                                          37   0.019
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         36   0.023
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    36   0.023
Kwal_26.7972                                                           36   0.025
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    35   0.037
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                36   0.038
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    36   0.043
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    36   0.044
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    35   0.044
Scas_714.18                                                            35   0.053
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       35   0.056
Kwal_34.15907                                                          35   0.064
Sklu_2398.4 , Contig c2398 9476-10405                                  35   0.064
Kwal_55.21338                                                          35   0.072
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    34   0.086
Scas_667.4                                                             34   0.095
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            34   0.10 
Kwal_27.12599                                                          34   0.12 
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    34   0.12 
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    34   0.14 
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    33   0.15 
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    33   0.16 
Scas_667.22                                                            33   0.16 
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    33   0.18 
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    33   0.20 
Scas_718.5                                                             33   0.21 
Scas_328.1                                                             32   0.31 
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    32   0.37 
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    32   0.44 
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    32   0.65 
Kwal_23.2913                                                           32   0.69 
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    31   0.90 
Scas_696.9                                                             31   0.97 
Kwal_23.3042                                                           31   1.3  
Scas_717.20                                                            30   1.6  
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    30   1.7  
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    30   2.0  
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    29   2.1  
Scas_712.8                                                             30   3.4  
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    29   5.1  
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    29   5.8  
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    28   6.3  
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    28   9.3  

>Kwal_23.5757
          Length = 307

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/303 (100%), Positives = 303/303 (100%)

Query: 1   MSQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG 60
           MSQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG
Sbjct: 1   MSQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG 60

Query: 61  WRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFL 120
           WRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFL
Sbjct: 61  WRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFL 120

Query: 121 AASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLW 180
           AASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLW
Sbjct: 121 AASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLW 180

Query: 181 FRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPAD 240
           FRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPAD
Sbjct: 181 FRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPAD 240

Query: 241 VMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAA 300
           VMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAA
Sbjct: 241 VMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAA 300

Query: 301 AGL 303
           AGL
Sbjct: 301 AGL 303

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score =  468 bits (1204), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 226/303 (74%), Positives = 253/303 (83%), Gaps = 5/303 (1%)

Query: 1   MSQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG 60
           MS K  I     L+SPEYYAACTLGG+VACGPTHS+VTPLDLVKCR QV+  LY+SNLDG
Sbjct: 1   MSTKQPI----PLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDG 56

Query: 61  WRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFL 120
           W+ IVRSEG +KVFTGVGAT IGYSLQGA KYGGYE+FK  YS L+SPETAH +RT ++L
Sbjct: 57  WKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYL 116

Query: 121 AASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLW 180
            ASASAEF+ADI LCPWEAIKV+QQT +PP F +N  + +SK+  AEG + LYKGITPLW
Sbjct: 117 CASASAEFLADILLCPWEAIKVKQQTTIPP-FCKNFLEGWSKITAAEGLSGLYKGITPLW 175

Query: 181 FRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPAD 240
            RQIPYTMCKFTSFERIVEMIYA+LP  K+EMS   QI VSF GGYLAGILCAVVSHPAD
Sbjct: 176 CRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPAD 235

Query: 241 VMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAA 300
           VMVSKVN +RK GES ++A+ RIY +IGF GLWNGL VRI MIGTLTSFQWLIYDSFKA 
Sbjct: 236 VMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAY 295

Query: 301 AGL 303
            GL
Sbjct: 296 IGL 298

>Scas_715.45
          Length = 305

 Score =  429 bits (1102), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 212/293 (72%), Positives = 235/293 (80%), Gaps = 3/293 (1%)

Query: 13  LYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATK 72
           LY+ EYYAACTLGG+VACGPTHS+VTPLDL+KCR QVD +LY+SN  G  QI++ EG  K
Sbjct: 10  LYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGK 69

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYS-QLVSPE-TAHSYRTGIFLAASASAEFIA 130
           +FTGVGAT IGYSLQGA KYGGYE FK  YS  LV  E TA+ YRT I+L +SA+AEF A
Sbjct: 70  LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA 129

Query: 131 DIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
           DI LCP+EAIKV+QQT +PP +  NV + + KM   EG    YKGITPLW RQIPYTMCK
Sbjct: 130 DIMLCPFEAIKVKQQTTMPP-WCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188

Query: 191 FTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER 250
           FTSFERIVE IYARLPT K EMS L QISVSF GGY+AGILCA+VSHPADVMVSK+NNER
Sbjct: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNER 248

Query: 251 KSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAGL 303
           K  ES   A  RIY +IGF GLWNGL VRILMIGTLTSFQWLIYDSFKA  GL
Sbjct: 249 KVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGL 301

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score =  403 bits (1035), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/292 (67%), Positives = 229/292 (78%), Gaps = 8/292 (2%)

Query: 13  LYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATK 72
           LY+ E+YA CTLGG++ACGPTHS++TPLDLVKCR QV+  LY SNL G+R+I+ +EG  K
Sbjct: 12  LYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKK 71

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADI 132
           V+TG GAT +GYSLQGA KYGGYE+FKH YS  +SP         ++L ASA+AEF+ADI
Sbjct: 72  VYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT------VYLMASATAEFLADI 125

Query: 133 FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEG-FASLYKGITPLWFRQIPYTMCKF 191
            LCP+EAIKV+QQT +PP F  NV D + KM    G   + YKGI PLW RQIPYTMCKF
Sbjct: 126 MLCPFEAIKVKQQTTMPP-FCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKF 184

Query: 192 TSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERK 251
           TSFE+IV+ IY+ LP  K EM+ L QISVSF GGYLAGILCA VSHPADVMVSK+N+ERK
Sbjct: 185 TSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERK 244

Query: 252 SGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAGL 303
           + ES   A+ RIY KIGF GLWNGL VRI+MIGTLTSFQWLIYDSFKA  GL
Sbjct: 245 ANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score =  238 bits (607), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 121/291 (41%), Positives = 181/291 (62%), Gaps = 5/291 (1%)

Query: 14  YSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLY-KSNLDGWRQIVRSEGATK 72
           YS   YA   L G + CG THSA+ P+D+VK R Q++ ++Y K  +  ++QI+ SEGA  
Sbjct: 8   YSLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGA 67

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADI 132
           + TG G T +GYSLQG+FK+GGYE FK  +  ++  + A +Y+  I++ ++A AEF ADI
Sbjct: 68  LLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADI 127

Query: 133 FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFT 192
            LCP EA ++R  +   P FA  +   +S+++  EG  S Y G TP+ F+QIPY + KF 
Sbjct: 128 ALCPLEATRIRLVSQ--PTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFL 185

Query: 193 SFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKS 252
            FER  E +Y  +  PK  +S      ++   G  AG+  A+VS PAD ++SKVN  +K+
Sbjct: 186 VFERAAE-VYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTKKA 244

Query: 253 -GESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAG 302
            G+ST+   +++  ++GF G + GL  R++M+GTLTS Q+ IY S K   G
Sbjct: 245 PGQSTIGLLAQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTLG 295

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score =  236 bits (602), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 182/291 (62%), Gaps = 5/291 (1%)

Query: 14  YSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG-WRQIVRSEGATK 72
           YS   YA   L G + CG THS++ P+D+VK R Q++ ++Y   + G +R+I+  EGA  
Sbjct: 8   YSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGA 67

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADI 132
           + TG G T +GYS+QGAFK+GGYE FK  +   +  +TA  Y+  +++ ++A+AEF+ADI
Sbjct: 68  LLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADI 127

Query: 133 FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFT 192
            LCP EA ++R  +   P FA  +   +S+++  EG  S Y G TP+ F+QIPY + KF 
Sbjct: 128 ALCPLEATRIRLVSQ--PTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFL 185

Query: 193 SFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKS 252
            FER  E+ ++  P PK  +SQ    +++   G  AG+  A+VS PAD ++SKVN   K+
Sbjct: 186 VFERASELYFSLAP-PKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKA 244

Query: 253 -GESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAG 302
            G+ST+    ++  ++GF G + GL  R++M+GTLTS Q+ IY   K + G
Sbjct: 245 PGQSTVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGQLKKSLG 295

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score =  232 bits (592), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 118/291 (40%), Positives = 179/291 (61%), Gaps = 5/291 (1%)

Query: 14  YSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG-WRQIVRSEGATK 72
           YS   Y    L G + CG THS++ P+D+VK R Q++ ++Y   + G ++QI+  EGA  
Sbjct: 12  YSVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGA 71

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADI 132
           + TG G T +GYS+QGAFK+GGYE FK  +   +  +TA  Y+  +++ ++A AEF+ADI
Sbjct: 72  LLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADI 131

Query: 133 FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFT 192
            LCP EA ++R  +   P FA  +   +S+++  EG  S Y G TP+ F+QIPY + KF 
Sbjct: 132 ALCPLEATRIRLVSQ--PQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFL 189

Query: 193 SFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKS 252
            FER  E  Y     PK ++S      ++   G  AG+  A+VS PAD ++SKVN  +K+
Sbjct: 190 VFERASEFYYG-FAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKA 248

Query: 253 -GESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAG 302
            G+ST+   +++  ++GF G + GL  R++M+GTLTS Q+ IY S K+  G
Sbjct: 249 PGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTLG 299

>Kwal_33.15597
          Length = 305

 Score =  232 bits (591), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 180/291 (61%), Gaps = 5/291 (1%)

Query: 14  YSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLY-KSNLDGWRQIVRSEGATK 72
           Y+   YA   L G + CG THSA+ P+D+VK R Q++ ++Y K  +  ++QI+ SEGA  
Sbjct: 8   YTISDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGA 67

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADI 132
           + TG G T +GYSLQG+FK+GGYE FK  +   +  + A +Y+  I++ ++A AEF ADI
Sbjct: 68  LLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADI 127

Query: 133 FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFT 192
            LCP EA ++R  +   P FA  +   +S+++  EG +S Y G TP+ F+QIPY + KF 
Sbjct: 128 ALCPLEATRIRLVSQ--PTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFL 185

Query: 193 SFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKS 252
            FER  E +Y  +  PK  +S      ++   G  AG+  A+VS PAD ++SKVN  +K+
Sbjct: 186 VFERAAE-VYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKVNKAKKA 244

Query: 253 -GESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAG 302
            G+ST+    ++  ++GF G + GL  R++M+GTLTS Q+ IY S K   G
Sbjct: 245 PGQSTIGLLGQLAKELGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTLG 295

>Scas_673.17
          Length = 314

 Score =  224 bits (570), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 174/291 (59%), Gaps = 5/291 (1%)

Query: 14  YSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG-WRQIVRSEGATK 72
           Y+   Y    L G + CG THS++ P+D+VK R Q++ ++Y   + G +++I+  EGA  
Sbjct: 15  YAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGA 74

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADI 132
           + TG G T +GYS+QGAFK+GGYE FK      +  E A  Y+  +++ ++A AEF+ADI
Sbjct: 75  LLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADI 134

Query: 133 FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFT 192
            LCP EA ++R  +   P FA  +   +S+++  EG  S Y G TP+ F+QIPY + KF 
Sbjct: 135 ALCPLEATRIRLVS--QPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFL 192

Query: 193 SFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKS 252
            FER  E+ Y  +   K  +S +    ++   G  AG   A VS PAD ++SKVN  +K+
Sbjct: 193 VFERASEVYYG-IVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKA 251

Query: 253 -GESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAG 302
            G+ST+   +++  ++G  G + GL  R++M+GTLTS Q+ IY S K   G
Sbjct: 252 PGQSTIGLLAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQFAIYGSLKNTLG 302

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score =  223 bits (568), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 123/293 (41%), Positives = 182/293 (62%), Gaps = 9/293 (3%)

Query: 16  PEY----YAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLY-KSNLDGWRQIVRSEGA 70
           PEY    YA   L G + CG THS++ P+D+VK R Q++ ++Y K  +  ++QI+ SEGA
Sbjct: 6   PEYTVSDYAKFALAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGA 65

Query: 71  TKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIA 130
             + TG G T +GYSLQG+FK+GGYE FK      +  + A +Y+  I++ ++A AEF A
Sbjct: 66  GALLTGFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFA 125

Query: 131 DIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
           DI LCP EA ++R  +   P FA  +F  +S+++  EG  S Y G TP+ F+QIPY + K
Sbjct: 126 DIALCPLEATRIRLVSQ--PTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAK 183

Query: 191 FTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER 250
           F  FE      Y  L  PK  MS+    +++ A G  AG+  AVVS PAD ++SKVN  +
Sbjct: 184 FFVFEHAANA-YFGLAGPKETMSETTHTAINLAAGLTAGLAAAVVSQPADTLLSKVNKTK 242

Query: 251 KS-GESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAG 302
           K+ G+ST+   +++  ++GF G + GL  R++M+GTLTS Q+ IY + K + G
Sbjct: 243 KAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFGIYGTLKKSLG 295

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score =  218 bits (556), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 173/291 (59%), Gaps = 5/291 (1%)

Query: 14  YSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG-WRQIVRSEGATK 72
           YS   YA   L G + CG THSA+ P+D+VK R Q++   Y S + G +R+IV  EGA  
Sbjct: 10  YSLSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAA 69

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADI 132
           + TG G T +GYS+QGAFK+GGYE FK  +   +  ETA  YRT I++ ++A AEF ADI
Sbjct: 70  LLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADI 129

Query: 133 FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFT 192
            LCP EA ++R  +   P FA  +   +++++  EG  S Y G TP+ F+QIPY + KF 
Sbjct: 130 ALCPLEATRIRLVSQ--PTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFV 187

Query: 193 SFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKS 252
            FE      Y  L   K  +S      ++   G  AG+  AV+S PAD ++SKVN  +K+
Sbjct: 188 VFEHAANA-YFGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKVNKTKKA 246

Query: 253 -GESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAG 302
            G+ST     ++  ++GF G + GL  R++M+GTLTS Q+ IY   K + G
Sbjct: 247 PGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGKLKQSLG 297

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 127/269 (47%), Gaps = 20/269 (7%)

Query: 23  TLGGLVAC-GPTHSAVTPLDLVKCRRQVDASL--YKSNLDGWRQIVRSEGATKVFTGVGA 79
           TLG +  C G T   V P+DLVK R Q   S   YK+++D + +I   EG   +++G+G 
Sbjct: 523 TLGSIAGCIGAT--VVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGLGP 580

Query: 80  TAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
             IG + + A K    ++ +    +L+       +   I   A A A  +  +F  P E 
Sbjct: 581 QLIGVAPEKAIKLTVNDYMR---GRLMDKHANLKWYFEILSGACAGACQV--VFTNPLEV 635

Query: 140 IKVRQQTAVPPPFARNVFDAYSKMVGA---EGFASLYKGITPLWFRQIPYTMCKFTSFER 196
           +K+R Q  V   +A +V  +    +G     G   LYKGI     R +P++   F ++  
Sbjct: 636 VKIRLQ--VRSEYAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPTYAH 693

Query: 197 IVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGES- 255
           + + ++   P  K++ ++L    +  AGG LAG+  A ++ P DV+ +++  + + GE+ 
Sbjct: 694 LKKDVFKYDPKDKKQRNKLKTWELLVAGG-LAGMPAAYLTTPFDVIKTRLQIDPRKGETR 752

Query: 256 ---TLQATSRIYGKIGFPGLWNGLAVRIL 281
                 A   I  +  F   + G + R+L
Sbjct: 753 YEGIFHAARTILKEESFKSFFKGGSARVL 781

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 36/82 (43%), Gaps = 5/82 (6%)

Query: 25  GGLVACGPTHSAVTPLDLVKCRRQVD----ASLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           GGL A  P     TP D++K R Q+D     + Y+      R I++ E     F G  A 
Sbjct: 721 GGL-AGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSAR 779

Query: 81  AIGYSLQGAFKYGGYEFFKHQY 102
            +  S Q  F    YE F++ +
Sbjct: 780 VLRSSPQFGFTLAAYEIFQNMF 801

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/63 (22%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 221 SFAGGYLAGILCAVVSHPADVMVSKVNNERKSGE--STLQATSRIYGKIGFPGLWNGLAV 278
           +F  G +AG + A V +P D++ +++  +R   +  +++   ++I+ + G  G+++GL  
Sbjct: 521 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGLGP 580

Query: 279 RIL 281
           +++
Sbjct: 581 QLI 583

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 75/284 (26%), Positives = 127/284 (44%), Gaps = 17/284 (5%)

Query: 23  TLGGLVAC-GPTHSAVTPLDLVKCRRQVDASL--YKSNLDGWRQIVRSEGATKVFTGVGA 79
           +LG +  C G T   V P+D VK R Q   SL  YK+++D + +I+  EG   V++G+G 
Sbjct: 548 SLGSVAGCIGAT--IVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGP 605

Query: 80  TAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
             IG + + A K    ++ +   ++L          + I   ASA A  +  IF  P E 
Sbjct: 606 QLIGVAPEKAIKLTVNDYMR---NKLKDKNGKLGLLSEIISGASAGACQV--IFTNPLEI 660

Query: 140 IKVRQQTA--VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERI 197
           +K+R Q         A N      +++   G   LYKG      R +P++   F ++  +
Sbjct: 661 VKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHL 720

Query: 198 VEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGES-- 255
              ++   P  K + S+L    +  + G LAG+  A ++ P DV+ +++  + K GE+  
Sbjct: 721 KRDLFNFDPNDKNKRSRLNTWEL-LSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIY 779

Query: 256 --TLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSF 297
              + A   I  +  F   + G A R+L       F    Y+ F
Sbjct: 780 KGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYELF 823

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 81.6 bits (200), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 76/283 (26%), Positives = 126/283 (44%), Gaps = 16/283 (5%)

Query: 23  TLGGLVACGPTHSAVTPLDLVKCRRQV--DASLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           TLG +  C      V P+D+VK R Q   D S YK+++D   +I+  EG   +++G+G  
Sbjct: 529 TLGSVAGCIGA-MVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGPQ 587

Query: 81  AIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAI 140
            IG + + A K    +   H  + L   +   S    I   A+A A  +  +F  P E +
Sbjct: 588 LIGVAPEKAIKLTVND---HMRATLAGRDGKLSLPCEIISGATAGACQV--VFTNPLEIV 642

Query: 141 KVRQQ--TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIV 198
           K+R Q  +      ARN  +A S ++   G   LY+G      R IP++   F ++  I 
Sbjct: 643 KIRLQVKSDYVADAARNSVNAIS-VIKNLGLIGLYRGAGACLLRDIPFSAIYFPTYAHIK 701

Query: 199 EMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQ 258
             ++   P    + ++L    +  +GG LAG+  A ++ P DV+ +++  + K GES   
Sbjct: 702 SNVFNFDPKDSDKRNKLNTWQLLVSGG-LAGMPAAFLTTPFDVIKTRLQIDPKKGESVYN 760

Query: 259 ----ATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSF 297
               A   I  + G    + G   R+L       F    Y+ F
Sbjct: 761 GIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIF 803

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 5/82 (6%)

Query: 25  GGLVACGPTHSAVTPLDLVKCRRQVDA----SLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           GGL A  P     TP D++K R Q+D     S+Y    D  R I++ EG    F G  A 
Sbjct: 727 GGL-AGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPAR 785

Query: 81  AIGYSLQGAFKYGGYEFFKHQY 102
            +  S Q  F    YE F + +
Sbjct: 786 VLRSSPQFGFTLAAYEIFHNLF 807

 Score = 32.7 bits (73), Expect = 0.37,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 221 SFAGGYLAGILCAVVSHPADVMVSKVNNERKSG--ESTLQATSRIYGKIGFPGLWNGLAV 278
           +F  G +AG + A+V +P D++ +++  +R     ++++    +I  K G  GL++GL  
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGP 586

Query: 279 RILMIGTLTSFQWLIYDSFKA 299
           +++ +    + +  + D  +A
Sbjct: 587 QLIGVAPEKAIKLTVNDHMRA 607

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 119/286 (41%), Gaps = 27/286 (9%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN--LDGWRQIVRSEGATKVFTGVGATA 81
           L G  A    HS + P+D +K R Q  +S   +   +    +I  +EG+  ++ GV +  
Sbjct: 21  LAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQSVI 80

Query: 82  IGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIK 141
           +G     A  +  YEF K   S+L+ P+  H+++      +  +A  +AD  + P++ IK
Sbjct: 81  LGAGPAHAVYFATYEFSK---SKLIDPQDMHTHQPIKTAISGMAATTVADALMNPFDVIK 137

Query: 142 VRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201
            R Q         +V+     +   EGFA+ Y          IP+    F  +E   + +
Sbjct: 138 QRMQLNT----RESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKFM 193

Query: 202 YARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVS--------KVNNERKSG 253
                 P  E +      +    G L+G  CA ++ P D + +         V+NE    
Sbjct: 194 -----NPSNEYNPF----IHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQ 244

Query: 254 ESTLQ-ATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
            +T Q A S IY   G+ G   GL  R++     T+  W  Y+  K
Sbjct: 245 ANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAK 290

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 77/177 (43%), Gaps = 8/177 (4%)

Query: 120 LAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPL 179
           L A A A  +    L P +AIK R Q++      + +    SK+  AEG  +L+KG+  +
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQSV 79

Query: 180 WFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPA 239
                P     F ++    E   ++L  P ++M     I  + + G  A  +   + +P 
Sbjct: 80  ILGAGPAHAVYFATY----EFSKSKLIDP-QDMHTHQPIKTAIS-GMAATTVADALMNPF 133

Query: 240 DVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDS 296
           DV+  ++  +  + ES    T  IY K GF   +      ++M     +F + IY+S
Sbjct: 134 DVIKQRM--QLNTRESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYES 188

>Kwal_47.17321
          Length = 881

 Score = 77.4 bits (189), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 132/289 (45%), Gaps = 28/289 (9%)

Query: 24  LGGLVAC-GPTHSAVTPLDLVKCRRQV--DASLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           LG +  C G T  AV P+DLVK R Q   + S YK+++D + +I   EG   +++G+G  
Sbjct: 506 LGSVAGCIGAT--AVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGLGPQ 563

Query: 81  AIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAI 140
            +G + + A K    ++ +     L+      +    I   A+A A  +  IF  P E +
Sbjct: 564 LVGVAPEKAIKLTVNDYVR---KLLMDENNRLTLPLEIISGAAAGACQV--IFTNPLEIV 618

Query: 141 KVRQQTAVPPPFARNVFDAYSK-------MVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193
           K+R Q  V   +A    D+  K       +V + G   LYKG+     R +P++   F +
Sbjct: 619 KIRLQ--VRSEYA----DSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPT 672

Query: 194 FERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSG 253
           +  +   I+   P  K + ++L    +  AGG LAG+  A ++ P DV+ +++  + + G
Sbjct: 673 YAHLKRDIFNYDPQDKNKRARLHTWELLTAGG-LAGMPAAYLTTPFDVIKTRLQIDPRKG 731

Query: 254 ES----TLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
           E+     L A   I  +  F   + G   R+L       F    Y+ F+
Sbjct: 732 ETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQ 780

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 42/99 (42%), Gaps = 6/99 (6%)

Query: 23  TLGGLVACGPTHSAVTPLDLVKCRRQVD----ASLYKSNLDGWRQIVRSEGATKVFTGVG 78
           T GGL A  P     TP D++K R Q+D     + Y   L   R I++ E     F G G
Sbjct: 701 TAGGL-AGMPAAYLTTPFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFFKGGG 759

Query: 79  ATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTG 117
           A  +  S Q  F    YE F++ +  L   E   S  T 
Sbjct: 760 ARVLRSSPQFGFTLAAYEIFQNMFP-LQHSENNESRETN 797

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 121/283 (42%), Gaps = 44/283 (15%)

Query: 39  PLDLVKCRRQVDASLYKSNLDGW---------RQIVRSEGATKVFTGVGATAIGYSLQGA 89
           PLD +K R Q+     +S L+G          R I   EG   ++ G+GA  IG   + A
Sbjct: 30  PLDTIKVRMQI---YRRSALEGIKPPGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMA 86

Query: 90  FKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ---- 145
            ++  YEF++   S L   +T        FLA   +    A + + P E +K+R Q    
Sbjct: 87  IRFSSYEFYR---SALADKQTGSVSTGNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHL 143

Query: 146 ---TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIY 202
              TA  P + RN   A   +V  EG  +LY+G++    RQ       FT + ++ E + 
Sbjct: 144 HPETAASPRY-RNALQACYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLKEFLQ 202

Query: 203 ARLPT---PKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQA 259
               T   P  E S +G IS         G +    + P D + +++  ++ +  + +  
Sbjct: 203 EHHKTDALPSWETSCIGLIS---------GAIGPFSNAPLDTIKTRLQKDKST--ANMSG 251

Query: 260 TSRIY--GKI-----GFPGLWNGLAVRILMIGTLTSFQWLIYD 295
            SRI   GK      GF  L+ G+  R++ +    +  + +Y+
Sbjct: 252 WSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 294

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 78/189 (41%), Gaps = 20/189 (10%)

Query: 28  VACGPTHSA--VTPLDLVKCRRQVD--------ASLYKSNLDGWRQIVRSEGATKVFTGV 77
           V  G T +   V P+++VK R Q          +  Y++ L     IV+ EG   ++ GV
Sbjct: 117 VGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGV 176

Query: 78  GATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTG-IFLAASASAEFIADIFLCP 136
             TA   +      +  Y   K    +    +   S+ T  I L + A   F       P
Sbjct: 177 SLTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSN----AP 232

Query: 137 WEAIKVRQQ----TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFT 192
            + IK R Q    TA    ++R +     +++  EGF +LYKGITP   R  P     FT
Sbjct: 233 LDTIKTRLQKDKSTANMSGWSR-IVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFT 291

Query: 193 SFERIVEMI 201
            +E + E +
Sbjct: 292 VYEFVREHL 300

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 15/99 (15%)

Query: 16  PEYYAACTLGGLV--ACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGW-------RQIVR 66
           P +  +C   GL+  A GP  +A  PLD +K R Q D S   +N+ GW       +Q+++
Sbjct: 211 PSWETSCI--GLISGAIGPFSNA--PLDTIKTRLQKDKS--TANMSGWSRIVTIGKQLIK 264

Query: 67  SEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQL 105
            EG   ++ G+    +  +   A  +  YEF +     L
Sbjct: 265 EEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHLETL 303

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 128/286 (44%), Gaps = 19/286 (6%)

Query: 23  TLGGLVAC-GPTHSAVTPLDLVKCRRQVDASL--YKSNLDGWRQIVRSEGATKVFTGVGA 79
           +LG +  C G T   V P+D +K R Q   SL  YK+++D   +I+  EG   +++G+G 
Sbjct: 535 SLGSIAGCIGAT--VVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGP 592

Query: 80  TAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
             IG + + A K    +F +   ++L       S    I   ASA A  +  IF  P E 
Sbjct: 593 QLIGVAPEKAIKLTVNDFMR---NRLTDKNGKLSLFPEIISGASAGACQV--IFTNPLEI 647

Query: 140 IKVRQQTAVPPPFARNVFDAY---SKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFER 196
           +K+R Q         N+  A    +++V   G   LY G+     R +P++   F ++  
Sbjct: 648 VKIRLQVQ-SDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAH 706

Query: 197 IVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGEST 256
           + + ++   P  K + ++L    +  AG  +AG+  A ++ P DV+ +++  + + GE+ 
Sbjct: 707 LKKDLFDFDPNDKTKRNRLKTWELLTAGA-IAGMPAAFLTTPFDVIKTRLQIDPRKGETK 765

Query: 257 ----LQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
                 A   I  +  F   + G   R+L       F    Y+ FK
Sbjct: 766 YNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELFK 811

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 221 SFAGGYLAGILCAVVSHPADVMVSKVNNERKSGE--STLQATSRIYGKIGFPGLWNGLAV 278
           +F+ G +AG + A V +P D + +++  +R   +  +++    +I  + G  GL++GL  
Sbjct: 533 NFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGP 592

Query: 279 RILMIGTLTSFQWLIYD 295
           +++ +    + +  + D
Sbjct: 593 QLIGVAPEKAIKLTVND 609

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 102/203 (50%), Gaps = 31/203 (15%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASL------YKSNLDGWRQIVRSEGATKVFTGV 77
           L G  A   T +A  P+ LVK R Q+D +       YK++ D  + ++R+EG   ++ G+
Sbjct: 168 LAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGL 227

Query: 78  GATAIGYSLQGAFKYGGYEFFKHQYSQL-------VSPETAHSY--------RTGIFLAA 122
            A+ +G S++   ++  YE  KH   Q        +S E   +Y        R+G    +
Sbjct: 228 SASYLG-SVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSG----S 282

Query: 123 SASAEFIADIFLCPWEAIKVRQQTAVPPPFAR----NVFDAYSKMVGAEGFASLYKGITP 178
           + +A+  A I   P E ++ R + A P    +     +F ++S ++  EGFAS+Y G+TP
Sbjct: 283 AGAAKLFASILTYPHEVVRTRLRQA-PKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTP 341

Query: 179 LWFRQIPYTMCKFTSFERIVEMI 201
              R +P ++  F ++E +++++
Sbjct: 342 HLMRTVPNSIIMFGTWELVIKLL 364

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 80/189 (42%), Gaps = 33/189 (17%)

Query: 135 CPWEAIKVRQQTAV------PPPFAR-NV----FDAYSKMVG-------AEGFASLYKGI 176
           CP++ +K R Q+ V          AR NV       + + VG        EGF SL+KG+
Sbjct: 68  CPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGL 127

Query: 177 TPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVS 236
            P     IP     F ++  + +   +RL    +E        + F  G  AG   +  +
Sbjct: 128 GPNLVGVIPARSINFFTYG-VTKDTASRLLNDGQEAPW-----IHFLAGATAGWATSTAT 181

Query: 237 HPADVMVSKVNNERKSG------ESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTS-F 289
           +P  ++ +++  ++ +       +++      +    G  GL+ GL+   L  G++ S  
Sbjct: 182 NPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYL--GSVESIL 239

Query: 290 QWLIYDSFK 298
           QW++Y+  K
Sbjct: 240 QWVLYEQMK 248

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 114/277 (41%), Gaps = 28/277 (10%)

Query: 34  HSAVTPLDLVKCRRQ---VDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAF 90
           HS + P+D +K R Q     +   K+ L     I  SEG   ++ GV +  +G     A 
Sbjct: 48  HSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAV 107

Query: 91  KYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPP 150
            +G YEF K         +T H ++T I   + A A   +D  + P++ IK R Q     
Sbjct: 108 YFGTYEFCKKNLIDSSDTQTHHPFKTAI---SGACATTASDALMNPFDTIKQRIQLNT-- 162

Query: 151 PFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKR 210
             + +V+    ++  +EG A+ Y          IP+    F  +E   + +      P  
Sbjct: 163 --SASVWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFL-----NPSN 215

Query: 211 EMSQLGQISVSFAGGYLAGILCAVVSHPADVM--VSKVNNER-------KSGESTLQATS 261
           E + L    +    G ++G  CA ++ P D +  V ++   +       +  ++  +A S
Sbjct: 216 EYNPL----IHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAAS 271

Query: 262 RIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
            IY   G+ G W G   RI+     T+  W  Y+  K
Sbjct: 272 AIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAK 308

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 73.9 bits (180), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 102/237 (43%), Gaps = 20/237 (8%)

Query: 25  GGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGY 84
           GG+VAC  TH    PLDL K R Q   +   + +    QI+R+EG   +++G+ A  +  
Sbjct: 18  GGIVACVATH----PLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQ 73

Query: 85  SLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQ 144
                 ++G Y+F K +Y   +  E  +S      L  S  +  +  +   P + + +R 
Sbjct: 74  CTYTTARFGVYDFVKERY---IPKEYLNSML--YLLPCSMFSGAVGGLIGNPADVVNIRM 128

Query: 145 Q--TAVPPPFARN---VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVE 199
           Q  +++P    RN     D   K+   EG A L+ G  P   R I  T  +  +++    
Sbjct: 129 QNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIAKN 188

Query: 200 MIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGEST 256
            +   +   K   S        FA   LAG++   V  PADV+ ++V N  K    +
Sbjct: 189 YLVQNVGLDKDNKS------THFASSLLAGLVATTVCSPADVIKTRVMNAHKHSHDS 239

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%)

Query: 225 GYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIG 284
           G   GI+  V +HP D+   ++        + ++  S+I    G PGL++GL   IL   
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQC 74

Query: 285 TLTSFQWLIYDSFK 298
           T T+ ++ +YD  K
Sbjct: 75  TYTTARFGVYDFVK 88

>Scas_602.8
          Length = 885

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 128/289 (44%), Gaps = 25/289 (8%)

Query: 23  TLGGLVAC-GPTHSAVTPLDLVKCRRQVDASL--YKSNLDGWRQIVRSEGATKVFTGVGA 79
           +LG +  C G T   V P+D +K R Q   SL  YK+++D   +I   EG   +++G+G 
Sbjct: 503 SLGSVAGCIGAT--LVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGP 560

Query: 80  TAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
             IG + + A K    +F +     LV  +   + + G  + + A+A     +F  P E 
Sbjct: 561 QLIGVAPEKAIKLTVNDFMR---KSLV--DKKGNLQLGAEVLSGATAGACQVVFTNPLEI 615

Query: 140 IKVRQQ------TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193
           +K+R Q       A+ P      F    +++       LYKG+     R +P++   F +
Sbjct: 616 VKIRLQVKSEYTNAMIPKSQLTAF----QIIKELKLIGLYKGVGACLLRDVPFSAIYFPT 671

Query: 194 FERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSG 253
           +  + + ++   P  K +  +L    +  AG  LAG+  A ++ P DV+ +++  E   G
Sbjct: 672 YAHLKKNVFQFDPNDKDKRDRLKTWELLTAGA-LAGVPAAFLTTPFDVIKTRLQIEPGVG 730

Query: 254 ES----TLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
           E+     L A   I  +  F   + G A R++       F    Y+ FK
Sbjct: 731 ETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFK 779

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

Query: 25  GGLVACGPTHSAVTPLDLVKCRRQVD----ASLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
            G +A  P     TP D++K R Q++     + Y   L   R I++ E     F G  A 
Sbjct: 701 AGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGAAR 760

Query: 81  AIGYSLQGAFKYGGYEFFKHQYS 103
            +  S Q  F    YE FK+ ++
Sbjct: 761 VMRSSPQFGFTLAAYELFKNMFN 783

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 221 SFAGGYLAGILCAVVSHPADVMVSKVNNERK--SGESTLQATSRIYGKIGFPGLWNGLAV 278
           +F+ G +AG + A + +P D + +++  +R     ++++    +I+GK G  GL++GL  
Sbjct: 501 NFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGP 560

Query: 279 RILMIGTLTSFQWLIYD 295
           +++ +    + +  + D
Sbjct: 561 QLIGVAPEKAIKLTVND 577

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 72.4 bits (176), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 126/268 (47%), Gaps = 18/268 (6%)

Query: 23  TLGGLVAC-GPTHSAVTPLDLVKCRRQV--DASLYKSNLDGWRQIVRSEGATKVFTGVGA 79
           TLG +  C G T   V P+DLVK R Q   ++  YK+++D   +I +++G   +++G+G 
Sbjct: 509 TLGSIAGCIGAT--VVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLGP 566

Query: 80  TAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
             IG + + A K    +F +  +  +    T   Y+    + + A+A     +F  P E 
Sbjct: 567 QLIGVAPEKAIKLTVNDFMRQYF--MNKSRTIKWYQE---ILSGATAGACQVVFTNPLEI 621

Query: 140 IKVRQQ--TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERI 197
           +K+R Q  +      AR    A   ++   G   LYKG      R +P++   F ++  +
Sbjct: 622 VKIRLQMRSDYVGENARPQLGAVG-IIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHL 680

Query: 198 VEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGEST- 256
            + ++   P  K + ++L    +  AGG +AG+  A ++ P DV+ +++  + + GE+T 
Sbjct: 681 KKDVFNFDPNDKNKRNKLKTWELLLAGG-IAGMPAAYLTTPFDVIKTRLQIDPRKGETTY 739

Query: 257 ---LQATSRIYGKIGFPGLWNGLAVRIL 281
              + A   I  +      + G   R+L
Sbjct: 740 TGVIHAARTILKEESIKSFFKGGPARVL 767

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 221 SFAGGYLAGILCAVVSHPADVMVSKVNNERKSGE--STLQATSRIYGKIGFPGLWNGLAV 278
           +F  G +AG + A V +P D++ +++  +R S +  +++    +I+   G  GL++GL  
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLGP 566

Query: 279 RILMIGTLTSFQWLIYD 295
           +++ +    + +  + D
Sbjct: 567 QLIGVAPEKAIKLTVND 583

>Kwal_26.8669
          Length = 296

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 114/258 (44%), Gaps = 25/258 (9%)

Query: 39  PLDLVKCRRQVDAS-----LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYG 93
           PLD+VK R Q+  S      YK  +D  +QIV  EGA++++ G+ +  +  + + A K+ 
Sbjct: 29  PLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFA 88

Query: 94  GYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFA 153
             + F+  Y +    E        + + + ASA       + P+E +K+R Q        
Sbjct: 89  CNDEFQKIYKREFGVE---KLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS--Y 143

Query: 154 RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMS 213
           +   D   K++  EG  ++Y G+    +R   +    F     I+  + A LP  K   S
Sbjct: 144 KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG----IIFQVRALLPEAK---S 196

Query: 214 QLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNE-------RKSGESTLQATSRIYGK 266
           +  Q       G + G + +++S P DV+ S++ N        RK   S   +   IY +
Sbjct: 197 KSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWS-WPSIFTIYKE 255

Query: 267 IGFPGLWNGLAVRILMIG 284
            GF  L+ G   ++L +G
Sbjct: 256 EGFRALYKGFVPKVLRLG 273

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 71/157 (45%), Gaps = 16/157 (10%)

Query: 37  VTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
           V P +LVK R Q  +S YK  +D  R+I+  EG   ++ G+ +T   + +  A    GY 
Sbjct: 126 VVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNA----GYF 181

Query: 97  FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVR-QQTAVPPPFAR- 154
               Q   L+    + S +T   L A +    I  +   P++ +K R Q TAV    AR 
Sbjct: 182 GIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK 241

Query: 155 ------NVFDAYSKMVGAEGFASLYKGITPLWFRQIP 185
                 ++F  Y +    EGF +LYKG  P   R  P
Sbjct: 242 YNWSWPSIFTIYKE----EGFRALYKGFVPKVLRLGP 274

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 222 FAGGYLAGILCAVVSHPADVMVSKVNNERKSG-----ESTLQATSRIYGKIGFPGLWNGL 276
           FA G +AGI   +V +P DV+ +++  +   G     +  +    +I  K G   L+ G+
Sbjct: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72

Query: 277 AVRILMIGTLTSFQWLIYDSFK 298
           +  +LM     + ++   D F+
Sbjct: 73  SSPVLMEAPKRATKFACNDEFQ 94

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 94/188 (50%), Gaps = 21/188 (11%)

Query: 33  THSAVTPLDLVKCRRQVDAS----LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQG 88
           T +A  P+ LVK R Q+D +     YK++ D  + +V+ EG   ++ G+ A+ +G S++G
Sbjct: 184 TSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLG-SVEG 242

Query: 89  AFKYGGYEFFKH--------QYSQLVSPETAHSYRTGIFLAASASA---EFIADIFLCPW 137
             ++  YE  KH        ++  +   E + S +   +   S SA   +F+A I   P 
Sbjct: 243 ILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPH 302

Query: 138 EAIKVRQQTAVPPPFAR----NVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193
           E ++ R + A P    +     +  +   ++  EG AS+Y G+TP   R +P ++  F +
Sbjct: 303 EVVRTRLRQA-PLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGT 361

Query: 194 FERIVEMI 201
           +E ++ ++
Sbjct: 362 WELVIRLL 369

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/289 (21%), Positives = 115/289 (39%), Gaps = 57/289 (19%)

Query: 39  PLDLVKCRRQVDA--SLYKSNL------------DGWRQ----------IVRSEGATKVF 74
           P D+VK R Q D   + YKS+              G R           + R+EG   +F
Sbjct: 72  PFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLF 131

Query: 75  TGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFL 134
            G+G   +G     +  +  Y   K  YS+ ++      +   I L A+A+A +      
Sbjct: 132 KGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVW---IHLMAAATAGWATSTAT 188

Query: 135 CPWEAIKVRQQ--TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFT 192
            P   +K R Q   A      +N +D    +V  EG   LYKG++  +   +   + ++ 
Sbjct: 189 NPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVE-GILQWV 247

Query: 193 SFERIVEMIYARLPTPKREMSQLGQISV---------------SFAGGYLAGILCAVVSH 237
            +E++  +I       +R M + G IS                S + G LA  + +++++
Sbjct: 248 LYEQMKHII------KQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAG-LAKFVASIITY 300

Query: 238 PADVMVSK-----VNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRIL 281
           P +V+ ++     + N +      +Q+   I  + G   ++ GL   +L
Sbjct: 301 PHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLL 349

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 78/194 (40%), Gaps = 35/194 (18%)

Query: 132 IFLCPWEAIKVRQQTAV-----------PPPFARNV-----------FDAYSKMVGAEGF 169
           +  CP++ +K R Q+ V             P   NV           F   S +   EGF
Sbjct: 68  VVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGF 127

Query: 170 ASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAG 229
            SL+KG+ P     IP     F ++    E IY++     +E      + +       AG
Sbjct: 128 RSLFKGLGPNLVGVIPARSINFFTYGTTKE-IYSKTLNNGQEA-----VWIHLMAAATAG 181

Query: 230 ILCAVVSHPADVMVSKVNNER----KSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGT 285
              +  ++P  ++ +++  ++    K  +++      +  K G  GL+ GL+   L  G+
Sbjct: 182 WATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYL--GS 239

Query: 286 LTS-FQWLIYDSFK 298
           +    QW++Y+  K
Sbjct: 240 VEGILQWVLYEQMK 253

>Scas_379.2
          Length = 301

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 111/286 (38%), Gaps = 28/286 (9%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN-LDGWRQIVRSEGATKVFTGVGATAI 82
           L G  A    HS + P+D +K R Q  ++   SN L    +I  +EG+  ++ GV +  +
Sbjct: 28  LAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQSVIL 87

Query: 83  GYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKV 142
           G     A  +  YE+ K         +T    +T +   +   A   AD  + P++ +K 
Sbjct: 88  GAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTAL---SGTVATIAADALMNPFDTLKQ 144

Query: 143 RQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIY 202
           R Q          V++   ++   EGF++ Y          IP+    F  +E   +   
Sbjct: 145 RMQLNT----NTTVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIYESATKFF- 199

Query: 203 ARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQ---- 258
                P  + + L    V    G L+G  CA ++ P D  +  V   R S   +LQ    
Sbjct: 200 ----NPTNDYNPL----VHCLSGGLSGATCAAITTPLDC-IKTVLQVRGSESVSLQVMKE 250

Query: 259 ------ATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
                 AT  IY   G  G W GL  R+      T+  W  Y+  K
Sbjct: 251 ANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAK 296

>Scas_721.27
          Length = 374

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 94/191 (49%), Gaps = 27/191 (14%)

Query: 33  THSAVTPLDLVKCRRQVDAS----LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQG 88
           T +A  P+ ++K R Q+D +     YK++ D  + +++SEG   ++ G+ A+ +G S++G
Sbjct: 188 TSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLG-SIEG 246

Query: 89  AFKYGGYEFFKHQYSQLVSPETAHS---------------YRTGIFLAASASAEFIADIF 133
             ++  YE  KH   Q    +  H                 R+G    ++  A+FIA I 
Sbjct: 247 ILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSG----SAGVAKFIASIV 302

Query: 134 LCPWEAIKVR-QQTAVP--PPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
             P E ++ R +Q  +    P    +  ++  ++  EG AS+Y G+TP   R +P ++  
Sbjct: 303 TYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIM 362

Query: 191 FTSFERIVEMI 201
           F ++E ++ ++
Sbjct: 363 FGTWELVIRLL 373

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 46/223 (20%), Positives = 85/223 (38%), Gaps = 31/223 (13%)

Query: 103 SQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQT----AVPPPFARNVFD 158
           ++ + PE+  + +  +   A         +  CP++ +K R Q+    +V    A  V  
Sbjct: 39  TKKIKPESHPNVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTA 98

Query: 159 AYSKMVGA----------------------EGFASLYKGITPLWFRQIPYTMCKFTSFER 196
           A++  +                        EGF SL+KG+ P     IP     F ++  
Sbjct: 99  AHNSKIANSLVQAGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGT 158

Query: 197 IVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGEST 256
             E IY++     +E   +  +S + AG   +     +      V + K    RK  +++
Sbjct: 159 TKE-IYSKAFNNGQETPLIHLMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKY-KNS 216

Query: 257 LQATSRIYGKIGFPGLWNGLAVRILMIGTLTS-FQWLIYDSFK 298
                 +    G  GL+ GL+   L  G++    QWL+Y+  K
Sbjct: 217 WDCLKTVLKSEGIYGLYRGLSASYL--GSIEGILQWLLYEQMK 257

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 56/290 (19%), Positives = 105/290 (36%), Gaps = 55/290 (18%)

Query: 39  PLDLVKCRRQVD--ASLYKSN--------------------------LDGWRQIVRSEGA 70
           P DLVK R Q D   S+YKS                                 + + EG 
Sbjct: 72  PFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGF 131

Query: 71  TKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTG-----IFLAASAS 125
             +F G+G   +G     +  +  Y   K  YS+        ++  G     I L ++A+
Sbjct: 132 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSK--------AFNNGQETPLIHLMSAAT 183

Query: 126 AEFIADIFLCPWEAIKVRQQ--TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQ 183
           A +       P   IK R Q   A      +N +D    ++ +EG   LY+G++  +   
Sbjct: 184 AGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLGS 243

Query: 184 IP-------YTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVS 236
           I        Y   K    +R +E         K    ++ +         +A  + ++V+
Sbjct: 244 IEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVT 303

Query: 237 HPADVMVSKV-----NNERKSGESTLQATSRIYGKIGFPGLWNGLAVRIL 281
           +P +V+ +++      N +      +Q+   I  + G   +++GL   ++
Sbjct: 304 YPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLM 353

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 125/281 (44%), Gaps = 36/281 (12%)

Query: 39  PLDLVKCRRQV---DASLYKSNLDGW----RQIVRSEGATKVFTGVGATAIGYSLQGAFK 91
           PLD +K R Q+    A +      G+    R I + EG   ++ G+GA  IG   + A +
Sbjct: 30  PLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIR 89

Query: 92  YGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ----TA 147
           +  YEF++   + LV+ E+        F+A   +    A + + P E +K+R Q    T 
Sbjct: 90  FSSYEFYR---TLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTP 146

Query: 148 VPP---PFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI--Y 202
             P   P   N   A   +V  EG ++LY+G++    RQ       FT + ++ E +  Y
Sbjct: 147 SEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNY 206

Query: 203 ARLPT-PKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNN------ERKSG-E 254
            ++   P  E S +G IS         G +    + P D + +++        E++SG +
Sbjct: 207 HQMDVLPSWETSCIGLIS---------GAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMK 257

Query: 255 STLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
             +   +++  + GF  L+ G+  R++ +    +  + +Y+
Sbjct: 258 KIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 79/198 (39%), Gaps = 34/198 (17%)

Query: 37  VTPLDLVKCRRQVD---------ASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQ 87
           V P+++VK R Q              Y + +     IV+ EG + ++ GV  TA   +  
Sbjct: 129 VNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATN 188

Query: 88  GAFKYGGY----EFFK--HQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIK 141
               +  Y    EF +  HQ   L S ET     + I L + A   F       P + IK
Sbjct: 189 QGANFTVYSKLKEFLQNYHQMDVLPSWET-----SCIGLISGAIGPFSN----APLDTIK 239

Query: 142 VRQQTAVPPPFAR-----NVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFER 196
            R Q        +      +    ++++  EGF +LYKGITP   R  P     FT +E 
Sbjct: 240 TRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEY 299

Query: 197 IVEM-----IYARLPTPK 209
           + E      I+ +  TPK
Sbjct: 300 VREHLENLGIFKKNDTPK 317

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 119/288 (41%), Gaps = 30/288 (10%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGW----RQIVRSEGATKVFTGVGA 79
           L G  A    HS + P+D +K R Q  A L K+   G      +I   EG+  ++ GV +
Sbjct: 28  LAGAFAGIMEHSLMFPIDALKTRVQA-AGLNKAASTGMISQISKISTMEGSMALWKGVQS 86

Query: 80  TAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
             +G     A  +G YEF K   ++L+SPE   +++      +   A   AD  + P++ 
Sbjct: 87  VILGAGPAHAVYFGTYEFCK---ARLISPEDMQTHQPMKTALSGTIATIAADALMNPFDT 143

Query: 140 IKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVE 199
           +K R Q          V++   ++   EGFA+ Y          IP+    F  +E    
Sbjct: 144 VKQRLQLDT----NLRVWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESA-- 197

Query: 200 MIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVS--------KVNNERK 251
              ++   P+   + L    +    G ++G  CA ++ P D + +         V+ E  
Sbjct: 198 ---SKFFNPQNSYNPL----IHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIM 250

Query: 252 SGESTLQATSRIYGKI-GFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
              +T    SR   ++ G+ G W GL  RI+     T+  W  Y+  K
Sbjct: 251 KDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAK 298

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 96/196 (48%), Gaps = 20/196 (10%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDAS---LYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           L    A   T +   P+ LVK R Q+D +    YK++LD  + +V++EG   ++ G+ A+
Sbjct: 174 LAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSAS 233

Query: 81  AIGYSLQGAFKYGGYEFFK--------HQYSQLVSPETAHSYRTGIFLAASASA---EFI 129
            +G S++G  ++  YE  K         ++  +     + S +   +   S SA   +F+
Sbjct: 234 YLG-SVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFV 292

Query: 130 ADIFLCPWEAIKVRQQTAVPPPFAR----NVFDAYSKMVGAEGFASLYKGITPLWFRQIP 185
           A I   P E ++ R + A P    +     +  ++  ++  EG  S+Y G+TP   R +P
Sbjct: 293 ASIVTYPHEVVRTRLRQA-PTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVP 351

Query: 186 YTMCKFTSFERIVEMI 201
            ++  F ++E +++++
Sbjct: 352 NSIIMFGTWELVIKLL 367

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 97/235 (41%), Gaps = 22/235 (9%)

Query: 63  QIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAA 122
            + R EG   +F G+G   +G     +  +  Y   K  YS+ ++      +   I L A
Sbjct: 119 NVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPW---IHLLA 175

Query: 123 SASAEFIADIFLCPWEAIKVR-QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLW- 180
           +A+A +       P   +K R Q         +N  D    +V  EG   LYKG++  + 
Sbjct: 176 AATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYL 235

Query: 181 ------FRQIPYTMCKFTSFERIVE---MIYARLPTPKREMSQLGQISVSFAGGYLAGIL 231
                  + I Y   K    ER +E    I+    +   ++ +  Q S S AG  LA  +
Sbjct: 236 GSVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGS-AG--LAKFV 292

Query: 232 CAVVSHPADVMVSKV-----NNERKSGESTLQATSRIYGKIGFPGLWNGLAVRIL 281
            ++V++P +V+ +++      N +      +Q+   I  + G   +++GL   +L
Sbjct: 293 ASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLL 347

 Score = 34.7 bits (78), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 65/136 (47%), Gaps = 12/136 (8%)

Query: 167 EGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGY 226
           EGF SL+KG+ P     IP     F ++    + IY+R     +E   +  ++ +     
Sbjct: 124 EGFRSLFKGLGPNLVGVIPARSINFLTYGTTKD-IYSRTLNNGQEAPWIHLLAAA----- 177

Query: 227 LAGILCAVVSHPADVMVSKVNNER---KSGESTLQATSRIYGKIGFPGLWNGLAVRILMI 283
            AG   + V++P  ++ +++  ++   K+ +++L     +    G  GL+ GL+   L  
Sbjct: 178 TAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYL-- 235

Query: 284 GTLTS-FQWLIYDSFK 298
           G++    QW++Y+  K
Sbjct: 236 GSVEGILQWILYEQMK 251

>Kwal_27.12081
          Length = 369

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 94/190 (49%), Gaps = 25/190 (13%)

Query: 33  THSAVTPLDLVKCRRQVDAS----LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQG 88
           T +A  P+ L+K R Q+D +     YK++ D  + I++ EG   ++ G+ A+ +G S++G
Sbjct: 181 TSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLG-SVEG 239

Query: 89  AFKYGGYEFFKH--------QYSQLVSPETAHSYRTGIFLAASASA---EFIADIFLCPW 137
             ++  YE  K         ++  +   E   S +   +   S SA   +F+A I   P 
Sbjct: 240 ILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPH 299

Query: 138 EAIKVRQQTAVPPPFARN------VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKF 191
           E ++ R + A   P   +      +  ++  ++  EG AS+Y G+TP   R +P ++  F
Sbjct: 300 EVVRTRLRQA---PLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMF 356

Query: 192 TSFERIVEMI 201
            ++E +++++
Sbjct: 357 GTWELVIKLL 366

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 76/187 (40%), Gaps = 24/187 (12%)

Query: 132 IFLCPWEAIKVRQQTAV-PPPFA------------------RNVFDAYSKMVGAEGFASL 172
           I  CP++ +K R Q+ V    +A                  R  F   S +   EGF SL
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 173 YKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILC 232
           +KG+ P     IP     F ++    + IY+R      E   +  IS + AG   +    
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYG-TTKQIYSRAFNNGEEAPWIHLISAATAGWATSTATN 186

Query: 233 AVVSHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTS-FQW 291
            +      + + K  + R+  +++      I  K GF GL+ GL+   L  G++    QW
Sbjct: 187 PIWLIKTRLQLDKAGHTRQY-KNSWDCLKHIIQKEGFFGLYKGLSASYL--GSVEGILQW 243

Query: 292 LIYDSFK 298
           L+Y+  K
Sbjct: 244 LLYEQMK 250

>Kwal_23.4731
          Length = 314

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 132/302 (43%), Gaps = 35/302 (11%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVR-----SEGATKVFT--- 75
           + GL A   T  A  PLDLVK R Q+  +   S+  G++++++     S+  + VF    
Sbjct: 18  IAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSH--GYKEVIKTIIRDSKADSNVFREAY 75

Query: 76  -GVGATAIGYSLQGAFKYGGYEF-----FKHQYSQLVSPETAHSYRT------GIFLAAS 123
            G+G   IG S+     +G Y F     +++  +Q+ +P T  S++        ++LA++
Sbjct: 76  RGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTP-TQSSFQKDKAMGPSLYLASA 134

Query: 124 ASAEFIADIFLCPWEAIKVRQQTAVPPPFAR--NVFDAYSKMVGAEGFASLYKGITPLWF 181
           A +     I   P   IK R  +       R    +D   K+   EGF+  ++G+ P  F
Sbjct: 135 ALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPSLF 194

Query: 182 RQIPYTMCKFTSFERIVEMIYARLP-TPKREMSQLGQISVSFAGGYLAGILCAVVSHPAD 240
             +      FT ++ +    +AR   T   +M  L  I+++     ++ +L     +P  
Sbjct: 195 -GVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAIT----SVSKMLSVTAVYPFQ 249

Query: 241 VMVSKVNN----ERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDS 296
           ++ S + +    E++           I+ K G  GL+ GL+  +L     T   + IY++
Sbjct: 250 LLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYEN 309

Query: 297 FK 298
            +
Sbjct: 310 LR 311

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 83/189 (43%), Gaps = 17/189 (8%)

Query: 18  YYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDAS----LYKSNLDGWRQIVRSEGATKV 73
           Y A+  L GL     T     P+ ++K R    +S     YK+  DG R++   EG +  
Sbjct: 130 YLASAALSGL----GTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGF 185

Query: 74  FTGVGATAIGYSLQGAFKYGGYEFFKHQY---SQLVSPETAHSYRTGIFLAASASAEFIA 130
           + G+  +  G + QGA  +  Y+  +HQY     +   E   +      +A ++ ++ ++
Sbjct: 186 WRGLVPSLFGVA-QGAIYFTIYDSLRHQYFARRGITEDEKMGNLEN---IAITSVSKMLS 241

Query: 131 DIFLCPWEAIKVRQQT--AVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTM 188
              + P++ +K   Q+  AV    +   ++    +   EG   LYKG++    R IP T 
Sbjct: 242 VTAVYPFQLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTC 301

Query: 189 CKFTSFERI 197
             F  +E +
Sbjct: 302 ITFCIYENL 310

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 65.9 bits (159), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 108/248 (43%), Gaps = 22/248 (8%)

Query: 22  CTLGGLVACGPTHSAVTPLDLVKCRRQ--VDASLYKSNLDGWRQIVRSEGATK-VFTGVG 78
           C + G +      SA+  LD VK R+Q   +   Y++ +  +R I   EG  + ++ G  
Sbjct: 56  CVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYM 115

Query: 79  ATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWE 138
           A  +G     A  +G YE     Y++    E      T   L+A    +FI+     P E
Sbjct: 116 AAMLGSFPSAAIFFGTYE-----YTKRTMIEDWQINDTITHLSAGFLGDFISSFVYVPSE 170

Query: 139 AIKVRQQTA--VPPPFAR------NVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
            +K R Q       PF +      N+ +A   ++  EGF SL+ G      R +P++  +
Sbjct: 171 VLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQ 230

Query: 191 FTSFERIVEMIYARLPTPKREMSQLGQISV--SFAGGYLAGILCAVVSHPADVMVSKVNN 248
           F  +E+  ++ +       R+    G++S+      G  AG L  +++ P DV+ ++V  
Sbjct: 231 FAFYEKFRQLAFKIEQKDGRD----GELSIPNEILTGACAGGLAGIITTPMDVVKTRVQT 286

Query: 249 ERKSGEST 256
           ++   +S 
Sbjct: 287 QQPPSQSN 294

>Scas_691.4
          Length = 334

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 116/290 (40%), Gaps = 46/290 (15%)

Query: 39  PLDLVKCRRQVDASLYKSNLDGW----RQIVRSEGATKVFTGVGATAIGYSLQGAFKYGG 94
           PLD +K R Q+          G+    R I   EG   ++ G+GA  IG   + A ++  
Sbjct: 33  PLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSS 92

Query: 95  YEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ--------- 145
           YEF+++    L   ET        FLA   +    A + + P E +K+R Q         
Sbjct: 93  YEFYRN---ALTDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIP 149

Query: 146 ------------TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193
                       T   P +A  +  AY+ +V  EG  +LY+G++    RQ       FT 
Sbjct: 150 QPAGVSAAGTAATVTKPKYANAIHAAYT-IVKEEGAGALYRGVSLTAARQATNQGANFTV 208

Query: 194 FERIVEMI---YARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER 250
           +  + + +   + R   P  E S +G IS         G +    + P D + +++  ++
Sbjct: 209 YSYLKDYLQKYHNRESLPSWETSCIGLIS---------GAIGPFSNAPLDTIKTRLQKDK 259

Query: 251 KSGESTLQATSRIYG-----KIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
               ++      I G     + GF  L+ G+  R++ +    +  + +Y+
Sbjct: 260 SISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 309

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 111/258 (43%), Gaps = 25/258 (9%)

Query: 39  PLDLVKCRRQVDAS-----LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYG 93
           PLD+VK   Q+  S      YK   D  +QI   EG ++++ G+ +  +  + + A K+ 
Sbjct: 29  PLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFA 88

Query: 94  GYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFA 153
             + F+  Y  L     A      + + + ASA       + P+E +K+R Q  V   F 
Sbjct: 89  CNDEFQKIYKDLFG---AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQD-VSSKFT 144

Query: 154 RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMS 213
             +      +V  EG  ++Y G+    +R   +    F     I+  + A LP   +  +
Sbjct: 145 SPI-AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG----IIFQVRALLP---KAST 196

Query: 214 QLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNE-------RKSGESTLQATSRIYGK 266
           +  Q       G + G L +++S P DV+ S+V N        RK   S   A + IY +
Sbjct: 197 KSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWS-WPALATIYKE 255

Query: 267 IGFPGLWNGLAVRILMIG 284
            GF  L+ G   ++L +G
Sbjct: 256 EGFKALYKGFVPKVLRLG 273

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 68/153 (44%), Gaps = 8/153 (5%)

Query: 37  VTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
           V P +LVK R Q  +S + S +   + IV  EG   ++ G+ +T   + +  A    GY 
Sbjct: 126 VVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNA----GYF 181

Query: 97  FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVR-QQTAVPPPFARN 155
               Q   L+   +  S +T   L A      ++ +   P++ +K R Q TAV P   R 
Sbjct: 182 GIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRK 241

Query: 156 V---FDAYSKMVGAEGFASLYKGITPLWFRQIP 185
               + A + +   EGF +LYKG  P   R  P
Sbjct: 242 YNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 67/161 (41%), Gaps = 15/161 (9%)

Query: 122 ASASAEFIADIFLCPWEAIKVRQQTAVPP---PFARNVFDAYSKMVGAEGFASLYKGITP 178
           A A A     + + P + +K   Q  V     P  + VFD   ++   EG + LYKGI+ 
Sbjct: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74

Query: 179 LWFRQIPYTMCKFT---SFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVV 235
               + P    KF     F++I + ++        +++Q     +S   G  AGI  + V
Sbjct: 75  PILMEAPKRATKFACNDEFQKIYKDLFG-----AEKLTQ----PLSILSGASAGICESFV 125

Query: 236 SHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGL 276
             P +++  ++ +      S +     I  K G   ++NGL
Sbjct: 126 VVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGL 166

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 58/276 (21%), Positives = 117/276 (42%), Gaps = 21/276 (7%)

Query: 15  SPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQI---VRSEGAT 71
           S  + A C  G + A     S   P +  K R Q+     K++ +    I    +++G  
Sbjct: 10  SKSFIAGCLAGAVEA-----SVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIG 64

Query: 72  KVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIAD 131
            V+ G  A  +G + +   ++ G++  K+    L  P+T         +A   +    + 
Sbjct: 65  SVYVGCPAFIVGNTAKAGVRFLGFDTIKNL---LRDPKTGELSGPRGVIAGLGAGLLESV 121

Query: 132 IFLCPWEAIK---VRQQTAVPPPFARN---VFDAYSKMVGAEGFASLYKGITPLWFRQIP 185
           + + P+EAIK   +  + +  P +  N   +   Y+ +V  +G + LY+G+ P+  RQ  
Sbjct: 122 VAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAA 181

Query: 186 YTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSK 245
               +   + +I  M+      PK +    G   ++F  G  +GI+    + P D + ++
Sbjct: 182 NQAVRLGCYNKIKVMVQDYTNAPKDKPLSSG---LTFVVGAFSGIVTVYTTMPIDTVKTR 238

Query: 246 VNN-ERKSGESTLQATSRIYGKIGFPGLWNGLAVRI 280
           + + + K   ST+   + I+ + G    W G   R+
Sbjct: 239 MQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRL 274

>Kwal_33.14050
          Length = 314

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 122/285 (42%), Gaps = 35/285 (12%)

Query: 34  HSAVTPLDLVKCRRQ-VDASLYKSNL------DGWRQIVR---SEGATKVFTGVGATAIG 83
           HS + P+D +K R Q + A++  +N       +  +QI R   +EG+  ++ GV +  +G
Sbjct: 31  HSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMALWKGVQSVILG 90

Query: 84  YSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVR 143
                A  +  YE  K   S L+ P+   +++     A+  +A   AD+ + P++ IK R
Sbjct: 91  AGPAHAVYFATYEMCK---SYLIDPQDFQTHQPLKTAASGIAATVAADLLMNPFDTIKQR 147

Query: 144 QQTAVPPPFARN-VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIY 202
            Q      F+++ ++   S++   EG A+ +          IP+    F  +E   +   
Sbjct: 148 MQLRT---FSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFF- 203

Query: 203 ARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMV---------SKVNNERKSG 253
                P+   + L    +    G ++G  CA ++ P D +          S V+   +  
Sbjct: 204 ----NPENTYNPL----IHCLCGGISGATCAAITTPLDCIKTVLQVRGSESVVDPLFRQA 255

Query: 254 ESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
           ++  +A S I    G+ G W GL  RI+     T+  W  Y+  K
Sbjct: 256 DTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYECAK 300

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 70/185 (37%), Gaps = 14/185 (7%)

Query: 120 LAASASAEFIADIFLCPWEAIKVRQQ--------TAVPPPFARNVFDAYSKMVGAEGFAS 171
           LAA A A  +    + P +AIK R Q                 N+    +++   EG  +
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMA 79

Query: 172 LYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGIL 231
           L+KG+  +     P     F ++    EM  + L  P+    Q  Q   + A G  A + 
Sbjct: 80  LWKGVQSVILGAGPAHAVYFATY----EMCKSYLIDPQD--FQTHQPLKTAASGIAATVA 133

Query: 232 CAVVSHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQW 291
             ++ +P D +  ++     S +      SRIY   G    +      I M     +F +
Sbjct: 134 ADLLMNPFDTIKQRMQLRTFSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNF 193

Query: 292 LIYDS 296
            IY+S
Sbjct: 194 AIYES 198

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 122/290 (42%), Gaps = 23/290 (7%)

Query: 1   MSQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG 60
           MS K++  +   L+S  + A    G   AC        P +  K R Q+     K++ + 
Sbjct: 1   MSSKATKSDVDPLHS--FLAGSLAGAAEAC-----ITYPFEFAKTRLQLIDKASKASRNP 53

Query: 61  WRQI---VRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTG 117
              I    +++G   ++ G  A  IG + +   ++ G++  K     L   ET     T 
Sbjct: 54  LVLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDM---LRDSETGELSGTR 110

Query: 118 IFLAASASAEFIADIFLCPWEAIKV----RQQTAVPP--PFARNVFDAYSKMVGAEGFAS 171
             +A   +    +   + P+EAIK      +Q+A P      R V   YS +V  +GF+ 
Sbjct: 111 GVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSG 170

Query: 172 LYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGIL 231
           LY+G+ P+  RQ      +   + +I  +I     +PK +    G   ++F  G  +GI+
Sbjct: 171 LYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSG---LTFLVGAFSGIV 227

Query: 232 CAVVSHPADVMVSKVNN-ERKSGESTLQATSRIYGKIGFPGLWNGLAVRI 280
               + P D + +++ + +     ST+   + I+ + G    W G   R+
Sbjct: 228 TVYSTMPLDTVKTRMQSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRL 277

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 72/175 (41%), Gaps = 9/175 (5%)

Query: 35  SAVTPLDLVKC----RRQVDASLYKSNLDG----WRQIVRSEGATKVFTGVGATAIGYSL 86
           +AVTP + +K      +Q     Y +N  G    +  +VR +G + ++ GV   ++  + 
Sbjct: 125 AAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAA 184

Query: 87  QGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQT 146
             A + G Y   K                +G+     A +  +      P + +K R Q+
Sbjct: 185 NQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQS 244

Query: 147 AVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201
                ++ +  + ++ +   EG  + +KG TP   R +      FT +E+++ M+
Sbjct: 245 LDSTKYS-STMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVLVML 298

>Scas_582.7
          Length = 329

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 114/290 (39%), Gaps = 30/290 (10%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDAS-----LYKSNLDGWRQIVRSEGATKVFTGVG 78
           L G  A    HS + P+D +K R Q   +        S +    +I   EG+  ++ GV 
Sbjct: 41  LAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGVQ 100

Query: 79  ATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAAS-ASAEFIADIFLCPW 137
           +  +G     A  +  YEF K   + L+ P++       I +A S A+A   +D F+ P+
Sbjct: 101 SVILGAGPAHAVYFATYEFTK---AHLI-PDSQRETHQPIKVAVSGATATVASDFFMNPF 156

Query: 138 EAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERI 197
           + IK R Q  +       V++   K+   EG ++ Y          IP+    F      
Sbjct: 157 DTIKQRMQ--ISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNF------ 208

Query: 198 VEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVN---------N 248
             MIY         +     +     GG ++G + A V+ P D + + +           
Sbjct: 209 --MIYESASKFFNPLHHYNPLIHCLCGG-ISGAIAAAVTTPLDCIKTVIQIRGSSVVSLE 265

Query: 249 ERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
             K   +  +ATS I    G+ G W GL  RIL     T+  W  Y+  K
Sbjct: 266 VMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYECAK 315

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 120/278 (43%), Gaps = 36/278 (12%)

Query: 39  PLDLVKCRRQVDASLYKSNLDG------WRQIVRSEGATKVFTGVGATAIGYSLQGAFKY 92
           PLD +K R Q+  +   S +          +I R+EG    + G+GA  IG + + A ++
Sbjct: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89

Query: 93  GGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPF 152
             YEF++   + L   ET        F+A   +    A + + P E +K+R Q     P 
Sbjct: 90  SSYEFYR---TLLADKETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPV 146

Query: 153 A-----RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI---YAR 204
                 +N   A   +V  EGF++LY+G++    RQ       FT + ++ E +   + +
Sbjct: 147 EGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQ 206

Query: 205 LPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSRIY 264
              P  E S +G IS         G +    + P D + +++  ++ +   +      I 
Sbjct: 207 EMLPSWETSLIGLIS---------GAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITII 257

Query: 265 GKI-----GFPGLWNGLAVRILMIG-----TLTSFQWL 292
           GK      GF  L+ G+  R++ +      T T+++++
Sbjct: 258 GKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 13/91 (14%)

Query: 23  TLGGLV--ACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWR-------QIVRSEGATKV 73
           +L GL+  A GP  +A  PLD +K R Q D S    N+ G +       Q+++ EG   +
Sbjct: 215 SLIGLISGAIGPFSNA--PLDTIKTRLQKDKST--KNMSGLKRITIIGKQLIQEEGFRAL 270

Query: 74  FTGVGATAIGYSLQGAFKYGGYEFFKHQYSQ 104
           + G+    +  +   A  +  YEF + +  +
Sbjct: 271 YKGITPRVMRVAPGQAVTFTAYEFIRKELEK 301

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 133/316 (42%), Gaps = 35/316 (11%)

Query: 4   KSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASL--YKSNLDGW 61
           K++  ++   YSP     C L G +      SA+  LD VK R+Q   S   YK+ +  +
Sbjct: 42  KTNADSTENAYSP--IVHCMLAGGIGGAIGDSAMHSLDTVKTRQQGAPSTVKYKNMIGAY 99

Query: 62  RQIVRSEGATK-VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFL 120
           R I+  EG  K ++ G     +G     A  +  YE+ K +           S+ T  FL
Sbjct: 100 RTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATYEYTKRKMIGEWGINETFSHLTAGFL 159

Query: 121 AASASAEFIADIFLCPWEAIKVRQQTA--VPPPFAR------NVFDAYSKMVGAEGFASL 172
                 +FI+     P E +K R Q       PF R      N+ DA + +V  EG+ +L
Sbjct: 160 G-----DFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTL 214

Query: 173 YKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILC 232
           + G      R +P++  +F  +E+  ++ +A      +   +   +S     G  AG L 
Sbjct: 215 FFGYKATLSRDLPFSGLQFAFYEKFRQLAFA---VENKTFDEDLSLSNEIITGAAAGGLA 271

Query: 233 AVVSHPADVMVSKV---------NNERKSGESTL-----QATSRIYGKIGFPGLWNGLAV 278
            +++ P DV+ +++         N+ +   + TL     +    +Y   G  GL++G+  
Sbjct: 272 GIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGP 331

Query: 279 RILMIGTLTSFQWLIY 294
           R +     +S   L+Y
Sbjct: 332 RFIWTSIQSSIMLLLY 347

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 118/279 (42%), Gaps = 38/279 (13%)

Query: 39  PLDLVKCRRQVDASLYKSNLDGWR---------QIVRSEGATKVFTGVGATAIGYSLQGA 89
           PLD +K R Q+    Y+   +G +          I   EG    + G+GA  IG   + A
Sbjct: 77  PLDTIKVRMQI----YRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132

Query: 90  FKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQT--- 146
            ++  YEF++   + L   +T        FLA   +    A + + P E +K+R Q    
Sbjct: 133 IRFSSYEFYR---TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHL 189

Query: 147 --AVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI--- 201
             A      RN   A   +V  EG  +LY+G++    RQ       FT + +++E +   
Sbjct: 190 HGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEY 249

Query: 202 YARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGEST--LQA 259
           +     P  E S +G +S         G +    + P D + +++  ++ +   +  ++ 
Sbjct: 250 HGSQNLPSWETSLIGLVS---------GAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRI 300

Query: 260 TS---RIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
           T+   ++  + GF  L+ G+  R++ +    +  + +Y+
Sbjct: 301 TTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 66/169 (39%), Gaps = 13/169 (7%)

Query: 37  VTPLDLVKCRRQV-------DASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGA 89
           V P+++VK R Q        +   Y++ +     IV+ EG   ++ GV  TA   +    
Sbjct: 174 VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQG 233

Query: 90  FKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVP 149
             +  Y     +  +    +   S+ T +    S +   I      P + IK R Q    
Sbjct: 234 ANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGA---IGPFSNAPLDTIKTRLQKDKS 290

Query: 150 PPFARN---VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195
                N   +     ++V  EGF +LYKGITP   R  P     FT +E
Sbjct: 291 TRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 42/92 (45%), Gaps = 13/92 (14%)

Query: 23  TLGGLV--ACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGW-------RQIVRSEGATKV 73
           +L GLV  A GP  +A  PLD +K R Q D S    NL  W       RQ+V+ EG   +
Sbjct: 261 SLIGLVSGAIGPFSNA--PLDTIKTRLQKDKS--TRNLSNWVRITTIGRQLVQEEGFRAL 316

Query: 74  FTGVGATAIGYSLQGAFKYGGYEFFKHQYSQL 105
           + G+    +  +   A  +  YEF +     L
Sbjct: 317 YKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348

 Score = 31.2 bits (69), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 7/100 (7%)

Query: 206 PTPKREMSQLGQIS--VSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGEST-----LQ 258
           P P   MS     +  V+   G  AG+  A+  HP D +  ++   R++ E T     L+
Sbjct: 43  PYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLR 102

Query: 259 ATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
             + IY   G    + GL   ++ I    + ++  Y+ ++
Sbjct: 103 TGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR 142

>Scas_640.25
          Length = 306

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 113/263 (42%), Gaps = 30/263 (11%)

Query: 39  PLDLVKCRRQVD---------ASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGA 89
           PLD+VK R Q+          A+ YK  +D   QIV+ EG   ++ G+ +  +  + + A
Sbjct: 33  PLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRA 92

Query: 90  FKYGGY-EFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAV 148
            K+    EF K   S   + +        I + + ASA     + + P+E +K+R Q  V
Sbjct: 93  VKFASNDEFIKLWKSVFGTKQLTQQ----ISVLSGASAGITEALVIVPFELVKIRLQD-V 147

Query: 149 PPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTP 208
              F   V +    ++  +G   LY G+    +R   +    F    ++ E+    LP  
Sbjct: 148 NSKFKGPV-EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVREL----LPVA 202

Query: 209 KREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVN---NERKSG----ESTLQATS 261
           K   S+  +       G++ G    + + P DV+ S++    NE  +G      T  +  
Sbjct: 203 K---SKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVM 259

Query: 262 RIYGKIGFPGLWNGLAVRILMIG 284
           +IY + GF  L+ G   ++L +G
Sbjct: 260 KIYHEEGFRALYKGFVPKVLRLG 282

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 71/152 (46%), Gaps = 13/152 (8%)

Query: 132 IFLCPWEAIKVRQQTAVPPPFA-------RNVFDAYSKMVGAEGFASLYKGITPLWFRQI 184
           + + P + +K R Q  V    A       + V D  S++V  EG   +YKGI+     + 
Sbjct: 29  MVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEA 88

Query: 185 PYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVS 244
           P    KF S +  +++  +   T  ++++Q  QISV    G  AGI  A+V  P +++  
Sbjct: 89  PKRAVKFASNDEFIKLWKSVFGT--KQLTQ--QISV--LSGASAGITEALVIVPFELVKI 142

Query: 245 KVNNERKSGESTLQATSRIYGKIGFPGLWNGL 276
           ++ +     +  ++    I  + G  GL++G+
Sbjct: 143 RLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGV 174

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 65/156 (41%), Gaps = 13/156 (8%)

Query: 37  VTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
           + P +LVK R Q   S +K  ++  + I++ +G   +++GV +T      + A    GY 
Sbjct: 134 IVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV----WRNAVWNAGYF 189

Query: 97  FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNV 156
               Q  +L+    +   +T   L A         +F  P++ +K R Q+        N 
Sbjct: 190 GVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEII--NG 247

Query: 157 FDAYS-------KMVGAEGFASLYKGITPLWFRQIP 185
              Y+       K+   EGF +LYKG  P   R  P
Sbjct: 248 VRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 117/278 (42%), Gaps = 36/278 (12%)

Query: 37  VTPLDLVKCRRQVDAS-----LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFK 91
           V PLD+ K R Q   +      Y+  +     I+R EG   ++ G+    +GY       
Sbjct: 102 VCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPIVLGYFPTWMLY 161

Query: 92  YGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEF---IADIFLCPWEAIKVR----Q 144
           +  YE  K +Y          SY  G F++ +ASA     I+     P   +K R     
Sbjct: 162 FSVYEKCKQRYP---------SYLPGGFVSHAASALTAGAISTALTNPIWVVKTRLMIQS 212

Query: 145 QTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYAR 204
             +      R+  DA+ KM  +EG    Y G+ P  F  + +    F  +E++   I+  
Sbjct: 213 DVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF-GLFHVAIHFPVYEKL--KIWLH 269

Query: 205 LPTPKREMSQLG----QISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSG--ESTLQ 258
             TP  +  +L     Q+        L+ ++ +V+++P +++ +++   R SG   S L 
Sbjct: 270 RNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRM-QVRHSGVPPSLLN 328

Query: 259 ATSRIYGKIGFPGLWNGLAVRILM-----IGTLTSFQW 291
              RI    G+ G ++G A  ++      + TL SF++
Sbjct: 329 LLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFEY 366

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 85/196 (43%), Gaps = 19/196 (9%)

Query: 14  YSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQV------DASLYKSNLDGWRQIVRS 67
           Y P  + +     L A   + +   P+ +VK R  +      D++ Y+S LD +R++ RS
Sbjct: 175 YLPGGFVSHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRS 234

Query: 68  EGATKVFTGVGATAIGYSLQGAFKYGGYEFFK---HQYSQLVSPETAHSYRTGI--FLAA 122
           EG    ++G+  +  G     A  +  YE  K   H+ +     +     +  +   + A
Sbjct: 235 EGLKVFYSGLVPSLFGL-FHVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVA 293

Query: 123 SASAEFIADIFLCPWEAIKVRQQ---TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPL 179
           S  ++ +A +   P E ++ R Q   + VPP    ++ +   ++  +EG+   Y G    
Sbjct: 294 SCLSKVVASVITYPHEILRTRMQVRHSGVPP----SLLNLLGRIRASEGYVGFYSGFATN 349

Query: 180 WFRQIPYTMCKFTSFE 195
             R +P ++    SFE
Sbjct: 350 LVRTVPASVITLVSFE 365

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 72/170 (42%), Gaps = 18/170 (10%)

Query: 116 TGIFLAASASAEFIADIFLCPWEAIKVRQQT---AVPPPFARNVFDAYSKMVGAEGFASL 172
           T +   + A A F++ I +CP +  K R Q         + R +    S ++  EG A L
Sbjct: 84  TQVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGL 143

Query: 173 YKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILC 232
           YKG+ P+     P  M  F+ +E+  +   + LP         G      A    AG + 
Sbjct: 144 YKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLP---------GGFVSHAASALTAGAIS 194

Query: 233 AVVSHP-----ADVMV-SKVNNERKSGESTLQATSRIYGKIGFPGLWNGL 276
             +++P       +M+ S V+ +  +  STL A  ++Y   G    ++GL
Sbjct: 195 TALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGL 244

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 91/182 (50%), Gaps = 19/182 (10%)

Query: 38  TPLDLVKCRRQVDAS----LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYG 93
            P+ +VK R Q+D +     YK++ D  + I+R+EG   ++ G+ A+ +G S++G  ++ 
Sbjct: 198 NPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLG-SVEGILQWL 256

Query: 94  GYEFFKHQYSQL-VSPETAHSYRTGIFL----------AASASAEFIADIFLCPWEAIKV 142
            YE  KH   +  +    AH   T                +  A+F+A I   P E ++ 
Sbjct: 257 LYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRT 316

Query: 143 R-QQTAVPPPFAR--NVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVE 199
           R +Q+ +     +   +  ++  ++  EG AS+Y G+TP   R +P ++  F ++E +++
Sbjct: 317 RLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVIK 376

Query: 200 MI 201
           ++
Sbjct: 377 LL 378

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 57/286 (19%), Positives = 106/286 (37%), Gaps = 46/286 (16%)

Query: 39  PLDLVKCRRQVD--ASLYKSNLDGWR---------------------------QIVRSEG 69
           P DLVK R Q D   ++YKS  +                               + R EG
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEG 135

Query: 70  ATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFI 129
              +F G+G   +G     +  +  Y   K  YS+  +      +   I L A+A+A + 
Sbjct: 136 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPW---IHLMAAATAGWA 192

Query: 130 ADIFLCPWEAIKVRQQ--TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIP-- 185
                 P   +K R Q   A      +N +D    ++  EG   LY+G++  +   +   
Sbjct: 193 TATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGI 252

Query: 186 -----YTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPAD 240
                Y   K    +R +E   A   +      ++ Q      G  LA  + ++V++P +
Sbjct: 253 LQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHE 312

Query: 241 VMVSK-----VNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRIL 281
           V+ ++     + N +      +Q+   I  + G   +++GL   ++
Sbjct: 313 VVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLM 358

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 108/251 (43%), Gaps = 29/251 (11%)

Query: 62  RQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLA 121
           R I   EG   ++ G+GA  IG   + A ++  YEF++   + L   +T     +  F+A
Sbjct: 87  RNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYR---TLLADKQTGVVSTSNTFIA 143

Query: 122 ASASAEFIADIFLCPWEAIKVRQQTA-------VPPPFARNVFDAYSKMVGAEGFASLYK 174
              +    A + + P E +K+R Q         +  P   N   A   ++  EG ++LY+
Sbjct: 144 GVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYR 203

Query: 175 GITPLWFRQIPYTMCKFTSFERIVEMI---YARLPTPKREMSQLGQISVSFAGGYLAGIL 231
           G++    RQ       FT + ++ E +   +     P  E S +G IS         G +
Sbjct: 204 GVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLIS---------GAI 254

Query: 232 CAVVSHPADVMVSKVNNERKS---GESTLQATSRIYGKI----GFPGLWNGLAVRILMIG 284
               + P D + +++  ++ +   GES  +  + I  ++    GF  L+ G+  R++ + 
Sbjct: 255 GPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVA 314

Query: 285 TLTSFQWLIYD 295
              +  + +Y+
Sbjct: 315 PGQAVTFTVYE 325

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 80/193 (41%), Gaps = 25/193 (12%)

Query: 37  VTPLDLVKCRRQVD---------ASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQ 87
           V P+++VK R Q              Y + +     I++ EG + ++ GV  TA   +  
Sbjct: 156 VNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATN 215

Query: 88  GAFKYGGYEFFKHQYSQLVSPETAHSYRTG-IFLAASASAEFIADIFLCPWEAIKVRQQT 146
               +  Y   +    +    ET  S+ T  I L + A   F       P + IK R Q 
Sbjct: 216 QGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSN----APLDTIKTRLQK 271

Query: 147 AVPPPFA-----RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE---RIV 198
                F      + +    ++++  EGF +LYKGITP   R  P     FT +E   R +
Sbjct: 272 DKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 331

Query: 199 EM--IYARLPTPK 209
           E   ++++ PTPK
Sbjct: 332 ENLGVFSK-PTPK 343

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 134/323 (41%), Gaps = 39/323 (12%)

Query: 1   MSQKSSILNSPT-LYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQ--VDASLYKSN 57
           M  +SS    P+  +SP  +  C L G +      S +  LD VK R+Q       Y+  
Sbjct: 36  MPDRSSPEGEPSSAHSPLLH--CVLAGGIGGAIGDSVMHSLDTVKTRQQGAPGEVKYRHM 93

Query: 58  LDGWRQIVRSEGATK-VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRT 116
           +  +R +   EG  + ++ G GA  +G     A  +G YE+ K Q   +++    H   T
Sbjct: 94  ISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFFGTYEWVKRQ---MINEWQIHE--T 148

Query: 117 GIFLAASASAEFIADIFLCPWEAIKVRQQTA---VPPPFA-----RNVFDAYSKMVGAEG 168
              LAA    +  + +   P E +K R Q         F      R + DA   +V  EG
Sbjct: 149 YSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEG 208

Query: 169 FASLYKGITPLWFRQIPYTMCKFTSFERIVE--MIYARLPTPKREMSQLGQISVSFAGGY 226
            ++L+ G      R +P++  +F  +ER  +   +  R P     +S   ++    + G 
Sbjct: 209 VSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPVDG-HLSFTAEVVTGASAGG 267

Query: 227 LAGILCAVVSHPADVMVSKVNNERKSGESTLQAT--SRIYGKI-----------GFPGLW 273
           LAGI+      P DV+ +++  + +    T  A+  +R+ G I           G  G +
Sbjct: 268 LAGIITT----PLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAF 323

Query: 274 NGLAVRILMIGTLTSFQWLIYDS 296
           +G+  R +     +S   L+Y +
Sbjct: 324 SGVGPRFIWTSIQSSIMLLLYQT 346

>Kwal_23.3529
          Length = 395

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 130/301 (43%), Gaps = 37/301 (12%)

Query: 20  AACTLGGLVACGPTHSAVTPLDLVKCRRQ--VDASLYKSNLDGWRQIVRSEGATK-VFTG 76
           A C + G +      S +  LD VK R+Q   +A  Y++ +  +++I   EG  + ++ G
Sbjct: 86  AHCIVAGGIGGAIGDSVMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGG 145

Query: 77  VGATAIGYSLQGAFKYGGYEFFKHQYSQL--VSPETAHSYRTGIFLAASASAEFIADIFL 134
             A  +G     A  +G YE  K +      V+   +H       L A  S + ++ +  
Sbjct: 146 YTAAMLGSFPSAAIFFGTYELTKRKLIDDWGVNETLSH-------LTAGLSGDLVSSVVY 198

Query: 135 CPWEAIKVRQQTA---VPPPFA-----RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPY 186
            P E +K R Q       P F      RN+ DA + +V  EG+ +L+ G      R +P+
Sbjct: 199 VPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPF 258

Query: 187 TMCKFTSFERIVEMIYA-RLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSK 245
           +  +F  +E+  +  +     TP +++S L ++    A    AG L  +++ P DV+ ++
Sbjct: 259 SAFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAA----AGGLAGIITTPMDVIKTR 314

Query: 246 VNNERKSG------------ESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLI 293
           +  +  S              S ++  + +Y   G  G ++G+  R +     +S   L+
Sbjct: 315 IQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLL 374

Query: 294 Y 294
           Y
Sbjct: 375 Y 375

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 36/90 (40%), Gaps = 12/90 (13%)

Query: 37  VTPLDLVKCRRQVD------------ASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGY 84
            TP+D++K R Q                +  S + G   + RSEG    F+GVG   I  
Sbjct: 305 TTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWT 364

Query: 85  SLQGAFKYGGYEFFKHQYSQLVSPETAHSY 114
           S+Q +     Y+       +  SP +A  Y
Sbjct: 365 SIQSSIMLLLYQVTLKSLDRFASPNSAFKY 394

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 118/265 (44%), Gaps = 34/265 (12%)

Query: 43  VKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQY 102
           + CR Q     +   L+ + +I + EG T ++ G+  T +         + GYE+ + + 
Sbjct: 103 LNCRNQK----FNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDR- 157

Query: 103 SQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPP--------FAR 154
               SP     Y T   L   A A  +A   + P E IK + Q ++P            R
Sbjct: 158 ----SPLNGL-YPTINPLICGAFARTLAATSVAPLELIKTKLQ-SIPSSSMKNGSVIMYR 211

Query: 155 NVFDAYSKMVGAEGFA-SLYKGITPLWFRQIPYTMCKFTSFE-RIVEMIYARLPTPKREM 212
           ++F+     +   G A +++KG+    +R +P++   + S+E    ++ Y    T  +  
Sbjct: 212 DLFNEIKSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNS 271

Query: 213 SQLGQISVSFAGGYLAGILCAVVSHPADVMVSK----VNNERKSGESTLQ--ATSRIYGK 266
           S     + SF GG+++G L A+ +HP DV  ++    +  ++K   S L+  +++ ++G 
Sbjct: 272 SNWFHFTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGF 331

Query: 267 I-------GFPGLWNGLAVRILMIG 284
           +       G   L+ GLA R+  I 
Sbjct: 332 LNYIRKTEGIGALYTGLAPRVAKIA 356

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 79/188 (42%), Gaps = 29/188 (15%)

Query: 35  SAVTPLDLVKCRRQV--DASLYKSNLDGWRQI---VRSEGATK-----VFTGVGATAIGY 84
           ++V PL+L+K + Q    +S+   ++  +R +   ++SE A +     +F G+  T    
Sbjct: 182 TSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTMFKGLEITLWRD 241

Query: 85  SLQGAFKYGGYEFFKHQYSQLVSPETAHS------YRTGIFLAASASAEFIADIFLCPWE 138
               A  +  YEF+K + + L SP T         + T  FL    S   +A I   P++
Sbjct: 242 VPFSAIYWASYEFYKTKVAYL-SPSTFDKNSSNWFHFTNSFLGGFISGS-LAAICTHPFD 299

Query: 139 AIKVRQQTAVPPP-----------FARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYT 187
             K RQQ ++               +  +F   + +   EG  +LY G+ P   +  P  
Sbjct: 300 VGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYTGLAPRVAKIAPSC 359

Query: 188 MCKFTSFE 195
               +S+E
Sbjct: 360 AIMISSYE 367

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 108/250 (43%), Gaps = 29/250 (11%)

Query: 54  YKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHS 113
           +   L+ + +I   EG T ++ G+  T +         + GYE+ +      VSP  A +
Sbjct: 102 FNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRD-----VSP-IAST 155

Query: 114 YRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPP--------FARNVFDAYS---K 162
           Y T   L   A A   A   + P E +K + Q+ +P            +++ +      K
Sbjct: 156 YPTLNPLFCGAIARVFAATSIAPLELVKTKLQS-IPRSSKSTKTWMMVKDLLNETRQEMK 214

Query: 163 MVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSF 222
           MVG     +L+KG+    +R +P++   ++S+E   E ++        + +       SF
Sbjct: 215 MVGPS--RALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSF 272

Query: 223 AGGYLAGILCAVVSHPADV-----MVSKVNNERKSG----ESTLQATSRIYGKIGFPGLW 273
           A G ++G++ A+ +HP DV      +S +NN    G     +  +    I+   G   L+
Sbjct: 273 ASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALY 332

Query: 274 NGLAVRILMI 283
            GLA R++ I
Sbjct: 333 TGLAARVIKI 342

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 90/210 (42%), Gaps = 18/210 (8%)

Query: 7   ILNSPTLYSPEYYAACTLGGLVACGPTHSAV-----TPLDLVKCRRQV--------DASL 53
           ILN+    + E +    +G  VA G T   V     +PL LVK R Q           + 
Sbjct: 109 ILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTH 168

Query: 54  YKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHS 113
           Y S  +G   I RSEG   +F GV A  +   +  A +   Y   K+     +      +
Sbjct: 169 YTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKN----FLLKHDLMN 224

Query: 114 YRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLY 173
             TG+ L +S  A F   + + PW+ +  R        ++  + D + K V  EG ++LY
Sbjct: 225 DGTGLHLLSSTIAGFGVGVAMNPWDVVLTRVYNQKGNLYSGPI-DCFIKTVRNEGLSALY 283

Query: 174 KGITPLWFRQIPYTMCKFTSFERIVEMIYA 203
           KG      R  P+T+   T  E+ ++++Y+
Sbjct: 284 KGFGAQILRIGPHTVLCLTFMEQTLKLVYS 313

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 120/289 (41%), Gaps = 44/289 (15%)

Query: 25  GGLVACGPTHSAVTPLDLVKCRRQVD-------ASLYKSNLDGWRQIVRSEGATKVFTGV 77
           GGL AC    +   P D VK R Q+        A +Y + +  +  I ++EG   +  G+
Sbjct: 27  GGLAACIAV-TVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQKGL 85

Query: 78  GATAIGY--SLQGAFKYGGYEFFKHQYSQLVSP--ETAHSYRTGIFLAASASAEFIADIF 133
            A+A  Y  +L G+ + G YE  +   + +  P  E+      GI +AA A++  +    
Sbjct: 86  -ASAYLYQIALNGS-RLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFI 143

Query: 134 LCPWEAIKVRQQT---AV---PPPFARNVFDAYSKMVGAEGFASLYKGITPLWFR----- 182
             P   +K R Q+   A+         + F+  + +  +EG   L++G+     R     
Sbjct: 144 GSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGS 203

Query: 183 --QIP-YTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPA 239
             Q+P Y +CK  +F              K ++   G   +      +AG    V  +P 
Sbjct: 204 AVQLPIYNICK--NF------------LLKHDLMNDGT-GLHLLSSTIAGFGVGVAMNPW 248

Query: 240 DVMVSKVNNERKSGEST-LQATSRIYGKIGFPGLWNGLAVRILMIGTLT 287
           DV++++V N++ +  S  +    +     G   L+ G   +IL IG  T
Sbjct: 249 DVVLTRVYNQKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGPHT 297

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 85/208 (40%), Gaps = 23/208 (11%)

Query: 109 ETAHSYRT--------GIFLAASASAEFIADIFLCPWEAIKVRQQT-----AVPPPFARN 155
           E  H+ +T        G F+A   +A  IA     P++ +K R Q      A       N
Sbjct: 6   EEKHNQKTAAHKVSKFGSFVAGGLAA-CIAVTVTNPFDCVKTRMQLQGELHANAAKVYTN 64

Query: 156 VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQL 215
              A+  +   EG A L KG+   +  QI     +   +E I   I   +  P  E  ++
Sbjct: 65  PIQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPI-RGILNNVFYPNVESHKV 123

Query: 216 GQISVSFAGGYLAGILCAVVSHPADVMVSKV---NNERKSGEST-----LQATSRIYGKI 267
             I ++ A G  +G++ A +  P  ++ +++   +N    G+ T         + I+   
Sbjct: 124 QHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSE 183

Query: 268 GFPGLWNGLAVRILMIGTLTSFQWLIYD 295
           G  GL+ G+   +L  G  ++ Q  IY+
Sbjct: 184 GIKGLFRGVDAAMLRTGIGSAVQLPIYN 211

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 110/258 (42%), Gaps = 25/258 (9%)

Query: 39  PLDLVKCRRQVDAS-----LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYG 93
           PLD+VK R Q+         Y   +D  ++IV  EG  +++ G+ +  +  + + A K+ 
Sbjct: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFA 90

Query: 94  GYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFA 153
             + F+  Y Q    E        + + A ASA  +    + P+E +K+R Q A      
Sbjct: 91  CNDEFQKLYKQAFGVE---KLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS--Y 145

Query: 154 RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMS 213
           +   D   K+V  EG  ++Y G+    +R   +    F     I+    A LP    +  
Sbjct: 146 KGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG----IIFQARALLPAAHNKTQ 201

Query: 214 QLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNE-------RKSGESTLQATSRIYGK 266
            +    +S + G   G +   +S P DV+ S++ N        RK   S L +   IY +
Sbjct: 202 CITNDLISDSIGCSIGCM---LSTPFDVVKSRIQNTAVIPGVVRKYNWS-LPSLLTIYRE 257

Query: 267 IGFPGLWNGLAVRILMIG 284
            GF  L+ G   ++L +G
Sbjct: 258 EGFRALYKGFVPKVLRLG 275

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 70/161 (43%), Gaps = 24/161 (14%)

Query: 37  VTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
           V P +LVK R Q  +S YK  +D  R+IV  EG   ++ G+ +T   ++L      GGY 
Sbjct: 128 VVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN----GGYF 183

Query: 97  FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLC--------PWEAIKVR-QQTA 147
               Q   L+    AH+    I      + + I+D   C        P++ +K R Q TA
Sbjct: 184 GIIFQARALLP--AAHNKTQCI------TNDLISDSIGCSIGCMLSTPFDVVKSRIQNTA 235

Query: 148 VPPPFARNV---FDAYSKMVGAEGFASLYKGITPLWFRQIP 185
           V P   R       +   +   EGF +LYKG  P   R  P
Sbjct: 236 VIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 65/158 (41%), Gaps = 9/158 (5%)

Query: 122 ASASAEFIADIFLCPWEAIKVRQQTAV---PPPFARNVFDAYSKMVGAEGFASLYKGITP 178
           A A A     + + P + +K R Q  V     P    V D   K+V  EG   LYKGI+ 
Sbjct: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76

Query: 179 LWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHP 238
               + P    KF   +      + +L      + +L Q  +S   G  AG + A V  P
Sbjct: 77  PILMEAPKRATKFACNDE-----FQKLYKQAFGVEKLSQ-PLSMLAGASAGCVEAFVVVP 130

Query: 239 ADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGL 276
            +++  ++ +   S +  +    +I  + G   ++NGL
Sbjct: 131 FELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGL 168

>Scas_489.4
          Length = 297

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/263 (20%), Positives = 113/263 (42%), Gaps = 19/263 (7%)

Query: 30  CGPTHSAVT-PLDLVKCRRQV---DASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYS 85
            G   +++T P +  K R Q+    ++  ++ L       +++G   ++ G  A  +G +
Sbjct: 20  AGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVGCPAFIVGNT 79

Query: 86  LQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIK---V 142
            +   ++ G++  K+     V+ E +        L A      +A   + P+EAIK   +
Sbjct: 80  AKAGIRFLGFDTIKNMLRDPVTGELSGPRGVVAGLGAGLLESVVA---VTPFEAIKTALI 136

Query: 143 RQQTAVPPPFARN---VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVE 199
             + A+ P +  N   +   Y  +V  +G   LY+G+ P+  RQ      +   + +I  
Sbjct: 137 DDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQAVRLGCYNKIKT 196

Query: 200 MIYARLPTPK-REMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNN-ERKSGESTL 257
           M+      PK R +S      ++F  G  +G++    + P D + +++ + +     ST+
Sbjct: 197 MVQDYTNAPKDRPLSS----GLTFIVGAFSGVVTVYTTMPIDTVKTRMQSLDATKYTSTV 252

Query: 258 QATSRIYGKIGFPGLWNGLAVRI 280
              ++I+ + G    W G   R+
Sbjct: 253 NCFAKIFKEEGLKTFWKGATPRL 275

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 69/171 (40%), Gaps = 9/171 (5%)

Query: 36  AVTPLDLVKC----RRQVDASLYKSN----LDGWRQIVRSEGATKVFTGVGATAIGYSLQ 87
           AVTP + +K      +Q     Y++N    L  +  +VR +G   ++ GV   ++  +  
Sbjct: 124 AVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAAN 183

Query: 88  GAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTA 147
            A + G Y   K       +        +G+     A +  +      P + +K R Q+ 
Sbjct: 184 QAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQSL 243

Query: 148 VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIV 198
               +   V + ++K+   EG  + +KG TP   R I      FT +E ++
Sbjct: 244 DATKYTSTV-NCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

>Kwal_26.7967
          Length = 297

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 123/290 (42%), Gaps = 26/290 (8%)

Query: 1   MSQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQ-VDASLYKSN-- 57
           MSQK  +     L+S   + A +L G V    T+    P +  K R Q VD S   S   
Sbjct: 1   MSQKKQV---DPLHS---FLAGSLAGAVEASITY----PFEFAKTRLQLVDKSSTASRNP 50

Query: 58  LDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTG 117
           L    +  + +G   V+ G  A  +G + +   ++ G++  K+    L  P T       
Sbjct: 51  LTLIYRTAKVQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNI---LRDPTTGELSGPR 107

Query: 118 IFLAASASAEFIADIFLCPWEAIKV----RQQTAVPP--PFARNVFDAYSKMVGAEGFAS 171
             +A   +    + + + P+EAIK      +Q+A P      R +   YS +V  +GF+ 
Sbjct: 108 GIVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSG 167

Query: 172 LYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGIL 231
           LY+G+ P+  RQ      +   + +I  MI     + K +    G   ++F  G  +GI+
Sbjct: 168 LYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSG---MTFVVGAFSGIV 224

Query: 232 CAVVSHPADVMVSKVNNERKSG-ESTLQATSRIYGKIGFPGLWNGLAVRI 280
               + P D + +++ +   S   ST+   + ++ + G    W G   R+
Sbjct: 225 TVYTTMPIDTVKTRMQSLDSSKYSSTINCFATVFREEGLKTFWKGATPRL 274

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 85/209 (40%), Gaps = 15/209 (7%)

Query: 6   SILNSPT---LYSPEYYAACTLGGLVACGPTHSAVTPLDLVKC----RRQVDASLYKSN- 57
           +IL  PT   L  P    A    GL+    +  AVTP + +K      +Q  +  Y +N 
Sbjct: 93  NILRDPTTGELSGPRGIVAGLGAGLLE---SVVAVTPFEAIKTALIDDKQSASPKYHNNG 149

Query: 58  ---LDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSY 114
              L  +  +V  +G + ++ GV   ++  +   A + G Y   K       +       
Sbjct: 150 RGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPL 209

Query: 115 RTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYK 174
            +G+     A +  +      P + +K R Q+     ++  + + ++ +   EG  + +K
Sbjct: 210 SSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSSKYSSTI-NCFATVFREEGLKTFWK 268

Query: 175 GITPLWFRQIPYTMCKFTSFERIVEMIYA 203
           G TP   R I      FT +E+++ ++ A
Sbjct: 269 GATPRLGRLILSGGIVFTIYEKVLVVLGA 297

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 112/252 (44%), Gaps = 20/252 (7%)

Query: 39  PLDLVKCRRQVDAS-LYKSNLDGWRQIVRSEG-ATKVFTGVGATAIGYSLQGAFKYGGYE 96
           P D VK R Q  AS ++ +     +   ++EG A   F G+ +  +G  L+ A  +  Y 
Sbjct: 33  PFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFFQGIASPLVGACLENATLFVSY- 91

Query: 97  FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTA---VPPPFA 153
              +Q S+ +   T + +  G  L +   A   A + L P E +K + Q A   V     
Sbjct: 92  ---NQCSKFLEKHT-NVFPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKT 147

Query: 154 RN--VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYAR--LPTPK 209
           ++  V      ++   G A L++G +  + R+    +  F ++E + + +  R  L  PK
Sbjct: 148 KHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPK 207

Query: 210 REMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSRIYGKIGF 269
           R+ S++ ++ +S   G  AG+       PAD + S +  E  S      A  +I+GK G 
Sbjct: 208 RDESKIWELLIS---GGSAGLAFNASIFPADTVKSVMQTEHIS---LTNAVKKIFGKFGL 261

Query: 270 PGLWNGLAVRIL 281
            G + GL + + 
Sbjct: 262 KGFYRGLGITLF 273

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 75/186 (40%), Gaps = 20/186 (10%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASL--------YKSNLDGWRQIVRSEGATKVFT 75
           + G VA       +TP++LVKC+ QV A+L        +   L   + I+   G   ++ 
Sbjct: 112 ISGGVAGSCASLVLTPVELVKCKLQV-ANLQVASAKTKHTKVLPTIKAIITERGLAGLWQ 170

Query: 76  GVGATAIGYSLQGAFKYGGYEFFKHQYSQ---LVSPETAHSYRTGIFLA-ASASAEFIAD 131
           G   T I  S  G   +  YE  K        L  P+   S    + ++  SA   F A 
Sbjct: 171 GQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNAS 230

Query: 132 IFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKF 191
           IF  P + +K   QT        ++ +A  K+ G  G    Y+G+    FR +P     F
Sbjct: 231 IF--PADTVKSVMQTE-----HISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVF 283

Query: 192 TSFERI 197
             FE +
Sbjct: 284 YIFETL 289

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 72/313 (23%), Positives = 122/313 (38%), Gaps = 38/313 (12%)

Query: 3   QKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN----- 57
           + S +++   L      A   + G  A    HS + PLD +K R Q   ++  +      
Sbjct: 2   ESSDVIDYEALPDHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIP 61

Query: 58  ---LDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKH-QYSQLVSPETAHS 113
              L     I   EG+  ++ GV +  +G     A  +  YE  K     +  S    H 
Sbjct: 62  STMLRQLSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHF 121

Query: 114 YRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLY 173
           ++T     + A+A   AD  + P++ IK R Q         +V+D   ++   EGF + Y
Sbjct: 122 FKTAF---SGATATIAADALMNPFDVIKQRIQLNT----NISVWDTAKRIYSKEGFQAFY 174

Query: 174 KGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQIS--VSFAGGYLAGIL 231
                     IP+    F  ++           T  R  +  G  +  +    G ++G  
Sbjct: 175 SSYPTTLAINIPFAAFNFGIYD-----------TATRYFNPSGVYNPFIHCLCGGISGAA 223

Query: 232 CAVVSHPADVMVS--------KVNNER-KSGESTLQATSRIYGKIGFPGLWNGLAVRILM 282
           CA ++ P D + +        KV+ E  K  ++  +AT  IY   G+ G W+G+  RIL 
Sbjct: 224 CAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILA 283

Query: 283 IGTLTSFQWLIYD 295
               T+  W  Y+
Sbjct: 284 NMPATAISWTAYE 296

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 116/270 (42%), Gaps = 22/270 (8%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIV---RSEGATKVFTGVGAT 80
           L G +A     S   P +  K R Q+     K++ +    I    ++ G + ++ G  A 
Sbjct: 95  LAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCPAF 154

Query: 81  AIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAI 140
            +G + +   ++ G++  K+      + E +        L A      +A   + P+EAI
Sbjct: 155 IVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRGVVAGLGAGLLESVVA---VTPFEAI 211

Query: 141 K---VRQQTAVPPPFARN---VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSF 194
           K   +  + A  P +  N   +   Y+K++  +GF+ LY+G+ P+  RQ      +   +
Sbjct: 212 KTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRLGCY 271

Query: 195 ERIVEMI--YARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKS 252
            +I  ++  Y  +P  K   S L     +F  G  +GI+    + P D + +++ +   +
Sbjct: 272 NKIKTLVQDYTNVPKDKPLSSGL-----TFIVGAFSGIVTVYTTMPIDTVKTRMQS-LNA 325

Query: 253 GE--STLQATSRIYGKIGFPGLWNGLAVRI 280
           G+  ST+   + I+ + G    W G   R+
Sbjct: 326 GQYSSTINCFATIFKEEGLKTFWKGATPRL 355

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/174 (18%), Positives = 73/174 (41%), Gaps = 9/174 (5%)

Query: 36  AVTPLDLVKC----RRQVDASLYKSNLDG----WRQIVRSEGATKVFTGVGATAIGYSLQ 87
           AVTP + +K      +Q     Y++N  G    + +++  +G + ++ GV   ++  +  
Sbjct: 204 AVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAAN 263

Query: 88  GAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTA 147
            A + G Y   K       +        +G+     A +  +      P + +K R Q+ 
Sbjct: 264 QAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSL 323

Query: 148 VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201
               ++  + + ++ +   EG  + +KG TP   R I      FT +E+++ ++
Sbjct: 324 NAGQYSSTI-NCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLTVL 376

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 123/291 (42%), Gaps = 34/291 (11%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASL------------YKSNLDGWRQIVRSEGAT 71
           + G VA     + + PLD+VK R Q++ +             Y   +D  ++IV+ EG +
Sbjct: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76

Query: 72  KVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSP-ETAHSYRTGIFLAASASAEFIA 130
           +++ G+ +  +  + + A K+   + ++  +  L +  ET       I +AA ASA    
Sbjct: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK----ISIAAGASAGMTE 132

Query: 131 DIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
              + P+E IK+R Q            D   K +  EG   LYKGI    +R   +    
Sbjct: 133 AAVIVPFELIKIRMQDVKSSYLGP--MDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGY 190

Query: 191 FTSFERIVEMIYARLPTPKREMSQLGQISVS-FAGGYLAGILCAVVSHPADVMVSK---- 245
           F     ++  +   +P  K +    GQ + +    G + G +  +++ P DV+ S+    
Sbjct: 191 FG----VIYQVRNSMPVAKTK----GQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242

Query: 246 --VNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIY 294
             V++  K     L +   IY + GF  L+ G   ++  +    S   +++
Sbjct: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 58.9 bits (141), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/272 (22%), Positives = 117/272 (43%), Gaps = 20/272 (7%)

Query: 19  YAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQI---VRSEGATKVFT 75
           + A  L G V    T+    P +  K R Q+     K++ +    I    +++G   ++ 
Sbjct: 14  FVAGALAGAVEASITY----PFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQGVGAIYV 69

Query: 76  GVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLC 135
           G  A  +G + + A ++ GY+  ++      + E +     G+ LA   +    + + + 
Sbjct: 70  GCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGP--RGV-LAGLGAGLLESVVAVT 126

Query: 136 PWEAIK---VRQQTAVPPPF---ARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMC 189
           P+EAIK   +  + +V P +    R++   Y  +V  EGF  LY G+ P+  RQ      
Sbjct: 127 PFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAANQAV 186

Query: 190 KFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNE 249
           +   + +I  ++      PK +    G   ++F  G  +G++    + P D + +++ + 
Sbjct: 187 RLGCYNKIKVLVQDYTGAPKDKPLTSG---LTFIVGAFSGVVTVYATMPIDTVKTRMQSL 243

Query: 250 RKSG-ESTLQATSRIYGKIGFPGLWNGLAVRI 280
             S   STL   + IY + G    W G   R+
Sbjct: 244 TASKYSSTLNCFTTIYKEEGLKTFWKGATPRL 275

 Score = 35.0 bits (79), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 34/171 (19%), Positives = 67/171 (39%), Gaps = 9/171 (5%)

Query: 36  AVTPLDLVKC----RRQVDASLYKSN----LDGWRQIVRSEGATKVFTGVGATAIGYSLQ 87
           AVTP + +K      +Q     Y++N       +  +V+ EG   ++ GV   ++  +  
Sbjct: 124 AVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAAN 183

Query: 88  GAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTA 147
            A + G Y   K                +G+     A +  +      P + +K R Q+ 
Sbjct: 184 QAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQSL 243

Query: 148 VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIV 198
               ++ +  + ++ +   EG  + +KG TP   R I      FT +E ++
Sbjct: 244 TASKYS-STLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 128/300 (42%), Gaps = 39/300 (13%)

Query: 5   SSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASL----------- 53
           +SI N P  +  ++ A     G +A       + PLD+VK R Q+  +            
Sbjct: 2   TSIDNRPLPFIYQFTA-----GAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKA 56

Query: 54  ----YKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLV-SP 108
               Y   +D   +IV+ EG + ++ G+ +  +  + + A K+ G + F+  Y ++  +P
Sbjct: 57  AVDHYTGVMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTP 116

Query: 109 ETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEG 168
               + +  I+  ASA A  +    + P+E +K+R Q  V   F +   +     V   G
Sbjct: 117 NGEMTQKIAIYSGASAGA--VEAFVVAPFELVKIRLQD-VNSQF-KTPIEVVKNSVVKGG 172

Query: 169 FASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLA 228
             SL+ G+    +R + +    F     I+  I   LP  K    +          G + 
Sbjct: 173 VLSLFNGLEATIWRHVLWNAGYFG----IIFQIRKLLPAAKTSTEKTRN---DLIAGAIG 225

Query: 229 GILCAVVSHPADVMVSKVNNERKSG-----ESTLQATSRIYGKIGFPGLWNGLAVRILMI 283
           G +  +++ P DV+ S++  +R SG       +L +   +Y + GF  L+ G A +++ +
Sbjct: 226 GTVGCLLNTPFDVVKSRI--QRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRL 283

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 64/155 (41%), Gaps = 13/155 (8%)

Query: 36  AVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGY 95
            V P +LVK R Q   S +K+ ++  +  V   G   +F G+ AT   + L  A    GY
Sbjct: 139 VVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIWRHVLWNA----GY 194

Query: 96  EFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARN 155
                Q  +L+      + +T   L A A    +  +   P++ +K R Q +  P    N
Sbjct: 195 FGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKYN 254

Query: 156 -----VFDAYSKMVGAEGFASLYKGITPLWFRQIP 185
                V   Y +    EGF +LYKG  P   R  P
Sbjct: 255 WSLPSVLLVYRE----EGFKALYKGFAPKVMRLAP 285

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 88/184 (47%), Gaps = 21/184 (11%)

Query: 38  TPLDLVKCRRQVDAS------LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFK 91
            P+ L+K R Q+D +       YK++ D  + ++R+EG T ++ G+ A+ +G S++G  +
Sbjct: 194 NPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLG-SVEGILQ 252

Query: 92  YGGYEFFKHQ----------YSQLVSPETAHSYRTGIFLAASAS-AEFIADIFLCPWEAI 140
           +  YE  K            Y    +  T+   +     + SA  A+F+A I   P E +
Sbjct: 253 WLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVV 312

Query: 141 KVRQQTAVPPPFARN---VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERI 197
           + R +        R    +  ++  ++  EG  S+Y G+TP   R +P ++  F ++E +
Sbjct: 313 RTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIV 372

Query: 198 VEMI 201
           + ++
Sbjct: 373 IRLL 376

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 57/293 (19%), Positives = 104/293 (35%), Gaps = 58/293 (19%)

Query: 39  PLDLVKCRRQVDASL-----------------------------YKSNLDGWRQIVRSEG 69
           P DLVK R Q D  L                             +K  L     + + EG
Sbjct: 72  PFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYKQEG 131

Query: 70  ATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTG-----IFLAASA 124
              +F G+G   +G     +  +  Y   K  Y        A ++  G     I L A+A
Sbjct: 132 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDMY--------AKAFNNGQETPMIHLMAAA 183

Query: 125 SAEFIADIFLCPWEAIKVRQQTAVPPPFA----RNVFDAYSKMVGAEGFASLYKGITPLW 180
           +A +       P   IK R Q       +    +N +D    ++  EGF  LYKG++  +
Sbjct: 184 TAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASY 243

Query: 181 FRQIP-------YTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCA 233
              +        Y   K    ER +E    +    K    ++ +         LA  + +
Sbjct: 244 LGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVAS 303

Query: 234 VVSHPADVMVSKV-----NNERKSGESTLQATSRIYGKIGFPGLWNGLAVRIL 281
           + ++P +V+ +++      N ++     +Q+   I  + G   +++GL   ++
Sbjct: 304 IATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLM 356

>Scas_709.9
          Length = 365

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/288 (20%), Positives = 112/288 (38%), Gaps = 34/288 (11%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQ------VDASLYKSNLDGWRQIVRSEGATKVFTGV 77
           L G++ C        PLD+ K R Q      ++   Y+  L     IV  EG   ++ G+
Sbjct: 77  LSGIIVC--------PLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 78  GATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPW 137
               +GY       +  YEF K  Y +++      S+      A +AS      +   P 
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAITAGAAST-----VLTNPI 183

Query: 138 EAIKVRQQTAVP----PPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193
             +K R     P        R   DA+ K++  EG  +LY G+ P  F  + +    F  
Sbjct: 184 WVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLL-HVAIHFPV 242

Query: 194 FERIVEMIYARLPTPKREMSQLG-QISVSFAGGYLAGILCAVVSHPADVMVSKVNNERK- 251
           +E++   ++    T      +    ++        + +L +++++P +++ +++  +   
Sbjct: 243 YEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDK 302

Query: 252 ---SGESTLQATSRIYGKIGFPGLWNGLAVRILMIG-----TLTSFQW 291
              S    L    R Y   G  G ++G A  +L        TL SF++
Sbjct: 303 LLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEY 350

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 84/188 (44%), Gaps = 21/188 (11%)

Query: 122 ASASAEFIADIFLCPWEAIKVRQQT----AVPPPFARNVFDAYSKMVGAEGFASLYKGIT 177
           + A A F++ I +CP +  K R Q     ++  P+ R V    S +V  EG   LYKG+ 
Sbjct: 70  SGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGLI 129

Query: 178 PLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSH 237
           P+     P  M  F+ +E   + +Y R+  P  +      IS S      AG    V+++
Sbjct: 130 PIILGYFPTWMIYFSVYE-FAKDLYPRV-LPNSDF-----ISHS-CSAITAGAASTVLTN 181

Query: 238 PADVMVSKVNNERKSGES------TLQATSRIYGKIGFPGLWNGLAVRILMIGTL-TSFQ 290
           P  V+ +++  +   GES      T+ A  +I  + G   L+ GL     M G L  +  
Sbjct: 182 PIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPS--MFGLLHVAIH 239

Query: 291 WLIYDSFK 298
           + +Y+  K
Sbjct: 240 FPVYEKLK 247

>Scas_721.129
          Length = 323

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 86/195 (44%), Gaps = 15/195 (7%)

Query: 117 GIFLAASASAEFIADIFLCPWEAIKVRQQ-----TAVPPPFARNVFDAYSKMVGAEGFAS 171
           G F+A   +A  IA  F  P E +K+R Q      AV     RN       +   EG   
Sbjct: 23  GSFIAGGMAA-CIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRG 81

Query: 172 LYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGIL 231
           L KG+   +  QI     +   +E I   + +    P  E  ++ ++S++ A G  +GI+
Sbjct: 82  LQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTF-YPNEESHKIQKVSINVAAGASSGII 140

Query: 232 CAVVSHPADVMVSKV---NNERKSGESTL-----QATSRIYGKIGFPGLWNGLAVRILMI 283
            AV+  P  ++ +++   ++  K GE T         S I    GF GL+ G+   IL  
Sbjct: 141 GAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRT 200

Query: 284 GTLTSFQWLIYDSFK 298
           G  +S Q  IY++ K
Sbjct: 201 GAGSSVQLPIYNTAK 215

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 110/245 (44%), Gaps = 31/245 (12%)

Query: 25  GGLVACGPTHSAVT---PLDLVKCRRQVDASL-------YKSNLDGWRQIVRSEGATKVF 74
           GG+ AC     AVT   P++LVK R Q+   L       Y++ + G   I R+EG   + 
Sbjct: 28  GGMAAC----IAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQ 83

Query: 75  TGVGATAI-GYSLQGAFKYGGYEFFKHQYSQLVSP-ETAHSY-RTGIFLAASASAEFIAD 131
            G+ A  I    L G+ + G YE  ++  +    P E +H   +  I +AA AS+  I  
Sbjct: 84  KGLVAAYIYQIGLNGS-RLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIGA 142

Query: 132 IFLCPWEAIKVRQQT---AVP---PPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIP 185
           +   P   +K R Q+   A+        RNV++  S +   EGF  L++GI     R   
Sbjct: 143 VIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGA 202

Query: 186 YTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSK 245
            +  +   +      +       K ++ + G   +      ++G+  AVV +P DV++++
Sbjct: 203 GSSVQLPIYNTAKNFLL------KNDLMKDGP-GLHLTASTISGLGVAVVMNPWDVILTR 255

Query: 246 VNNER 250
           + N++
Sbjct: 256 IYNQK 260

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 73/178 (41%), Gaps = 21/178 (11%)

Query: 38  TPLDLVKCRRQV--------DASLYKSNLDGWRQIVRSEGATKVFTGVGA----TAIGYS 85
           +PL LVK R Q         + + Y++  +G   I R+EG   +F G+ A    T  G S
Sbjct: 146 SPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGSS 205

Query: 86  LQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ 145
           +Q         F          P        G+ L AS  +     + + PW+ I  R  
Sbjct: 206 VQLPIYNTAKNFLLKNDLMKDGP--------GLHLTASTISGLGVAVVMNPWDVILTRIY 257

Query: 146 TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA 203
                 + +   D + K V  EG ++LYKG      R  P+T+   T  E+ ++++Y+
Sbjct: 258 NQKGNLY-KGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLTFMEQTMKLVYS 314

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 119/304 (39%), Gaps = 40/304 (13%)

Query: 9   NSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDAS--------LYKSNLDG 60
           N+P +Y     AA    G++     HS + P+D +K R Q  ++        L  + L  
Sbjct: 14  NAPLVYQ---LAAGAFAGIME----HSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQ 66

Query: 61  WRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFL 120
             +I  +EG+  ++ GV +  +G     A  +  YE  K   S+L+ PE   +++     
Sbjct: 67  IAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEMCK---SRLIDPEDRQTHQPLKTA 123

Query: 121 AASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLW 180
            +   A   AD  + P++ IK R Q        +     Y +    EG A+ +       
Sbjct: 124 LSGTLATVAADALMNPFDTIKQRLQLHPSDSMTKCAVRMYQR----EGIAAFFYSYPTTI 179

Query: 181 FRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPAD 240
              IP+    F  +E   ++       P    +      +    G ++G  CA ++ P D
Sbjct: 180 AMNIPFAALNFVIYESSTKIF-----NPSNNYNPW----IHCLCGGISGATCAAITTPLD 230

Query: 241 VM--------VSKVNNER-KSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQW 291
            +           V ++  K  ++  +A S I+   G+ G + GL  RI+     T+  W
Sbjct: 231 CVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISW 290

Query: 292 LIYD 295
             Y+
Sbjct: 291 TSYE 294

>Kwal_26.7653
          Length = 325

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 73/174 (41%), Gaps = 13/174 (7%)

Query: 38  TPLDLVKCRRQV--------DASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGA 89
           +PL L+K R Q           + Y S  +G   I R+EG   ++ GV A  +      +
Sbjct: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208

Query: 90  FKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVP 149
            +   Y   KH     +         TG+ L AS  + F   + + PW+ I  R      
Sbjct: 209 VQLPIYNTAKH----FLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKG 264

Query: 150 PPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA 203
             + +   D + K V  EG  +LYKG     FR  P+T+   T  E+ ++++YA
Sbjct: 265 NLY-KGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYA 317

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 88/204 (43%), Gaps = 15/204 (7%)

Query: 108 PETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ-----TAVPPPFARNVFDAYSK 162
           P      +TG F+A   +A  IA     P E +K R Q     +A      +N   A   
Sbjct: 17  PAAQKVSKTGSFIAGGMAA-CIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKV 75

Query: 163 MVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSF 222
           +   EG   L KG++  +  QI     +   +E I   +  +   P  +  ++  ++V+ 
Sbjct: 76  IFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPI-RSVLNKTFYPAMDPHKVQNVAVNV 134

Query: 223 AGGYLAGILCAVVSHPADVMVSKV---NNERKSGESTL-----QATSRIYGKIGFPGLWN 274
             G  +GI+ A++  P  ++ +++   +N  + G+ T         S IY   GF GL+ 
Sbjct: 135 VSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYR 194

Query: 275 GLAVRILMIGTLTSFQWLIYDSFK 298
           G+   IL  G  +S Q  IY++ K
Sbjct: 195 GVDAAILRTGAGSSVQLPIYNTAK 218

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 104/250 (41%), Gaps = 20/250 (8%)

Query: 14  YSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQ--VDASLYKSNLDGWRQIVRSEGAT 71
           +SP ++  C L G V      SA+  LD VK R+Q   +   YK  L  +R +   EG  
Sbjct: 50  HSPIWH--CFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFR 107

Query: 72  K-VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIA 130
           + ++ G  A  +G     A  +  YEF K             S+ T  FL      +F +
Sbjct: 108 RGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLTAGFLG-----DFFS 162

Query: 131 DIFLCPWEAIKVRQQTA---VPPPFA-----RNVFDAYSKMVGAEGFASLYKGITPLWFR 182
                P E +K R Q       P F      +++ +A + +   EG A+L+ G      R
Sbjct: 163 SFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLAR 222

Query: 183 QIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVM 242
            +P++  +F  +E+  +  +A L   K        IS     G  AG L  +++ P DV+
Sbjct: 223 DLPFSALQFAFYEKFRQ--WAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVV 280

Query: 243 VSKVNNERKS 252
            ++V  +  S
Sbjct: 281 KTRVQTQLPS 290

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 78/183 (42%), Gaps = 13/183 (7%)

Query: 120 LAASASAEFIADIFLCPWEAIKVRQQTAVP---PPFARNVFDAYSKMVGAEGFASLYKGI 176
           L A A +  +A     P + IK+R Q        PF   V +    M+  EG  S +KG 
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79

Query: 177 TPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVS 236
            P     + Y   +F+S+      ++ R  TP    ++L  + V    G  AGI  ++VS
Sbjct: 80  IPGSLLYVTYGSAQFSSYS-----LFNRYLTPFGLEARLHSLVV----GAFAGITSSIVS 130

Query: 237 HPADVMVSK-VNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
           +P DV+ ++ V N +    S  +    I+   G PG + G    +  I    S  +  Y+
Sbjct: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190

Query: 296 SFK 298
           + +
Sbjct: 191 TIR 193

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 80/194 (41%), Gaps = 20/194 (10%)

Query: 30  CGPTHSAVT-PLDLVKCRRQVDASLYKSNLD-GWRQIVRSEGATKVFTGVGATAIGYSLQ 87
            G T S V+ P D+++ R   +  ++  ++    R I + EG    F G  A+    +L 
Sbjct: 122 AGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLT 181

Query: 88  GAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASAS--AEFIADIFLCPWEAIKVRQQ 145
            +  +G YE  +    +      AH       L  SA      IA I   P E I+ R Q
Sbjct: 182 ASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241

Query: 146 ---TAVPPPFARN--VFDAYS---------KMVGAEGFASLYKGITPLWFRQIPYTMCKF 191
              +     F+R+  V+ +Y          +++  EG +SLY+GI     + IP T   F
Sbjct: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301

Query: 192 TSFERIVEMIYARL 205
             +E  +   Y R+
Sbjct: 302 WGYETAIH--YLRM 313

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 32/154 (20%), Positives = 58/154 (37%), Gaps = 15/154 (9%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDAS-----LYKSNLDGWRQIVRSEGATKVFTGVG 78
           L G V+     S   P+D +K R Q+  +          ++  R ++++EG    + G  
Sbjct: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI 80

Query: 79  ATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWE 138
             ++ Y   G+ ++  Y  F    +        HS   G F   ++S      I   P++
Sbjct: 81  PGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSS------IVSYPFD 134

Query: 139 AIKVR---QQTAVPPPFARNVFDAYSKMVGAEGF 169
            ++ R             R V D + K+ G  GF
Sbjct: 135 VLRTRLVANNQMHSMSITREVRDIW-KLEGLPGF 167

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (44%), Gaps = 16/181 (8%)

Query: 41  DLVKCRRQVDASL-------YKSNLDGWRQIVRSEGATKVF-TGVGATAIGYSLQGAFKY 92
           DL+  R Q D++L       YK+ +DG  +I ++EGA  +F TG     +   L  A + 
Sbjct: 120 DLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQV 179

Query: 93  GGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPF 152
             Y+ FK+    LV+       +    L +S  A F+A     P + IK     A   P 
Sbjct: 180 VTYDMFKNF---LVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHKKPG 236

Query: 153 ARN--VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKR 210
             +   F    + +  EG + +++G  P + R  P+TM  F + E++ +    R+  PK 
Sbjct: 237 HNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAMEQLKKY---RVGMPKE 293

Query: 211 E 211
           E
Sbjct: 294 E 294

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 100/237 (42%), Gaps = 31/237 (13%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYS 85
           G+ A   TH    PLDL K R Q       + +   R I+++EG   ++ G+ A+ +   
Sbjct: 17  GIFAVMNTH----PLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 86  LQGAFKYGGYEFFKHQYSQLVSPE---TAHSYRTGIFLAASAS---AEFIADIFLCPWEA 139
                ++G Y+  K      V P    T   Y  G  + + A    A   AD+       
Sbjct: 73  TYTTARFGMYDALKEH----VIPRDKLTNMWYLLGASMVSGALGGLAGNFADLI-----N 123

Query: 140 IKVRQQTAVPPPFARNVFDAYSKMVG---AEGFASLY-KGITPLWFRQIPYTMCKFTSFE 195
           I+++  +A+P    RN  +A   MV    AEG  SL+  G  P   R +  T  +  +++
Sbjct: 124 IRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYD 183

Query: 196 RIVEMIYARLP-TPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERK 251
                +  +    PK+  + L   + S   G++A  +C+    PADV+ + V N  K
Sbjct: 184 MFKNFLVTKYNMDPKKNSTHL---TSSLLAGFVATTVCS----PADVIKTIVMNAHK 233

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 74/175 (42%), Gaps = 26/175 (14%)

Query: 136 PWEAIKVRQQTA-VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSF 194
           P +  KVR Q A +P P    +      ++  EG   LY G++    RQ  YT  +F  +
Sbjct: 26  PLDLTKVRLQAAPIPKP---TIVQMLRSILKNEGIVGLYAGLSASLLRQCTYTTARFGMY 82

Query: 195 ERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNE----- 249
           + + E +  R         +L  +        ++G L  +  + AD++  ++ N+     
Sbjct: 83  DALKEHVIPR--------DKLTNMWYLLGASMVSGALGGLAGNFADLINIRMQNDSALPL 134

Query: 250 --RKSGESTLQATSRIYGKIGFPGL----WNGLAVRILMIGTLTSFQWLIYDSFK 298
             R++ ++ +    +IY   G   L    W    VR ++   +T+ Q + YD FK
Sbjct: 135 DKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVL---MTASQVVTYDMFK 186

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%)

Query: 225 GYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIG 284
           G  AGI   + +HP D+   ++        + +Q    I    G  GL+ GL+  +L   
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 285 TLTSFQWLIYDSFK 298
           T T+ ++ +YD+ K
Sbjct: 73  TYTTARFGMYDALK 86

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 108/266 (40%), Gaps = 37/266 (13%)

Query: 43  VKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQY 102
           V CR    A+  +  L+G R+I + EG   ++ G+G T +         + GYE  +   
Sbjct: 71  VGCRE--PAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRDNS 128

Query: 103 SQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARN------- 155
                   A+    G F      A  +A   + P E ++ R Q+    P AR+       
Sbjct: 129 PLASRLPVANPLVCGAF------ARILAATTIAPLELLRTRLQSV---PRARDTERTIYL 179

Query: 156 VFDAYSKM---VGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREM 212
           + D   +M   V   G+ +L+KG+    +R +P++   + ++E      +AR        
Sbjct: 180 IGDLLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWAR-HAATHNA 238

Query: 213 SQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKS-------GESTLQATSR--- 262
           S       SFA G + G + A+++HP DV  +++     S       G++T    SR   
Sbjct: 239 SNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMF 298

Query: 263 -----IYGKIGFPGLWNGLAVRILMI 283
                I    G   L+ GL  R++ I
Sbjct: 299 SFLNAIRKSEGIRALYTGLLPRVMKI 324

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 88/197 (44%), Gaps = 15/197 (7%)

Query: 115 RTGIFLAASASAEFIADIFLCPWEAIKVRQQ-----TAVPPPFARNVFDAYSKMVGAEGF 169
           + G F+A   +A  IA     P+E +K R Q     +A      RN F A   +   EG 
Sbjct: 23  KVGSFIAGGLAA-CIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGV 81

Query: 170 ASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAG 229
             L +G+   +  QI     +   +E I   +  +   P+ +  +L  ++V+   G  +G
Sbjct: 82  KGLQRGLVSAYVYQIGLNGSRLGFYEPI-RTVLNKTFFPESDPHKLQNVAVNVTAGATSG 140

Query: 230 ILCAVVSHPADVMVSKV---NNERKSGESTL-----QATSRIYGKIGFPGLWNGLAVRIL 281
           I+ A+V  P  ++ +++   +N  K GE T         + I+ K G  GL+ G+   IL
Sbjct: 141 IIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAIL 200

Query: 282 MIGTLTSFQWLIYDSFK 298
             G  +S Q  IY++ K
Sbjct: 201 RTGAGSSVQLPIYNTTK 217

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 71/178 (39%), Gaps = 21/178 (11%)

Query: 38  TPLDLVKCRRQV--------DASLYKSNLDGWRQIVRSEGATKVFTGVGA----TAIGYS 85
           +PL LVK R Q         + + Y S  +G   I + EG   +F GV A    T  G S
Sbjct: 148 SPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGSS 207

Query: 86  LQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ 145
           +Q    Y   + F  Q   +      H       L +S        I + PW+ +  R  
Sbjct: 208 VQLPI-YNTTKNFLLQNDIMKEGTALH-------LLSSTVTGLGVGIVMNPWDVVLTRVY 259

Query: 146 TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA 203
                 + +   D   K +  EG  +LYKG     FR  P+T+   T  E+ ++++YA
Sbjct: 260 NQKGNTY-KGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHTILCLTFMEQTMKLVYA 316

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 120/285 (42%), Gaps = 19/285 (6%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQ--VDASLYKSNLDGWRQIVRSEGAT--KVFTGVGA 79
           + GL A   T   V PLDL K R Q  + ++  K   + W +IV S+ +   +++ G+  
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRELYRGLTV 72

Query: 80  TAIGYSLQGAFKYGGYEFFKH---QYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCP 136
             +G ++     +  Y   K     Y+  +  +   S  + ++L+ASAS+  +  +   P
Sbjct: 73  NLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLS--SWMYLSASASSGMLTTVLTNP 130

Query: 137 WEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFER 196
              IK R  +                ++  +G   L+KG+ P     +      FT ++ 
Sbjct: 131 LWVIKTRMMSKANSDLTS--MKVLRDLIKNDGVQGLWKGLVPA-LVGVSQGALHFTCYDT 187

Query: 197 IVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGES- 255
           +   +  +      E++ L  I+V+     ++ +L     +P  ++ S + + + S    
Sbjct: 188 LKHKLVLK-NRDSDEITNLETIAVT----SVSKMLSTSAVYPFQLLKSNLQSFQASENDF 242

Query: 256 -TLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKA 299
             L  +  IY + G  G + GL+  +L     T   + IY++FK+
Sbjct: 243 KLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYENFKS 287

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 77/189 (40%), Gaps = 10/189 (5%)

Query: 16  PEY-YAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASL------YKSNLDGWRQIVRSE 68
           P++ + A +   + A   + +   P+ +VK R  + ++L      YK   D +R++   E
Sbjct: 172 PQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQE 231

Query: 69  GATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEF 128
           G   ++ G+  + +G     A  +  YE  K ++         +S      + AS+ ++ 
Sbjct: 232 GFKALYAGLVPSLLGL-FHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKM 290

Query: 129 IADIFLCPWEAIKVRQQ--TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPY 186
           IA     P E ++ R Q  + +P    R +F         EG    Y G T    R IP 
Sbjct: 291 IASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPA 350

Query: 187 TMCKFTSFE 195
           +     SFE
Sbjct: 351 SAITLVSFE 359

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 64/150 (42%), Gaps = 8/150 (5%)

Query: 36  AVTPLDLVKCRRQV-------DASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQG 88
           AV PLD+ K R Q        +   Y+  +     IVR EG   ++ G+    +GY    
Sbjct: 94  AVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTW 153

Query: 89  AFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAV 148
              +  YEF K ++   + P+     ++   + A A++  + +        + ++     
Sbjct: 154 MIYFSVYEFSK-KFFHGIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGE 212

Query: 149 PPPFARNVFDAYSKMVGAEGFASLYKGITP 178
            P   +  FDA+ K+   EGF +LY G+ P
Sbjct: 213 HPTHYKGTFDAFRKLFYQEGFKALYAGLVP 242

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 20/195 (10%)

Query: 116 TGIFLAASASAEFIADIFLCPWEAIKVRQQ-----TAVPPPFARNVFDAYSKMVGAEGFA 170
           T I   + A A F++ + +CP +  K R Q     T    P+ R +    S +V  EG  
Sbjct: 77  TQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPR 136

Query: 171 SLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGI 230
            LYKG+ P+     P  M  F+ +E   +  +   P       Q   ++ S A    AG 
Sbjct: 137 GLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFP-------QFDFVAQSCA-AITAGA 188

Query: 231 LCAVVSHPADVMVSKVNNERKSGES------TLQATSRIYGKIGFPGLWNGLAVRILMIG 284
               +++P  V+ +++  +   GE       T  A  +++ + GF  L+ GL   +L + 
Sbjct: 189 ASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLF 248

Query: 285 TLTSFQWLIYDSFKA 299
            + +  + IY+  K 
Sbjct: 249 HV-AIHFPIYEDLKV 262

>Scas_702.10
          Length = 302

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 112/271 (41%), Gaps = 30/271 (11%)

Query: 9   NSPT--LYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGW-RQIV 65
           +SPT  +  P +Y      G+ AC  TH    PLDL K R Q  A L K  L      I+
Sbjct: 3   DSPTKQIKYPWWYGGA--AGIFACVMTH----PLDLAKVRLQA-APLPKPTLGRMLTTIL 55

Query: 66  RSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASAS 125
           R+E    +++G+ A  +        ++G Y+  K      + P+  H       L  S  
Sbjct: 56  RNENVMGLYSGLSAAVLRQCTYTTVRFGAYDLMKEN----LIPQ-GHINDMVYLLPCSMF 110

Query: 126 AEFIADIFLCPWEAIKVRQQ--TAVPPPFARNVFDA----YSKMVGAEGFASLYKGITPL 179
           +  I  +     + + +R Q  +A+ P   RN  +A    Y   +   G  +L  G  P 
Sbjct: 111 SGAIGGLVGNFADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPN 170

Query: 180 WFRQIPYTMCKFTSFERIVEMIYARLP-TPKREMSQLGQISVSFAGGYLAGILCAVVSHP 238
             R +  T  +  +++     +  +L   PK+  + L       +   LAG++   +  P
Sbjct: 171 MVRGVLMTASQVVTYDVFKNYLVTKLSFDPKKNSTHL-------SASLLAGLVATTICSP 223

Query: 239 ADVMVSKVNNERKS-GESTLQATSRIYGKIG 268
           ADV+ +++ N  K+  ES ++  +    K G
Sbjct: 224 ADVIKTRIMNAHKTESESAIKILTSAIKKEG 254

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 75/172 (43%), Gaps = 14/172 (8%)

Query: 36  AVTPLDLVKCRRQVDASL------YKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGA 89
           A  P+ +VK R  +   +      YK  +D +R+I++ EGA  ++ G+    +G  L  A
Sbjct: 155 ATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGM-LNVA 213

Query: 90  FKYGGYEFFKHQY----SQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ 145
            ++  YE  K ++    S  VS +   S    + LA+  S + +A     P E ++ R Q
Sbjct: 214 IQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLS-KMVASTVTYPHEILRTRMQ 272

Query: 146 --TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195
             + +P    R++          EGFA  Y G      R +P  +    SFE
Sbjct: 273 LKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFE 324

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 57/280 (20%), Positives = 117/280 (41%), Gaps = 35/280 (12%)

Query: 37  VTPLDLVKCRRQVD--------ASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQG 88
           V P D+ K R Q          +  YK     +  I + EGA  ++ G+  T +GY    
Sbjct: 56  VCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLGYIPTL 115

Query: 89  AFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASAS---AEFIADIFLCPWEAIKVR-- 143
              +  Y+F + +YS  + P +        FL+ ++S   A  I+ +   P   +K R  
Sbjct: 116 MIYFSVYDFCR-KYSVDIFPHSP-------FLSNASSAITAGAISTVATNPIWVVKTRLM 167

Query: 144 QQTAVPP--PFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERI-VEM 200
            QT +       +   D + K++  EG  +LY G+ P     +   + +F  +E + +  
Sbjct: 168 LQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAI-QFPLYENLKIRF 226

Query: 201 IYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGEST---- 256
            Y+       +++      +  A   L+ ++ + V++P +++ +++  +     +     
Sbjct: 227 GYSESTDVSTDVTSSNFQKLILA-SMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQRHL 285

Query: 257 LQATSRIYGKIGFPGLWNGLAVRIL-----MIGTLTSFQW 291
           L      Y + GF G ++G A  ++      + TL SF++
Sbjct: 286 LPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEY 325

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 32/73 (43%), Gaps = 6/73 (8%)

Query: 129 IADIFLCPWEAIKVR------QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFR 182
           ++ + +CP++  K R      Q         +  F  ++ +   EG A LYKG+ P    
Sbjct: 51  LSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLG 110

Query: 183 QIPYTMCKFTSFE 195
            IP  M  F+ ++
Sbjct: 111 YIPTLMIYFSVYD 123

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 110/288 (38%), Gaps = 34/288 (11%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGA----TKVFT---GVG 78
           G++  G  H    P+D +  R   + +   S       I R   A     +VFT   G+G
Sbjct: 21  GILEIGVFH----PVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVFTLFPGLG 76

Query: 79  ATAIGYSLQGAFKYGGYEF--------FKHQYSQLVSPETAHSYRTGIFLAASASAEFIA 130
             A+   LQ  +KYGG  F        FK  +      +T  + R+    A + S   I 
Sbjct: 77  YAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRS----ATAGSLIGIG 132

Query: 131 DIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
           +I L P + +K+++QT  P  F       + K++  EG  +LY+G      R  P +   
Sbjct: 133 EIVLLPLDVLKIKRQTN-PEAFKGR---GFLKILKDEGIFNLYRGWGWTAARNAPGSFAL 188

Query: 191 FTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER 250
           F       E I       +   SQ      +F    +      +VS P DV+ +++ N  
Sbjct: 189 FGGNAFAKEYILGLQDYSQATWSQ------NFISSIVGASASLIVSAPLDVIKTRIQNRN 242

Query: 251 -KSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSF 297
             + ES  +         GF   + GL  ++L  G    F + +  S 
Sbjct: 243 FDNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQSL 290

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 77/182 (42%), Gaps = 12/182 (6%)

Query: 21  ACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           + T G L+  G     + PLD++K +RQ +   +K    G+ +I++ EG   ++ G G T
Sbjct: 122 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPEAFKGR--GFLKILKDEGIFNLYRGWGWT 177

Query: 81  AIGYSLQGAFK-YGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
           A   +  G+F  +GG  F K     L     A   +  I     ASA  I      P + 
Sbjct: 178 A-ARNAPGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVS---APLDV 233

Query: 140 IKVR-QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIV 198
           IK R Q      P   + F      +  EGF + +KG+TP      P  +  F   + ++
Sbjct: 234 IKTRIQNRNFDNP--ESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQSLI 291

Query: 199 EM 200
            M
Sbjct: 292 PM 293

>Kwal_47.18216
          Length = 333

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 118/306 (38%), Gaps = 58/306 (18%)

Query: 39  PLDLVKCRRQV------DASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKY 92
           PLD +K R Q+           +  +   R I   EG   ++ G+GA  IG   + A ++
Sbjct: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89

Query: 93  GGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTA----V 148
             YEFF+   + L   +T        F+A   +    A + + P E +K+R Q      V
Sbjct: 90  TSYEFFR---TLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYV 146

Query: 149 P----------------------------PPFARNVFDAYSKMVGAEGFASLYKGITPLW 180
           P                             P  RN   A   +V  EG  +LY+G++   
Sbjct: 147 PLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTA 206

Query: 181 FRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQI---SVSFAGGYLAGILCAVVSH 237
            RQ       FT        +Y+ L +  +E  Q   +     S   G ++G L    + 
Sbjct: 207 ARQATNQGANFT--------VYSTLKSRLQEYHQTDMLPSWETSLI-GLISGALGPFSNA 257

Query: 238 PADVMVSKVNNE----RKSGESTLQATSR-IYGKIGFPGLWNGLAVRILMIGTLTSFQWL 292
           P D + +++  +    + SG S + A  R +  + GF  L+ G+  R++ +    +  + 
Sbjct: 258 PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317

Query: 293 IYDSFK 298
           +Y+  +
Sbjct: 318 VYELIR 323

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 13/96 (13%)

Query: 22  CTLGGLV--ACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGW-------RQIVRSEGATK 72
            +L GL+  A GP  +A  PLD +K R Q D S  K +  GW       RQ++R EG   
Sbjct: 241 TSLIGLISGALGPFSNA--PLDTIKTRLQKDKSTSKDS--GWSRILAIGRQLIREEGFRA 296

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSP 108
           ++ G+    +  +   A  +  YE  + +   L +P
Sbjct: 297 LYKGITPRVMRVAPGQAVTFTVYELIRKKLEGLTAP 332

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 57/138 (41%), Gaps = 16/138 (11%)

Query: 112 HSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ----TAVPPPFARNVFDAYSKMVGAE 167
           +S    I L A  +A     +   P + IKVR Q           AR        +   E
Sbjct: 6   NSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQE 65

Query: 168 GFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISV--SFAGG 225
           GF +LYKG+  +    IP    +FTS+E    ++  R         Q G +S   +F  G
Sbjct: 66  GFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR---------QTGVVSTGNTFVAG 116

Query: 226 YLAGILCAV-VSHPADVM 242
             AGI  AV V +P +V+
Sbjct: 117 VGAGITEAVMVVNPMEVV 134

>Kwal_23.3965
          Length = 307

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 77/172 (44%), Gaps = 13/172 (7%)

Query: 130 ADIFLCPWEAIKVRQQTAVPPPFARN-VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTM 188
           A I   P + +K+R Q  +        +   + ++V  EG  +L+KG  P     I Y  
Sbjct: 28  ARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87

Query: 189 CKFTSFERIVEMI-YARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSK-V 246
            +FTS+  + +++  ++LP          QI     G  L+G   A+ S+P DV+ ++ +
Sbjct: 88  TQFTSYAILNKLLSKSQLP---------AQIHTGMVGA-LSGTCSAIASYPCDVLRTRFI 137

Query: 247 NNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
            N  +   + L     I+   GF G + G++  I+ I   TS     Y+S K
Sbjct: 138 ANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYESVK 189

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 84/214 (39%), Gaps = 29/214 (13%)

Query: 39  PLDLVKCRRQV---DASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGY 95
           PLD +K R Q+   + + Y   L  ++++VR EG   ++ G       Y L G+ ++  Y
Sbjct: 34  PLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY 93

Query: 96  EFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARN 155
                  S+   P   H   TG+  A S +   IA     P + ++ R        F  N
Sbjct: 94  AILNKLLSKSQLPAQIH---TGMVGALSGTCSAIASY---PCDVLRTR--------FIAN 139

Query: 156 VFDAYSKMVGA-------EGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTP 208
                S M+         EGF   +KG++         T     ++E  V++   + P  
Sbjct: 140 HSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYES-VKIFCEQRPDR 198

Query: 209 KREMSQLGQISVSFAGGYLAGILCAVVSHPADVM 242
              + QL + S S     +AGI+   +  P D +
Sbjct: 199 DSSVIQLLESSASV----IAGIVSKTIVFPIDTV 228

>Scas_669.6
          Length = 373

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 104/244 (42%), Gaps = 26/244 (10%)

Query: 22  CTLGGLVACGPTHSAVTPLDLVKCRRQVD--ASLYKSNLDGWRQIVRSEG-ATKVFTGVG 78
           C L G +      S++  LD VK R+Q       YK+    +R I   EG A  ++ G  
Sbjct: 54  CVLAGGIGGIIGDSSMHSLDTVKTRQQGAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYF 113

Query: 79  ATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWE 138
           A  +G     A  +G YE+ K +    +      S+     L+A    +F++     P E
Sbjct: 114 AAMLGSFPSAAIFFGTYEWCKRKMIGDLGFNDTVSH-----LSAGLLGDFVSSFVYVPSE 168

Query: 139 AIKVRQQTA--VPPPF------ARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
            +K R Q    V  PF       R++  A   +V  EG  +L+ G      R +P++  +
Sbjct: 169 VLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQ 228

Query: 191 FTSFERIVEMIYARLPTPKREMSQLGQISVSFAG----GYLAGILCAVVSHPADVMVSKV 246
           F  +E+  +  +      K E   + + ++S       G +AG L  +++ P DV+ +++
Sbjct: 229 FGFYEKFRQTAF------KLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRL 282

Query: 247 NNER 250
             ++
Sbjct: 283 QTQQ 286

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 110/275 (40%), Gaps = 30/275 (10%)

Query: 39  PLDLVKCRRQVDASLYKSNLDGWRQIVR---SEGATK----VFTGVGATAIGYSLQGAFK 91
           P+D +  R   + +   S  +  R I R   SE   K    +F G+G  A    LQ  +K
Sbjct: 30  PVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFPGLGYAASYKVLQRVYK 89

Query: 92  YGGYEF--------FKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVR 143
           YGG  F        +K  +  L   +T  + R+    AA+ S   I +I L P + +K++
Sbjct: 90  YGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRS----AAAGSLIGIGEIVLLPLDVLKIK 145

Query: 144 QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA 203
           +QT  P  F       + K++  EG  +LY+G      R  P +   F       E I  
Sbjct: 146 RQTN-PESFKGR---GFIKILRDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILG 201

Query: 204 RLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER-KSGESTLQATSR 262
                 ++ SQ    S +F    +      +VS P DV+ +++ N    + ES L+    
Sbjct: 202 L-----KDYSQ-ATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKN 255

Query: 263 IYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSF 297
                G    + GL  ++L  G    F + +  S 
Sbjct: 256 TLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSL 290

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 71/174 (40%), Gaps = 22/174 (12%)

Query: 25  GGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGY 84
           G L+  G     + PLD++K +RQ +   +K    G+ +I+R EG   ++ G G TA   
Sbjct: 126 GSLIGIGEI--VLLPLDVLKIKRQTNPESFKGR--GFIKILRDEGLFNLYRGWGWTA-AR 180

Query: 85  SLQGAFK-YGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVR 143
           +  G+F  +GG  F K     L     A   +  I     A +  I      P + IK R
Sbjct: 181 NAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVS---APLDVIKTR 237

Query: 144 QQTAVPPPFARNVFDAYSKM------VGAEGFASLYKGITPLWFRQIPYTMCKF 191
            Q        RN  +  S +      +  EG  + +KG+TP      P  +  F
Sbjct: 238 IQN-------RNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSF 284

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 65/300 (21%), Positives = 121/300 (40%), Gaps = 30/300 (10%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN--LDGWRQIVRSEGATKVFT----GV 77
           + GL A   T  +  PLDLVK R Q+ A+  K     D  ++IV+       F     G+
Sbjct: 13  ISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRETYRGL 72

Query: 78  GATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTG---------IFLAASASAEF 128
           G   +G S+     +G Y   K    Q  + +      T          ++L A+A +  
Sbjct: 73  GVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAAMSGV 132

Query: 129 IADIFLCPWEAIKVRQQTA--VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPY 186
              +   P   IK R  +   V     R+  D   K+   EG A  ++G+ P  F  +  
Sbjct: 133 ATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPSLF-GVSQ 191

Query: 187 TMCKFTSFERIVEMIYA-RLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSK 245
               FT ++ +    +A +    K+++S L  I+++     L+ ++     +P  ++ S 
Sbjct: 192 GAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITIT----SLSKMVSVTAVYPLQLLKSN 247

Query: 246 VNN-------ERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
           + +         K+     +  + IY + G  GL+ GL   ++     T   + +Y++F+
Sbjct: 248 LQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYENFR 307

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 86/201 (42%), Gaps = 14/201 (6%)

Query: 4   KSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQ----VDASLYKSNLD 59
            +++ N   + S  Y  A  + G+     T+    P+ ++K R      VD+  Y+S +D
Sbjct: 109 NNTMNNDKEMTSLMYLLAAAMSGVATSVLTN----PIWVIKTRIMSTSFVDSRSYRSTVD 164

Query: 60  GWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIF 119
           G +++ R EG    + G+  +  G S QGA  +  Y+  K+ Y      +         +
Sbjct: 165 GIKKLYRIEGLAGFWRGLVPSLFGVS-QGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEY 223

Query: 120 LAASASAEFIADIFLCPWEAIKVRQQ-----TAVPPPFARNVFDAYSKMVGAEGFASLYK 174
           +  ++ ++ ++   + P + +K   Q     T + P  +  V+   + +   +G   LYK
Sbjct: 224 ITITSLSKMVSVTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYK 283

Query: 175 GITPLWFRQIPYTMCKFTSFE 195
           G+     R +P T   F  +E
Sbjct: 284 GLLANLIRAVPSTCITFCVYE 304

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/323 (21%), Positives = 127/323 (39%), Gaps = 37/323 (11%)

Query: 1   MSQKSSILNSPT----LYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKS 56
           MS+ + +L  P+    +   +   A   GGL A   + + V+P + VK   QV  S    
Sbjct: 1   MSELAQVLPQPSYVKSILKNDSNVAFLAGGL-AGAVSRTVVSPFERVKILLQVQNSTTAY 59

Query: 57  N---LDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHS 113
           N   +   RQ+ R EG   +F G G   I      A ++  YE  K  +  +   +    
Sbjct: 60  NQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQ 119

Query: 114 YRTGIFLAASASAEFIADIFLCPWEAIKVRQ--QTAVPPPFARN----------VFDAYS 161
            +    L + A     + +   P + ++ R   QTA     +++          V+D   
Sbjct: 120 LQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLC 179

Query: 162 KMVGAEG-FASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPT-PKREMSQLGQIS 219
           +    EG    LY+G+ P     +PY    F  +E+  E     +P      ++   ++S
Sbjct: 180 RTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEF----MPEGTDNTLANFYKLS 235

Query: 220 VSFAGGYLAGILCAVVSHPADVMVSKVNNERKSG-------ESTLQATSRIYGKIGFPGL 272
           +    G L+G +   V++P D++  +       G       +S + A   I    GF G 
Sbjct: 236 I----GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291

Query: 273 WNGLAVRILMIGTLTSFQWLIYD 295
           + GL   +  +   T+  WL+Y+
Sbjct: 292 YKGLTANLFKVIPSTAVSWLVYE 314

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 83/197 (42%), Gaps = 24/197 (12%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVDAS----LYKSNLDG-------WRQIVRS---EGAT 71
           G +  G +  A  PLDLV+ R  +  +    L KS           W  + R+   EG  
Sbjct: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188

Query: 72  K-VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIA 130
           K ++ GV  T++G     A  +  YE FK    +      A+ Y+    L+  A +  +A
Sbjct: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYK----LSIGALSGGVA 244

Query: 131 DIFLCPWEAIKVRQQTAVPPPFA-----RNVFDAYSKMVGAEGFASLYKGITPLWFRQIP 185
                P++ ++ R Q             ++V DA   +   EGF   YKG+T   F+ IP
Sbjct: 245 QTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIP 304

Query: 186 YTMCKFTSFERIVEMIY 202
            T   +  +E + ++++
Sbjct: 305 STAVSWLVYEVVCDLMH 321

 Score = 34.7 bits (78), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 205 LPTPKREMSQLGQIS-VSFAGGYLAGILCAVVSHPAD---VMVSKVNNERKSGESTLQAT 260
           LP P    S L   S V+F  G LAG +   V  P +   +++   N+     +  + A 
Sbjct: 8   LPQPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAV 67

Query: 261 SRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
            ++Y + G PGL+ G  +  + I   ++ Q+++Y++ K
Sbjct: 68  RQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACK 105

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 111/264 (42%), Gaps = 24/264 (9%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATA-- 81
           L G  A   T     P+D +K R Q     +++   G+R + R  G+  V +  GA+   
Sbjct: 10  LSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFRNG--GYRGVYRGLGSAVVASAPGASLFF 67

Query: 82  IGYSLQGAFKYGGYEFFKHQY-SQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAI 140
           I Y    A   G   FF+    S  V+    H +       +S+  E  A +   P E +
Sbjct: 68  ITYDTCKAETRG---FFRGLLPSSNVADVVTHMF-------SSSMGEIAACMVRVPAEVV 117

Query: 141 KVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEM 200
           K R QT         + +      G     +LY+G +    R+IP+T  +F  +E  ++ 
Sbjct: 118 KQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYE-YMKK 176

Query: 201 IYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGE-STLQA 259
           ++A L    R     G +  S AGG     + A  + P D + +++   +KS    TL +
Sbjct: 177 VWAELDESDRVEPWKGAVCGSIAGG-----IAAATTTPLDFLKTRLMLCKKSIPLGTLVS 231

Query: 260 TSRIYGKIGFPGLWNGLAVRILMI 283
           T  IY + GF   ++G+  R + I
Sbjct: 232 T--IYKEEGFKVFFSGVGPRTMWI 253

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 37/94 (39%), Gaps = 14/94 (14%)

Query: 8   LNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVK-----CRRQVDASLYKSNLDGWR 62
           L+      P   A C   G +A G   +  TPLD +K     C++ +      S      
Sbjct: 181 LDESDRVEPWKGAVC---GSIAGGIAAATTTPLDFLKTRLMLCKKSIPLGTLVST----- 232

Query: 63  QIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
            I + EG    F+GVG   +  S  GA   G YE
Sbjct: 233 -IYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYE 265

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 89/223 (39%), Gaps = 28/223 (12%)

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEF--------FKHQYSQLVSPETAHSYRTGIFLAASA 124
           +F G+G  A    LQ  +KYGG  F        FK  + Q    +T  + R+    A + 
Sbjct: 71  LFPGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRS----ATAG 126

Query: 125 SAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQI 184
           S   I +I L P + +K+++QT  P  F       + K++  EGF  LY+G      R  
Sbjct: 127 SLIGIGEIVLLPLDVLKIKRQTN-PESFKGR---GFLKIIKDEGFG-LYRGWGWTAARNA 181

Query: 185 PYTMCKFTSFERIVEMIYARLPTPKREMSQLGQI--SVSFAGGYLAGILCAVVSHPADVM 242
           P +   F       E I          +   GQ   S +F    +      +VS P DV+
Sbjct: 182 PGSFALFGGNAFAKEYILG--------LKDYGQATWSQNFVSSIVGASASLIVSAPLDVI 233

Query: 243 VSKVNNER-KSGESTLQATSRIYGKIGFPGLWNGLAVRILMIG 284
            +++ N    + ES  +         GF   + GL  ++L  G
Sbjct: 234 KTRIQNRNFDNPESGFKIIKNTLKNEGFTAFFKGLTPKLLTTG 276

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 73/173 (42%), Gaps = 13/173 (7%)

Query: 21  ACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           + T G L+  G     + PLD++K +RQ +   +K    G+ +I++ EG   ++ G G T
Sbjct: 122 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPESFKGR--GFLKIIKDEGFG-LYRGWGWT 176

Query: 81  AIGYSLQGAFK-YGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
           A   +  G+F  +GG  F K     L     A   +  +     ASA  I      P + 
Sbjct: 177 A-ARNAPGSFALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVS---APLDV 232

Query: 140 IKVR-QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKF 191
           IK R Q      P   + F      +  EGF + +KG+TP      P  +  F
Sbjct: 233 IKTRIQNRNFDNP--ESGFKIIKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSF 283

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 119/271 (43%), Gaps = 27/271 (9%)

Query: 39  PLDLVKCRRQVD-ASLYKSNLDGWRQIVRSEGATKVF-TGVGATAIGYSLQGAFKYGGYE 96
           P D VK R Q   A LY +     R     EG  K F  G+ +   G +L+ A  +  + 
Sbjct: 27  PFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQGIASPLFGAALENAVLFVSFN 86

Query: 97  ---FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTA-VPPPF 152
               F  +++QL  P T   Y +G F  A A A FI    L P E +K + Q + +    
Sbjct: 87  QCTNFLDEFTQL-KPLTKTIY-SGAF--AGACASFI----LTPVELVKCKLQVSNISNSL 138

Query: 153 AR-----NVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPT 207
           ++     +V+     ++  +G   L++G    + R+       FT++E I++M +A L  
Sbjct: 139 SQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYE-IMKMKFASLHP 197

Query: 208 PKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSRIYGKI 267
            ++E +   ++ VS   G  AG+L      PAD + S    E  S  + L+   R +G  
Sbjct: 198 AEKE-NHTWELLVS---GASAGVLFNASVFPADTVKSVCQTEHVSIVNALKKVLRTHGIT 253

Query: 268 GFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
           GF   + GL + ++      +  +  Y++ K
Sbjct: 254 GF---YRGLGITLIRAAPANATVFYTYETLK 281

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 83/199 (41%), Gaps = 25/199 (12%)

Query: 10  SPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQV--------DASLYKSNLDGW 61
           + T+YS  +  AC              +TP++LVKC+ QV          + + S     
Sbjct: 102 TKTIYSGAFAGACA----------SFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTI 151

Query: 62  RQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLA 121
           + +++ +G   ++ G  +T +   L GA  +  YE  K +++ L   E  +     +   
Sbjct: 152 KSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSG 211

Query: 122 ASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWF 181
           ASA   F A +F  P + +K   QT        ++ +A  K++   G    Y+G+     
Sbjct: 212 ASAGVLFNASVF--PADTVKSVCQTE-----HVSIVNALKKVLRTHGITGFYRGLGITLI 264

Query: 182 RQIPYTMCKFTSFERIVEM 200
           R  P     F ++E + +M
Sbjct: 265 RAAPANATVFYTYETLKKM 283

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 155 NVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQ 214
           N+F    +MV   GF + ++G  P  FRQ+  +  +FT++  + +MI     +P + +S+
Sbjct: 192 NIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMI-----SPNKPLSE 246

Query: 215 LGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSG--ESTLQATSRIYGKIGFPGL 272
                 +F  G  +      ++ P DV+ +++ ++       ++L    R + + G   L
Sbjct: 247 Y----YAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSL 302

Query: 273 WNGLAVRILMIG 284
           W G   R+  +G
Sbjct: 303 WKGWVPRLFKVG 314

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 48/121 (39%), Gaps = 6/121 (4%)

Query: 62  RQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLA 121
           R++V++ G T  F G   T        A ++  Y   K    Q++SP    S      + 
Sbjct: 198 REMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLK----QMISPNKPLSEYYAFGIG 253

Query: 122 ASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWF 181
             +S   +A     P + +K R Q+       RN  +   +    EG  SL+KG  P  F
Sbjct: 254 VFSSCAVVA--LTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLF 311

Query: 182 R 182
           +
Sbjct: 312 K 312

 Score = 31.2 bits (69), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 10  SPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDA--SLYKSNLDGWRQIVRS 67
           SP     EYYA   +G   +C    +   P+D+VK R Q     SLY+++L+   +    
Sbjct: 239 SPNKPLSEYYA-FGIGVFSSCAVV-ALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIE 296

Query: 68  EGATKVFTGVGATAIGYSLQGAFKYGGYEF 97
           EG T ++ G         L G   +G Y++
Sbjct: 297 EGLTSLWKGWVPRLFKVGLSGGVSFGVYQY 326

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 121/281 (43%), Gaps = 36/281 (12%)

Query: 25  GGLVACGPTHSAVTPLDLVKCRRQVD-------ASLYKSNLDGWRQIVRSEGATKVFTGV 77
           GGL AC    +   P++L+K R Q+        A +YK+ + G   I ++EG   +  G+
Sbjct: 29  GGLAACIAV-TVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGL 87

Query: 78  GATAI-GYSLQGAFKYGGYEFFKHQYSQLVSPETA-HSYRT-GIFLAASASAEFIADIFL 134
            A  I    L G+ + G YE  +   +QL  P+   H  ++ G+ + + A++  I  +  
Sbjct: 88  NAAYIYQIGLNGS-RLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIG 146

Query: 135 CPWEAIKVRQQTAVPPPFAR--------NVFDAYSKMVGAEGFASLYKGITPLWFRQIPY 186
            P   +K R Q+     F +         V++    +   EG   L++GI     R    
Sbjct: 147 SPLFLVKTRLQSY--SEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204

Query: 187 TMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKV 246
           +  +   +        A+    K ++ + G  ++      ++G+  AVV +P DV+++++
Sbjct: 205 SSVQLPIYNT------AKNILVKNDLMKDGP-ALHLTASTISGLGVAVVMNPWDVILTRI 257

Query: 247 NNER----KSGESTLQATSRIYGKIGFPGLWNGLAVRILMI 283
            N++    K     L  T RI    G   L+ G A ++  I
Sbjct: 258 YNQKGDLYKGPIDCLVKTVRIE---GVTALYKGFAAQVFRI 295

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 83/195 (42%), Gaps = 15/195 (7%)

Query: 117 GIFLAASASAEFIADIFLCPWEAIKVRQQ-----TAVPPPFARNVFDAYSKMVGAEGFAS 171
           G F+A   +A  IA     P E IK+R Q     +A      +N     + +   EG   
Sbjct: 24  GSFVAGGLAA-CIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKG 82

Query: 172 LYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGIL 231
           L KG+   +  QI     +   +E I   +  +L  P +E  ++  + V+   G  +GI+
Sbjct: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIRSSL-NQLFFPDQEPHKVQSVGVNVFSGAASGII 141

Query: 232 CAVVSHPADVMVSKVNNER---KSGESTL-----QATSRIYGKIGFPGLWNGLAVRILMI 283
            AV+  P  ++ +++ +     K GE T           I+   G  GL+ G+   IL  
Sbjct: 142 GAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRT 201

Query: 284 GTLTSFQWLIYDSFK 298
           G  +S Q  IY++ K
Sbjct: 202 GAGSSVQLPIYNTAK 216

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 72/178 (40%), Gaps = 21/178 (11%)

Query: 38  TPLDLVKCRRQV--------DASLYKSNLDGWRQIVRSEGATKVFTGVGA----TAIGYS 85
           +PL LVK R Q         + + Y    +G   I ++EG   +F G+ A    T  G S
Sbjct: 147 SPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206

Query: 86  LQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ 145
           +Q          +    + LV  +        + L AS  +     + + PW+ I  R  
Sbjct: 207 VQ-------LPIYNTAKNILVKNDLMKD-GPALHLTASTISGLGVAVVMNPWDVILTRIY 258

Query: 146 TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA 203
                 + +   D   K V  EG  +LYKG     FR  P+T+   T  E+ ++++Y+
Sbjct: 259 NQKGDLY-KGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYS 315

>Scas_589.10
          Length = 316

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 74/162 (45%), Gaps = 19/162 (11%)

Query: 132 IFLCPWEAIKVRQQ------------TAVPP-PFARNVFDAYSKMVGAEGFASLYKGITP 178
           I + P + +K R Q             AVP  P   ++    SK++  EGF +LYKG++P
Sbjct: 29  IMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEEGFKNLYKGMSP 88

Query: 179 LWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHP 238
               ++P    KF S E+  +++  +     +E++     +V+   G  AGI  +++  P
Sbjct: 89  PLLMEVPKRAVKFASNEQFQQIMMKKFKL--KEVTS----TVTLLAGTFAGITESLIVVP 142

Query: 239 ADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRI 280
            +++  ++ + +    S ++ T  I    G  G++ G    I
Sbjct: 143 FELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTI 184

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/274 (20%), Positives = 105/274 (38%), Gaps = 32/274 (11%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASL---------------YKSNLDGWRQIVRSE 68
           + G VA       + PLD+VK R Q+  +                + S L    +I++ E
Sbjct: 18  ISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEE 77

Query: 69  GATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEF 128
           G   ++ G+    +    + A K+   E F+    +    +   S  T   L A   A  
Sbjct: 78  GFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVT---LLAGTFAGI 134

Query: 129 IADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTM 188
              + + P+E +K+R Q A      R+       ++  +G   +Y G     +R   +  
Sbjct: 135 TESLIVVPFELVKIRLQDAQSD--YRSPIRCTRTIIENQGLFGIYAGFESTIWRNTIWNA 192

Query: 189 CKFTSFERIVEMIYARLPTPK-REMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVN 247
             F    ++ + I      P+ +  ++   I   F  G +AG +   +S P DV+ +++ 
Sbjct: 193 SYFGLIFQVKKFI------PRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQ 246

Query: 248 NERKSGESTL-----QATSRIYGKIGFPGLWNGL 276
             +K+          Q+   IY   G  G++ G+
Sbjct: 247 GSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGI 280

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 69/177 (38%), Gaps = 14/177 (7%)

Query: 17  EYYAACTLGGLVACGPTHS-AVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFT 75
           E  +  TL      G T S  V P +LVK R Q   S Y+S +   R I+ ++G   ++ 
Sbjct: 119 EVTSTVTLLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYA 178

Query: 76  GVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLC 135
           G  +T    ++  A  +G     K    +  S       R    + A A    ++     
Sbjct: 179 GFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGC--MSCFLSV 236

Query: 136 PWEAIKVRQQTAVPPPFA-------RNVFDAYSKMVGAEGFASLYKGITPLWFRQIP 185
           P++ +K R Q +             ++VF  Y      EG   +YKGI P+  R  P
Sbjct: 237 PFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYR----TEGIKGIYKGILPIICRYGP 289

>Kwal_55.21335
          Length = 317

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 82/190 (43%), Gaps = 29/190 (15%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG--------W---RQIVRSEGATK 72
           L G  A   T   +TP++L+KC  QV      SNL+G        W   + IV+ +G   
Sbjct: 144 LSGAFAGACTSYVLTPVELIKCTLQV------SNLEGATTRHSKIWPTVKHIVQHKGIGG 197

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASA--EFIA 130
           ++ G  +T I     GA  +  YE  K   ++  +    H++     LA+ ASA   F A
Sbjct: 198 LWQGQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWE---LLASGASAGVAFNA 254

Query: 131 DIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
            IF  P + IK   QT         + DA  +++   G A LY+G+     R  P     
Sbjct: 255 SIF--PADTIKSTAQTQ-----HLGIVDATKRILARSGPAGLYRGLGITLIRAAPANAIV 307

Query: 191 FTSFERIVEM 200
           F ++E +  +
Sbjct: 308 FYTYETLSNL 317

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 122/287 (42%), Gaps = 47/287 (16%)

Query: 20  AACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSE----GATKV-- 73
           AA  +GG+ A    H    P DLVK R Q + +  +S +D    I+++     G T +  
Sbjct: 33  AAGGVGGVCAVLTGH----PFDLVKVRCQSNQA--RSAMDAVSHILQAARQAAGPTSLNA 86

Query: 74  ----FTGVGATAIGYSLQGAFKYGGYEFFKHQYSQL----------VSPETAHSYRTGIF 119
               + GV    +G +   A  + GY+  K   + +          V PE        + 
Sbjct: 87  VRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPE--------LT 138

Query: 120 LAASASAEFIADI----FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKG 175
           L+  A+A FI+ I       P E +KV  QT        +  DA  ++V  +GF SL+KG
Sbjct: 139 LSQMAAAGFISAIPTTLVTAPTERVKVVLQTT---QGKASFLDAAKQIVRTQGFQSLFKG 195

Query: 176 ITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVV 235
                 R  P +   F S+E   E +         E+S     +V  +GG +AG+   VV
Sbjct: 196 SLATLSRDGPGSALYFASYEICKEYLNKASGHTSGELS---ITNVCISGG-MAGVSMWVV 251

Query: 236 SHPADVMVSKVNNERKSGESTLQATSRIYG-KIGFPGLWNGLAVRIL 281
             P D + +++ +  K  +S L+ T  IY  + G  G + G+   IL
Sbjct: 252 VFPIDTVKTQLQSSSKR-QSMLEVTRMIYNTRGGIKGFFPGVGPAIL 297

>Kwal_23.4354
          Length = 343

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/247 (20%), Positives = 102/247 (41%), Gaps = 22/247 (8%)

Query: 54  YKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHS 113
           Y S  D + +I + EG   ++ G+  T +  +      + GYE  + + S+L        
Sbjct: 84  YNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRDK-SRL-----QDK 137

Query: 114 YRTGIFLAASASAEFIADIFLCPWEAIKVRQQT-------AVPPPFARNVFDAYSKMVGA 166
           Y T   L   A A  +A   + P E  + R Q+       +      +++       +  
Sbjct: 138 YPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISK 197

Query: 167 EGFASLYKGITPLWFRQIPYTMCKFTSFE--RIVEMIYARLPTPKREMSQLGQISVSFAG 224
            G+ +L++G+    +R +P++   +  +E  +    I +         S       SF G
Sbjct: 198 VGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVG 257

Query: 225 GYLAGILCAVVSHPADV-----MVSKVNN--ERKSGESTLQATSRIYGKIGFPGLWNGLA 277
           G   G + AV++HP DV      ++ +N+  E+K  ++  +  +++    G   L+ GL 
Sbjct: 258 GSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYTGLV 317

Query: 278 VRILMIG 284
            R++ I 
Sbjct: 318 PRVIKIA 324

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 72/180 (40%), Gaps = 19/180 (10%)

Query: 35  SAVTPLDLVKCRRQ---------VDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYS 85
           + V PL+L + R Q           A + K  +   R  +   G   +F G+  T     
Sbjct: 156 TTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKALFRGLEITLWRDV 215

Query: 86  LQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGI--FLAASASAEF---IADIFLCPWEAI 140
              +  +G YEF+K   S        +S  +    F+ +     F   +A +   P++  
Sbjct: 216 PFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVG 275

Query: 141 KVRQQ-----TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195
           K R Q     + +    ++N+F   ++M  +EG A+LY G+ P   +  P      +++E
Sbjct: 276 KTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYE 335

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 108/295 (36%), Gaps = 27/295 (9%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN---LDGWRQIVRSEGATKVFTGVGAT 80
           L G VA   + + V+P + VK   QV +S    N       RQ+   EG   +F G G  
Sbjct: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86

Query: 81  AIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAI 140
            I      A ++  YE  K +   +              L + A     + +   P + I
Sbjct: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146

Query: 141 KVRQ--QTAVPPPFARNVFDAYSKMVG-----------AEGFASLYKGITPLWFRQIPYT 187
           K R   QTA      R+   + SK  G             G   LY+G+ P     +PY 
Sbjct: 147 KTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGVVPYV 206

Query: 188 MCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVN 247
              F  +E++ E             S L ++++    G ++G +   +++P D++  +  
Sbjct: 207 ALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI----GAISGGVAQTITYPFDLLRRRFQ 262

Query: 248 NERKSGE-------STLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
                G        S   A   I    G  G + GLA  +  +   T+  WL+Y+
Sbjct: 263 VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 84/197 (42%), Gaps = 23/197 (11%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVD----ASLYKSNLDG-------WR---QIVRSEGAT 71
           G +  G +  A  PLDL+K R  +     +SL +S           W+   +  R EG  
Sbjct: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGL 188

Query: 72  K-VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIF-LAASASAEFI 129
           + ++ GV  T++G     A  +  YE  +     + S +   S+++ ++ L   A +  +
Sbjct: 189 RGLYRGVWPTSLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLTIGAISGGV 246

Query: 130 ADIFLCPWEAIKVRQQTAVPPPFA-----RNVFDAYSKMVGAEGFASLYKGITPLWFRQI 184
           A     P++ ++ R Q              +V+DA   +  AEG +  YKG+    F+ +
Sbjct: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306

Query: 185 PYTMCKFTSFERIVEMI 201
           P T   +  +E + + +
Sbjct: 307 PSTAVSWLVYEVVCDSV 323

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/298 (20%), Positives = 110/298 (36%), Gaps = 33/298 (11%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN---LDGWRQIVRSEGATKVFTGVGAT 80
           L G +A   + + V+P + VK   QV +S    N    D   Q+ + E    +F G G  
Sbjct: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87

Query: 81  AIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAI 140
            I      A ++  +E  K     + +            L + A     + +   P + +
Sbjct: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147

Query: 141 KVR----------------QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQI 184
           + R                   A PP   + +  AY++  G  G   LY+G+ P     +
Sbjct: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMG---LYRGVWPTSLGIV 204

Query: 185 PYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVS 244
           PY    F  +E++ E     +P+ +   S +       + G ++G +   +++P D++  
Sbjct: 205 PYVALNFAVYEQLKEF----MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRR 260

Query: 245 KVNNERKSGE-------STLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
           +       G        S   A   I    GF G + GL   +  +   T+  WL+Y+
Sbjct: 261 RFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318

>Scas_562.12
          Length = 300

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 114/286 (39%), Gaps = 30/286 (10%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVR---SEGATK----VFTGVG 78
           G++  G  H    P+D +  R   + +   ++ +  R I R   SE   K    +F G+G
Sbjct: 21  GILEIGVFH----PVDTISKRLMSNHTKIGNSHELNRVIFREHFSEPLGKRLFTLFPGLG 76

Query: 79  ATAIGYSLQGAFKYGGY----EFFKHQYSQLVSPETAHSYRTGIFLAASASAEF--IADI 132
             A    LQ  +KYGG     EF    Y +    ++A   +TG  + ++ +     I +I
Sbjct: 77  YAASYKVLQRVYKYGGQPFANEFLNKHYKK--DFDSAFGEKTGKAMRSATAGSLIGIGEI 134

Query: 133 FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFT 192
            L P + +K+++QT  P  F       + K++  EG  +LY+G      R  P +   F 
Sbjct: 135 VLLPLDVLKIKRQTN-PEAFKGR---GFVKILKDEGIFNLYRGWGWTAARNAPGSFALFG 190

Query: 193 SFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER-K 251
                 E I       +   SQ      +F    +      +VS P DV+ +++ N    
Sbjct: 191 GNAFAKEYILGLEDYSQASWSQ------NFISSIVGASCSLIVSAPLDVIKTRIQNRSFD 244

Query: 252 SGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSF 297
           + E+ L      +   G    + GL  ++L  G    F + +  S 
Sbjct: 245 NPETGLTIVKNTFKNEGITAFFKGLTPKLLTTGPKLVFSFALAQSL 290

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 72/178 (40%), Gaps = 22/178 (12%)

Query: 21  ACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           + T G L+  G     + PLD++K +RQ +   +K    G+ +I++ EG   ++ G G T
Sbjct: 122 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPEAFKGR--GFVKILKDEGIFNLYRGWGWT 177

Query: 81  AIGYSLQGAFK-YGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
           A   +  G+F  +GG  F K     L     A   +  I     AS   I      P + 
Sbjct: 178 A-ARNAPGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVS---APLDV 233

Query: 140 IKVR-QQTAVPPP-----FARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKF 191
           IK R Q  +   P       +N F         EG  + +KG+TP      P  +  F
Sbjct: 234 IKTRIQNRSFDNPETGLTIVKNTFK-------NEGITAFFKGLTPKLLTTGPKLVFSF 284

>Kwal_14.2210
          Length = 315

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 116/302 (38%), Gaps = 45/302 (14%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWR---QIVRSEGATKVFTGVGATAI 82
           G +A   + + V+P + VK   QV +S +  N   +R   Q+   EG   +  G G   I
Sbjct: 24  GGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNCI 83

Query: 83  GYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKV 142
                 A ++  YEF K Q+ Q        ++   +  A       +A     P + ++ 
Sbjct: 84  RIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATY---PLDLVRT 140

Query: 143 RQ--QTA--------------VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPY 186
           R   QTA               PP     +   Y++  G  G   LY+G+ P     +PY
Sbjct: 141 RLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFG---LYRGVWPTSIGVVPY 197

Query: 187 TMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVM---- 242
               F  +E++ E I A        + +L       + G ++G +   +++P D++    
Sbjct: 198 VALNFAVYEQLREYIPASFDPASASLYKL-------SIGAISGGVAQTITYPFDLLRRRF 250

Query: 243 ------VSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDS 296
                  S++    KS    L    R     GF G + GL   +  +   T+  W++Y++
Sbjct: 251 QVLAMGQSELGFHYKSVPDALITIGRTE---GFKGYYKGLTANLFKVVPSTAVSWVVYET 307

Query: 297 FK 298
            +
Sbjct: 308 VR 309

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 78/194 (40%), Gaps = 24/194 (12%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVD-ASLYKSNLDG----------W---RQIVRSEG 69
           + G +  G +  A  PLDLV+ R  +  A+L + +             W   R+    EG
Sbjct: 119 VSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEG 178

Query: 70  AT-KVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEF 128
               ++ GV  T+IG     A  +  YE  +        P +A  Y+    L+  A +  
Sbjct: 179 GIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYK----LSIGAISGG 234

Query: 129 IADIFLCPWEAIKVRQQTAVPPP-----FARNVFDAYSKMVGAEGFASLYKGITPLWFRQ 183
           +A     P++ ++ R Q             ++V DA   +   EGF   YKG+T   F+ 
Sbjct: 235 VAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKV 294

Query: 184 IPYTMCKFTSFERI 197
           +P T   +  +E +
Sbjct: 295 VPSTAVSWVVYETV 308

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/294 (21%), Positives = 126/294 (42%), Gaps = 39/294 (13%)

Query: 21  ACTLGGLVACGPTHSAVTPLDLVKCR--------RQVDASLYKSNLDGWRQIVRSEGATK 72
           A  L G+V C        PLD+ K R        R  +   Y+ ++     IVR EG   
Sbjct: 78  AGLLSGIVVC--------PLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRG 129

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADI 132
           ++ G+    +GY       +  YEF K     L +  +  S+ +  F A +A A  ++ +
Sbjct: 130 LYKGLVPIIMGYFPTWMIYFSVYEFCK---DNLRTNSSNWSFVSHSFSAITAGA--VSTV 184

Query: 133 FLCPWEAIKVRQ--QTAV--PPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTM 188
              P   +K R   QT +       +  +DA+ K++  EG  +LY G+ P     + +  
Sbjct: 185 VTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLL-GLLHVA 243

Query: 189 CKFTSFERIVEMI--YARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKV 246
             F  +ER+      Y R  +       L ++ ++ +   ++ ++ +V+S+P +++ +++
Sbjct: 244 IHFPVYERLKVSFKCYQRDESSNESKINLKRLILASS---VSKMVASVLSYPHEILRTRL 300

Query: 247 N--NERKSGESTLQATSRI-YGKIGFPGLWNGLAVRILMIG-----TLTSFQWL 292
              ++  S +  L    +I Y + G  G ++G    +         TL SF+++
Sbjct: 301 QLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYV 354

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 73/177 (41%), Gaps = 15/177 (8%)

Query: 38  TPLDLVKCRRQVDASLYKSNLDGW--RQIV---RSEGATKVFTGVGATAIGYSLQGAFKY 92
           +PL LVK R Q  A      L G   R++V   +  G   ++ GV A  +   +  A + 
Sbjct: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195

Query: 93  GGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPF 152
             Y   K   S+ V    A      ++  ASA +     I + P++    R        +
Sbjct: 196 AVYSHAKEALSRHVPDGMA------LYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLY 249

Query: 153 ARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE---RIVEMIYARLP 206
            R   D   K V  EGF++LYKG      R  P+T+   T  E   R+V ++  RLP
Sbjct: 250 -RGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENRLP 305

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 78/190 (41%), Gaps = 14/190 (7%)

Query: 122 ASASAEFIADIFLCPWEAIKVRQQ-----TAVPPPFARNVFDAYSKMVGAEGFASLYKGI 176
           A   A  IA     P E +K+R Q      A       N F A   +   EG   L KG+
Sbjct: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83

Query: 177 TPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVS 236
              +  QI     +   +E I   +  +   P +E  ++  + ++   G  +GI+ AV+ 
Sbjct: 84  VAAYIYQIALNGSRLGFYEPI-RAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMG 142

Query: 237 HPADVMVSKV---NNERKSGESTL-----QATSRIYGKIGFPGLWNGLAVRILMIGTLTS 288
            P  ++ +++   +N  K GE T           IY   G  GL+ G+   IL  G  +S
Sbjct: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202

Query: 289 FQWLIYDSFK 298
            Q  IY++ K
Sbjct: 203 VQLPIYNTAK 212

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 69/178 (38%), Gaps = 21/178 (11%)

Query: 38  TPLDLVKCRRQV--------DASLYKSNLDGWRQIVRSEGATKVFTGVGA----TAIGYS 85
           +PL LVK R Q         + + Y    +G + I  +EG   +F G+ A    T  G S
Sbjct: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202

Query: 86  LQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ 145
           +Q         F          P         + L AS  +     + + PW+ I  R  
Sbjct: 203 VQLPIYNTAKNFLLRNDIMEDGPS--------LHLTASTISGLGVAVVMNPWDVILTRIY 254

Query: 146 TAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA 203
                 + +   D   K V  EG  +LYKG     FR  P+T+   T  E+ +++++A
Sbjct: 255 NQKGDLY-KGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHA 311

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 116/285 (40%), Gaps = 30/285 (10%)

Query: 19  YAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN-------LDGWRQIVRSEGAT 71
           + + T GGL AC    +   P+++VK R Q+   L  +N             + R+EG  
Sbjct: 19  FGSFTAGGLAACIAV-TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIR 77

Query: 72  KVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPE-TAHSYRT-GIFLAASASAEFI 129
            +  G+ A  I        + G YE  +   ++   P+  +H  ++ GI + A A++  I
Sbjct: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137

Query: 130 ADIFLCPWEAIKVRQQT---AVP---PPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQ 183
             +   P   +K R Q+   A+          V++    +   EG   L++GI     R 
Sbjct: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRT 197

Query: 184 IPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMV 243
              +  +   +      +       + ++ + G  S+      ++G+  AVV +P DV++
Sbjct: 198 GAGSSVQLPIYNTAKNFLL------RNDIMEDGP-SLHLTASTISGLGVAVVMNPWDVIL 250

Query: 244 SKVNNER----KSGESTLQATSRIYGKIGFPGLWNGLAVRILMIG 284
           +++ N++    K     L  T +I    G   L+ G   ++  IG
Sbjct: 251 TRIYNQKGDLYKGPIDCLVKTVKIE---GITALYKGFEAQVFRIG 292

>Kwal_55.20868
          Length = 380

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 83/193 (43%), Gaps = 19/193 (9%)

Query: 116 TGIFLAASASAEFIADIFLCPWEAIKVRQQT----AVPPPFARNVFDAYSKMVGAEGFAS 171
           T I   + A A F+A + +CP +  K R Q     + P  + + +    + ++  EG   
Sbjct: 75  TEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARG 134

Query: 172 LYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGIL 231
           LYKG+ P+     P  M  F+ +ER  + +Y R+            IS S A    AG +
Sbjct: 135 LYKGLVPIIMGYFPTWMIYFSVYER-SKKLYPRI------FPSFDFISHS-ASALTAGTV 186

Query: 232 CAVVSHPADVMVSK------VNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGT 285
             ++++P  V+ ++      VN       ST  A  ++Y   G    + GL   +L +  
Sbjct: 187 STILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLFH 246

Query: 286 LTSFQWLIYDSFK 298
           + +  + IY+  K
Sbjct: 247 V-AIHFPIYEKLK 258

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 109/268 (40%), Gaps = 34/268 (12%)

Query: 37  VTPLDLVKCRRQVD------ASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAF 90
           V PLD+ K R Q        ++ YK  L     I+R EGA  ++ G+    +GY      
Sbjct: 93  VCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGLVPIIMGYFPTWMI 152

Query: 91  KYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASAS---AEFIADIFLCPWEAIKVR--QQ 145
            +  YE  K  Y ++        + +  F++ SAS   A  ++ I   P   +K R   Q
Sbjct: 153 YFSVYERSKKLYPRI--------FPSFDFISHSASALTAGTVSTILTNPVWVVKTRLMLQ 204

Query: 146 TAVPPPFAR--NVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA 203
           T V        + FDA+ KM   EG  + Y G+ P     + +    F  +E++   ++ 
Sbjct: 205 THVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLL-GLFHVAIHFPIYEKLKVWLHC 263

Query: 204 RLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGE--STLQATS 261
                + E   L    +  A    + ++ + +++P +++ +++  +    +  + LQ TS
Sbjct: 264 TPSMSRTEDHNLNLARLIIASS-ASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTS 322

Query: 262 R---------IYGKIGFPGLWNGLAVRI 280
           R          Y   G  G ++G    +
Sbjct: 323 RHGLIRLIKHTYKSEGLRGFYSGFTANL 350

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/166 (20%), Positives = 63/166 (37%), Gaps = 14/166 (8%)

Query: 42  LVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFK-- 99
           +++     +++ Y S  D + ++  +EG    + G+  + +G     A  +  YE  K  
Sbjct: 202 MLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGL-FHVAIHFPIYEKLKVW 260

Query: 100 -HQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPP--PFA--- 153
            H    +   E  H+      + AS++++ +A     P E ++ R Q    P  P A   
Sbjct: 261 LHCTPSMSRTED-HNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQ 319

Query: 154 ----RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195
                 +         +EG    Y G T    R +P +     SFE
Sbjct: 320 KTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFE 365

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/294 (20%), Positives = 104/294 (35%), Gaps = 48/294 (16%)

Query: 34  HSAVTPLDLVKCRRQVDASL--------------------YKSNLDGWRQIVRSEGATKV 73
           HS + P+D +K R Q  + +                      + L    +I  +EG+  +
Sbjct: 35  HSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQISRISSTEGSLAL 94

Query: 74  FTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIF 133
           + GV +  +G     A  +  YEF K Q        T    +T +   +  +A   AD  
Sbjct: 95  WRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAV---SGVAATVAADAL 151

Query: 134 LCPWEAIKVR---QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
           + P++ IK R   Q  +      R  F+ Y      EG  + +          IP+    
Sbjct: 152 MNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKN----EGPMAFFYSYPTTLAMNIPFAALN 207

Query: 191 FTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVN--- 247
           F  +E   +        P    +      +    G +AG  CA V+ P D + + +    
Sbjct: 208 FVIYESSTKFF-----NPTNAYNPW----IHCLCGGIAGATCAAVTTPLDCIKTVLQIRG 258

Query: 248 ------NERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
                    K+  +  +A   I+   G+ G W GL  R++     T+  W  Y+
Sbjct: 259 SDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAISWTSYE 312

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 106/275 (38%), Gaps = 35/275 (12%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGA----TKVFT---GVG 78
           G++  G  H    P+D +  R   + +   S+      I R   A     +VFT   G+G
Sbjct: 20  GILEIGVFH----PVDTISKRLMSNHTKIGSSSQLNSVIFREHAAEPLSKRVFTLFPGLG 75

Query: 79  ATAIGYSLQGAFKYGGYEF--------FKHQYSQLVSPETAHSYRTGIFLAASASAEFIA 130
             A    LQ  +KYGG  F        FK  +      +T  + R+    A + S   I 
Sbjct: 76  YAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKALRS----ATAGSMIGIG 131

Query: 131 DIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
           +I L P + +K+++QT  P  F       + K++  EG   LY+G      R  P +   
Sbjct: 132 EIVLLPLDVLKIKRQTN-PEAFKGR---GFVKILKDEGLG-LYRGWGWTAARNAPGSFAL 186

Query: 191 FTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER 250
           F       E I       +   SQ      +F    +      ++S P DV+ +++ N+ 
Sbjct: 187 FGGNAFAKEYILGLKDYSQATWSQ------NFVSSIVGASASLIISAPLDVIKTRIQNKN 240

Query: 251 -KSGESTLQATSRIYGKIGFPGLWNGLAVRILMIG 284
            ++ ES            GF   + GL  ++L  G
Sbjct: 241 FENPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTG 275

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 13/173 (7%)

Query: 21  ACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           + T G ++  G     + PLD++K +RQ +   +K    G+ +I++ EG   ++ G G T
Sbjct: 121 SATAGSMIGIGEI--VLLPLDVLKIKRQTNPEAFKGR--GFVKILKDEG-LGLYRGWGWT 175

Query: 81  AIGYSLQGAFK-YGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
           A   +  G+F  +GG  F K     L     A   +  +     ASA  I      P + 
Sbjct: 176 A-ARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIIS---APLDV 231

Query: 140 IKVR-QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKF 191
           IK R Q      P   + F      +  EGF++ +KG+TP      P  +  F
Sbjct: 232 IKTRIQNKNFENP--ESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGPKLVFSF 282

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 83/202 (41%), Gaps = 27/202 (13%)

Query: 15  SPEYYAACTLGGLVACGPTHS-AVTPLDLVKCRRQVDASLYKSNL-DGWRQIVRSEGATK 72
           SP+ Y+ C +G L   G T S A  P D+++ R   ++      L D    I   EG   
Sbjct: 105 SPQLYS-CLVGSL--AGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMG 161

Query: 73  VFTGVGATAIGYSLQGAFKYGGYE---FFKHQYSQLVSPETAHSYRTGIFLAASASAEFI 129
            F+G G++ I   L  A  +G YE    F  + S+L       +    +   A   + F 
Sbjct: 162 FFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNEL---AGPISGFT 218

Query: 130 ADIFLCPWEAIKVRQQTAVPP-------PFARNVFDAYSK---------MVGAEGFASLY 173
           + +   P + ++ R Q    P        F ++++ +Y           MV  EG  SLY
Sbjct: 219 SKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLY 278

Query: 174 KGITPLWFRQIPYTMCKFTSFE 195
           +G+T    + +P T     S+E
Sbjct: 279 RGVTMSLIKSVPSTAISLWSYE 300

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 77/184 (41%), Gaps = 12/184 (6%)

Query: 116 TGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKG 175
           T   +A S S  F A   + P + +K++ Q     P  +N  +    ++  EG    +KG
Sbjct: 16  TNSLVAGSLSGLF-ARTCIAPLDTVKIKLQVT---PHNKNA-NVLINILKREGIRGFWKG 70

Query: 176 ITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVV 235
             P     I Y   +F S+  I   +   L     +++   Q+     G  LAG+  ++ 
Sbjct: 71  NVPGSIMYIIYGGAQFGSYTYIGSFLRGGL-----DLNISPQLYSCLVGS-LAGMTSSLA 124

Query: 236 SHPADVMVSK-VNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIY 294
           S+P DV+ ++   N +            I+   G  G ++G    ++ IG  T+  + +Y
Sbjct: 125 SYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184

Query: 295 DSFK 298
           +S K
Sbjct: 185 ESIK 188

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 119/288 (41%), Gaps = 39/288 (13%)

Query: 7   ILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVR 66
           I ++P   + + + A  +GG+ A    H    P DL+K R Q   +   S +     I++
Sbjct: 27  IKSNPVRENIKSFVAGGVGGVCAVFTGH----PFDLIKVRCQNGQA--NSTVHAITNIIK 80

Query: 67  SEGATKV------------FTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSY 114
            E  T+V            + GV    +G +   A  + GY+  K    +LV+       
Sbjct: 81  -EAKTQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGK----KLVTFNNKQGG 135

Query: 115 RTGIFLAASASAEFIADI----FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFA 170
              + +   A+A FI+ I       P E +KV  QT+    F      A   +V   G A
Sbjct: 136 SNELTMGQMAAAGFISAIPTTLVTAPTERVKVVLQTSSKGSF----IQAAKTIVKEGGIA 191

Query: 171 SLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQ-LGQISVSFAGGYLAG 229
           SL+KG      R  P +   F S+E     + +R P       + +  ++V  AGG +AG
Sbjct: 192 SLFKGSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGG-IAG 250

Query: 230 ILCAVVSHPADVMVSKVNNERKSGESTLQATSRIYGKIG-----FPGL 272
           +   +   P D + +K+     + ++ L AT  IY + G     FPGL
Sbjct: 251 MSMWLAVFPIDTIKTKL-QASSTRQNMLSATKEIYLQRGGIKGFFPGL 297

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 63/304 (20%), Positives = 122/304 (40%), Gaps = 38/304 (12%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG----WRQIVRSEG------ATKV 73
           + GL A   T   V PLDL+K R Q+ A+  +    G     ++I+RS          ++
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNEL 73

Query: 74  FTGVGATAIGYSLQGAFKYGGYEFFKHQY---------SQLVSPETAHSYRTGIFLAASA 124
           + G+     G ++     +G Y   K            +QL      H   + I+L+A A
Sbjct: 74  YRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGA 133

Query: 125 SAEFIADIFLCPWEAIKVRQQTAVPPPFA--RNVFDAYSKMVGAEGFASLYKGITPLWFR 182
           S+  +  I   P   IK R  +          ++++   +++  +GF  L+KG+ P  F 
Sbjct: 134 SSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPALF- 192

Query: 183 QIPYTMCKFTSFERIVEMIYARLPTPKRE------MSQLGQISVSFAGGYLAGILCAVVS 236
            +      F  ++ + +    R    KRE      ++ L  I ++     L  ++   + 
Sbjct: 193 GVSQGALYFAVYDTLKQRKLRR----KRENGLDIHLTNLETIEIT----SLGKMVSVTLV 244

Query: 237 HPADVMVSKVNNERKSGES--TLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIY 294
           +P  ++ S + + R + +          I    GF GL+ GL+  ++     T   + +Y
Sbjct: 245 YPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVY 304

Query: 295 DSFK 298
           ++ K
Sbjct: 305 ENLK 308

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 86/201 (42%), Gaps = 10/201 (4%)

Query: 2   SQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDAS----LYKSN 57
           +Q   + N   + S  Y +A    GL+    T+    P+ ++K R    +      Y S 
Sbjct: 112 TQLKGVGNDHKMNSLIYLSAGASSGLMTAILTN----PIWVIKTRIMSTSKGAQGAYTSM 167

Query: 58  LDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTG 117
            +G +Q++R++G   ++ G+     G S QGA  +  Y+  K +  +         + T 
Sbjct: 168 YNGVQQLLRTDGFQGLWKGLVPALFGVS-QGALYFAVYDTLKQRKLRRKRENGLDIHLTN 226

Query: 118 I-FLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGI 176
           +  +  ++  + ++   + P++ +K   Q+         +F     ++  +GF  LYKG+
Sbjct: 227 LETIEITSLGKMVSVTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGL 286

Query: 177 TPLWFRQIPYTMCKFTSFERI 197
           +    R IP T   F  +E +
Sbjct: 287 SANLVRAIPSTCITFCVYENL 307

>Kwal_47.19228
          Length = 281

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 64/134 (47%), Gaps = 11/134 (8%)

Query: 153 ARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREM 212
           +R       ++  + G     +G  P   RQ   +  +FT++  + +MI     +P + +
Sbjct: 128 SRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI-----SPNKPL 182

Query: 213 SQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER--KSGESTLQATSRIYGKIGFP 270
           ++      +FA G+++      V+ P DV+ +++ ++    + +++L    RI+ + GF 
Sbjct: 183 NEY----YAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFT 238

Query: 271 GLWNGLAVRILMIG 284
             W G A R++ +G
Sbjct: 239 KFWKGWAPRLMKVG 252

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 4/90 (4%)

Query: 10  SPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDA--SLYKSNLDGWRQIVRS 67
           SP     EYYA   LG + +C    +   P+D++K R Q     S YK++L+   +I   
Sbjct: 177 SPNKPLNEYYAFA-LGFISSCAVV-AVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVE 234

Query: 68  EGATKVFTGVGATAIGYSLQGAFKYGGYEF 97
           EG TK + G     +   L G   +G Y++
Sbjct: 235 EGFTKFWKGWAPRLMKVGLSGGVSFGVYQY 264

 Score = 31.6 bits (70), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 45/117 (38%), Gaps = 6/117 (5%)

Query: 62  RQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLA 121
           ++I RS G      G   T I  +   A ++  Y   K    Q++SP    +      L 
Sbjct: 136 QEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLK----QMISPNKPLNEYYAFALG 191

Query: 122 ASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITP 178
             +S   +A     P + IK R Q+       +N  +   ++   EGF   +KG  P
Sbjct: 192 FISSCAVVA--VTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAP 246

>Scas_697.47
          Length = 328

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 115/271 (42%), Gaps = 31/271 (11%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCR---RQVDASLY--KSNLDGWRQIVRSE---GATKVF- 74
           +GG+ A    H    P DL+K R    Q  ++++  K  L   R I  S     + K F 
Sbjct: 45  VGGVCAVLTGH----PFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSVKGFY 100

Query: 75  TGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADI-- 132
            GV    +G +   A  + GY+  K   ++      + S    + +   A+A FI+ I  
Sbjct: 101 KGVIPPLLGVTPIFAVSFWGYDVGKKIVTR------SDSSSAQLTMGQMAAAGFISAIPT 154

Query: 133 --FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
                P E IKV  QTA       +   A   +V   G  SL+KG      R  P +   
Sbjct: 155 TLVTAPTERIKVVLQTAGANS-KTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALY 213

Query: 191 FTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER 250
           F S+E   + +  R  T + +  ++   +V  AGG +AG+   +V  P D + +K+ +  
Sbjct: 214 FASYEISKKFLNDRNATAESKTGEVNIANVCLAGG-IAGMSMWLVVFPIDTIKTKLQSSS 272

Query: 251 KSGESTLQATSRIYGKIG-----FPGLWNGL 276
            S +S + AT  IY K G     FPGL   L
Sbjct: 273 GS-QSMVAATREIYVKRGGIKGFFPGLGPAL 302

>Kwal_55.21106
          Length = 328

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 124/318 (38%), Gaps = 75/318 (23%)

Query: 26  GLVACGPTHSAVTPLDLVKC----------------------RRQVDASLYKSNLDGWRQ 63
           G VA    +  V PLDLVK                       + +V    YK +LD   +
Sbjct: 10  GAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIK 69

Query: 64  IVRSEGATKVFTGVGATAIGYSLQGAFKYGGY------EFFKHQY--SQLVSPETAHSYR 115
           I +++G   ++ G+  + I   LQ +F Y  +       FF+++    +L    T     
Sbjct: 70  IFKTKGVLGLYQGLWTSIIAGFLQ-SFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEELL 128

Query: 116 TGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPP---FARNVFDAYSKMVGAEGF--- 169
            GI  AA      ++ IF  P   I  RQQT+       F   +   YS+     GF   
Sbjct: 129 LGIVAAA------VSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWRG 182

Query: 170 --ASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQI--------- 218
              SL   + P            F S+E++ ++      T KR + + GQ+         
Sbjct: 183 FKVSLILTVNP---------SITFASYEKLQDIFI----TSKRAVDENGQLLETSGQLSP 229

Query: 219 SVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSG--ESTLQATSRIYGKIGFPGLWNGL 276
             +F  G  + ++  +++ P  ++VSK   +R     +S  Q    +Y + G   LW GL
Sbjct: 230 RQNFLLGVFSKVISTLITQP--LIVSKAYLQRTGSNFQSFQQVLLYLYKQEGLISLWKGL 287

Query: 277 AVR----ILMIGTLTSFQ 290
           A +    IL+ G L  F+
Sbjct: 288 APQLSKGILVQGLLFMFK 305

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 80/183 (43%), Gaps = 20/183 (10%)

Query: 125 SAEFIADIFLCPWEAIKVRQQTA-VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQ 183
           +A   A +   P +  KVR Q A +P P    +F     ++  EG   LY G++    RQ
Sbjct: 22  AAGIFATMVTHPLDLAKVRLQAAPMPKP---TLFRMLESILANEGVVGLYSGLSAAVLRQ 78

Query: 184 IPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMV 243
             YT  +F +++ + E +  R         QL  ++        +G +  +  + ADV+ 
Sbjct: 79  CTYTTVRFGAYDLLKENVIPR--------EQLTNMAYLLPCSMFSGAIGGLAGNFADVVN 130

Query: 244 SKVNNE-------RKSGESTLQATSRIYG-KIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
            ++ N+       R++ ++ +    +IY  + G   L+ G    ++    +T+ Q + YD
Sbjct: 131 IRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYD 190

Query: 296 SFK 298
            FK
Sbjct: 191 VFK 193

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 60/282 (21%), Positives = 105/282 (37%), Gaps = 27/282 (9%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYS 85
           G+ A   TH    PLDL K R Q       +       I+ +EG   +++G+ A  +   
Sbjct: 24  GIFATMVTH----PLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 86  LQGAFKYGGYEFFKHQY---SQLVSPETAHSYRTGIFLAASAS-AEFIADIFLCPWEAIK 141
                ++G Y+  K       QL +   A+     +F  A    A   AD+       I+
Sbjct: 80  TYTTVRFGAYDLLKENVIPREQLTN--MAYLLPCSMFSGAIGGLAGNFADVV-----NIR 132

Query: 142 VRQQTAVPPPFARN---VFDAYSKMVGAEG-FASLYKGITPLWFRQIPYTMCKFTSFERI 197
           ++  +A+     RN     D   K+   EG   +L+ G  P   R I  T  +  +++  
Sbjct: 133 MQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVF 192

Query: 198 VEMIYARLP-TPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGEST 256
              +  +L     +  + L           LAG++   V  PADVM +++ N     +  
Sbjct: 193 KNYLVTKLDFDASKNYTHL-------TASLLAGLVATTVCSPADVMKTRIMNGSGDHQPA 245

Query: 257 LQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
           L+  +    K G   ++ G       +G  T   +   +  K
Sbjct: 246 LKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLK 287

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%)

Query: 225 GYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIG 284
           G  AGI   +V+HP D+   ++        +  +    I    G  GL++GL+  +L   
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 285 TLTSFQWLIYDSFK 298
           T T+ ++  YD  K
Sbjct: 80  TYTTVRFGAYDLLK 93

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 63/130 (48%), Gaps = 11/130 (8%)

Query: 157 FDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLG 216
           F    ++    G     +G  P  FRQ+  +  +FT++  + ++I     +P + +++  
Sbjct: 271 FSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLI-----SPNKPLNEY- 324

Query: 217 QISVSFAGGYLAGILCAVVSHPADVMVSKVNNERK--SGESTLQATSRIYGKIGFPGLWN 274
               +F  G+++      V+ P DV+ +++ ++    + +++L    RI+ + G P  W 
Sbjct: 325 ---YAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWK 381

Query: 275 GLAVRILMIG 284
           G A R++ +G
Sbjct: 382 GWAPRLMKVG 391

 Score = 35.0 bits (79), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 4/95 (4%)

Query: 8   LNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASL--YKSNLDGWRQIV 65
           L SP     EYYA   LG + +C    +   P+D++K R Q   +   YK++L+   +I 
Sbjct: 314 LISPNKPLNEYYAF-VLGFISSCAVV-AVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIF 371

Query: 66  RSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKH 100
             EG  K + G     +   L G   +G Y++ ++
Sbjct: 372 VEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVEN 406

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 59/126 (46%), Gaps = 13/126 (10%)

Query: 21  ACTLGGLVACGPTHSAVTPLDLVKCRRQVD-ASLYKSN--LDGWRQIVRSEGATKVFTGV 77
           A ++ GLVA     S   P+D VK RRQ+  AS +K +  L  +R + R EG   ++ G 
Sbjct: 30  AGSVSGLVA----RSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGN 85

Query: 78  GATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPW 137
              +  Y L G+ ++G Y +     +    P  AHS      LA  A A  ++ +   P 
Sbjct: 86  VPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHS------LAVGALAGLVSSLLTYPL 139

Query: 138 EAIKVR 143
           + ++ R
Sbjct: 140 DLLRTR 145

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 83/198 (41%), Gaps = 29/198 (14%)

Query: 20  AACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIV-RSEGATKVFTGVG 78
           A   L GLV+   T+    PLDL++ R   + S +  +L    +++  +EG    F G G
Sbjct: 123 AVGALAGLVSSLLTY----PLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRG-G 177

Query: 79  ATAIG-YSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPW 137
           A AI   +L     +G YE           P  A         AAS +A  ++   + P 
Sbjct: 178 AWAIAATTLTTGLIFGIYETCTIAADTYGLPWLA--------AAASPTAGLVSKAAVFPL 229

Query: 138 EAIKVRQQ--TAVPPPFARNVFDAYS------------KMVGAEGFASLYKGITPLWFRQ 183
           + ++ R Q   A   PF      AYS             MV AEG ASLYKG+T    + 
Sbjct: 230 DTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKS 289

Query: 184 IPYTMCKFTSFERIVEMI 201
            P T+     ++R + ++
Sbjct: 290 TPTTVITLWVYQRCLRLL 307

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 77/176 (43%), Gaps = 11/176 (6%)

Query: 128 FIADIFLCPWEAIKVRQQTAVPPPFA-RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPY 186
            +A     P + +K+R+Q  +        +   +  +   EG  +L+KG  P     + Y
Sbjct: 36  LVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLY 95

Query: 187 TMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKV 246
              +F +        YA L T     + L   + S A G LAG++ +++++P D++ +++
Sbjct: 96  GSLQFGT--------YAWLNTAAAS-AGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146

Query: 247 NNERKSGESTLQATSR-IYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAA 301
              R +   +L+  +R I+   G  G + G A  I      T   + IY++   AA
Sbjct: 147 VANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIFGIYETCTIAA 202

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 85/201 (42%), Gaps = 15/201 (7%)

Query: 2   SQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQV-DASLYKSN--- 57
           +Q   +L+  +L SP   +     G  A       +TP++L+KC+ QV + S  K++   
Sbjct: 85  NQAKRLLDVESLLSP--LSKTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTK 142

Query: 58  -LDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRT 116
            L   + ++   G   ++ G   T I  S  GA  +  YE  K+    L S   A    T
Sbjct: 143 ILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKN---YLASRRQAEQNTT 199

Query: 117 GIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGI 176
              LA+ ASA    +  + P + IK   QT        ++  A  K+   +G A  Y+G+
Sbjct: 200 WELLASGASAGLAFNASIFPADTIKSTMQTD-----HIDLSSATRKIYARQGIAGFYRGL 254

Query: 177 TPLWFRQIPYTMCKFTSFERI 197
                R +P     F ++E +
Sbjct: 255 GITLIRAVPANAAIFYTYETL 275

>Kwal_27.11626
          Length = 299

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 89/234 (38%), Gaps = 24/234 (10%)

Query: 73  VFTGVGATAIGYSLQGAFKYGGYEF--------FKHQYSQLVSPETAHSYRTGIFLAASA 124
           +F G+G  A    LQ  +KYGG  F        FK  +      +T  + R+    A + 
Sbjct: 70  LFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRS----ATAG 125

Query: 125 SAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQI 184
           S   I +I L P + +K+++QT  P  F       + K++  EGF  LY+G      R  
Sbjct: 126 SLIGIGEIVLLPLDVLKIKRQTN-PESFKGR---GFIKILKDEGFG-LYRGWGWTAARNA 180

Query: 185 PYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVS 244
           P +   F       E I           SQ      +F    +      +VS P DV+ +
Sbjct: 181 PGSFALFGGNAFAKEYILGLKDYSSATWSQ------NFVSSIVGASASLIVSAPLDVIKT 234

Query: 245 KVNNER-KSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSF 297
           ++ N    + ES  +         G    + GL  ++L  G    F + +  S 
Sbjct: 235 RIQNRHFDNPESGFRIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQSL 288

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 73/173 (42%), Gaps = 13/173 (7%)

Query: 21  ACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           + T G L+  G     + PLD++K +RQ +   +K    G+ +I++ EG   ++ G G T
Sbjct: 121 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPESFKGR--GFIKILKDEGFG-LYRGWGWT 175

Query: 81  AIGYSLQGAFK-YGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
           A   +  G+F  +GG  F K     L    +A   +  +     ASA  I      P + 
Sbjct: 176 A-ARNAPGSFALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVS---APLDV 231

Query: 140 IKVR-QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKF 191
           IK R Q      P   + F      +  EG  + +KG+TP      P  +  F
Sbjct: 232 IKTRIQNRHFDNP--ESGFRIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSF 282

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 101/246 (41%), Gaps = 22/246 (8%)

Query: 43  VKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQY 102
           ++C+    A  + S  + + +I   EG   ++ G+  T +         + GYE F+   
Sbjct: 88  IQCKNS--ALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDH- 144

Query: 103 SQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQT-------AVPPPFARN 155
               SP    SY +   L   A+A  +A   + P E IK R Q+              ++
Sbjct: 145 ----SP-MRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKD 199

Query: 156 VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTP--KREMS 213
           +       + + G+  L+KG+    +R +P++   + S+E   +  +        +  +S
Sbjct: 200 LLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLS 259

Query: 214 QLGQISV-SFAGGYLAGILCAVVSHPADV----MVSKVNNERKSGESTLQATSRIYGKIG 268
                 + SF GG ++G   A+++HP DV    M   ++ E K   + +    R+  +  
Sbjct: 260 PNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGM 319

Query: 269 FPGLWN 274
           F  L+N
Sbjct: 320 FKFLYN 325

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 83/213 (38%), Gaps = 30/213 (14%)

Query: 3   QKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASL-----YKSN 57
            +S  +   TL   +YY      G V+        TP++ V+ R Q+         YKS 
Sbjct: 110 NRSRGIYDNTLSLGQYYTC----GFVSGSANALLATPIEHVRIRLQLQKEALANAEYKST 165

Query: 58  LDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYR-- 115
           LD   ++++     + FT   AT +  S        G+  +   Y  L++ + AH +R  
Sbjct: 166 LDCTEKLLKQGSLMRGFT---ATLMRTS-------HGFGIYFLTYETLIASQLAHGFRRE 215

Query: 116 -----TGIFLAASASAEFIADIFLCPWEAIK--VRQQTAVPPPFARNVFDAYSKMVGAEG 168
                      A + A F A  +  P++ +K  ++    V P +  NV      +    G
Sbjct: 216 DISAWKACMFGALSGAFFWAMTY--PFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRERG 273

Query: 169 FASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201
             +  KG  P   R +P     F +FE  ++M+
Sbjct: 274 LRAFTKGFMPTMLRSLPVNGATFAAFEVTMQML 306

 Score = 31.2 bits (69), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 11/83 (13%)

Query: 105 LVSPETA------HSYRTGIFLAASASAEFIADIFLC-PWEAIKVRQQTAVPPPFARNVF 157
           L++P+        H +R  +    S +   +A + +  P++ IKVR QT    P     +
Sbjct: 6   LITPQVVEDLTDLHGFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTM---PGNATAW 62

Query: 158 DAYSKMVGAEGFASLYKG-ITPL 179
           +A + +V  EGF   YKG + PL
Sbjct: 63  EAITDLVKYEGFMGFYKGTMAPL 85

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 66/134 (49%), Gaps = 15/134 (11%)

Query: 152 FARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKRE 211
           FA  V + Y +  G  GF    +G  P  FRQ+  ++ +FT++  IV+ +     +P + 
Sbjct: 195 FAGTVLEIY-RTRGVRGF---LQGAMPTIFRQLGNSVVRFTTYAWIVQSL-----SPHKA 245

Query: 212 MSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERK--SGESTLQATSRIYGKIGF 269
           + +      +FA G L+      ++ P DV+ +++ ++    + +S+L    RI+ + GF
Sbjct: 246 LDEYQ----AFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGF 301

Query: 270 PGLWNGLAVRILMI 283
             +W G   R+  +
Sbjct: 302 RYMWKGWVPRLFKV 315

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 39  PLDLVKCRRQVDAS--LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
           P+D++K R Q   +   YKS+L+   +I   EG   ++ G        SL G   +G Y+
Sbjct: 268 PIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQ 327

Query: 97  FFKH 100
           + ++
Sbjct: 328 YVEN 331

>Scas_716.29
          Length = 316

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 77/185 (41%), Gaps = 16/185 (8%)

Query: 120 LAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKM-----VGAEGFASLYK 174
           L A + +  +A   + P + +K+R Q  + P +         KM     +   G  S +K
Sbjct: 26  LVAGSVSGLLARTVIAPLDTLKIRLQ--LRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83

Query: 175 GITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAV 234
           G  P     + Y   +F+S+       Y  L     +M+  GQ+  S   G LAG+  + 
Sbjct: 84  GNVPGTMMYVLYGGAQFSSYS-----FYNNLFGETSDMN--GQLQ-SLVVGALAGMTSSF 135

Query: 235 VSHPADVMVSK-VNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLI 293
           VS+P DV+ ++ + N+  +  S       I+   G PG + G    +  I    S  +  
Sbjct: 136 VSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGT 195

Query: 294 YDSFK 298
           Y+S K
Sbjct: 196 YESIK 200

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 80/189 (42%), Gaps = 22/189 (11%)

Query: 31  GPTHSAVT-PLDLVKCRRQVDASLYKSNLD-GWRQIVRSEGATKVFTGVGATAIGYSLQG 88
           G T S V+ P D+++ R   +  +  S+L  G ++I   EG    F G  A+    +L  
Sbjct: 130 GMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSA 189

Query: 89  AFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQT-- 146
           +  +G YE  K  Y    S E+   Y   +  +AS+ +   + +   P + I+ R Q   
Sbjct: 190 SILFGTYESIK-IYCDEYSKES--DYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRN 246

Query: 147 ------AVPPPFARNVFDAYS---------KMVGAEGFASLYKGITPLWFRQIPYTMCKF 191
                  V       ++ +Y           ++  EG  SLY+G++    + +P T+   
Sbjct: 247 SVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSL 306

Query: 192 TSFERIVEM 200
            ++E ++ +
Sbjct: 307 WAYETVMRL 315

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/282 (20%), Positives = 109/282 (38%), Gaps = 36/282 (12%)

Query: 39  PLDLVKCRRQVDAS-------LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFK 91
           PLD+VK R Q+           Y   +D   QIV+ EG ++++ G+ +  +  + + A K
Sbjct: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87

Query: 92  YGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPP 151
           +   + ++  +  L   +        I + + + A       + P+E +K+R Q  V   
Sbjct: 88  FACNDSYQKMFKDLYGVDKLTQQ---ISILSGSLAGVTEACVIVPFELVKIRLQD-VNSK 143

Query: 152 FARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKRE 211
           F     +   K +   G  SLY G+    +R   +    F     ++  I A LP  K  
Sbjct: 144 F-NGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG----VIFQIRALLPKAKTN 198

Query: 212 MSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATS---------- 261
             +    +     G + G       H    ++S V +  +SG +T  A            
Sbjct: 199 TEK---TTNDLIAGTIGGYCRYSTEH---TILSVVKSRIQSGATTTLADGTVVPKYNWTW 252

Query: 262 ----RIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKA 299
               +IY + GF  L+ G   +IL +G       ++++   A
Sbjct: 253 PSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMA 294

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 74/168 (44%), Gaps = 18/168 (10%)

Query: 118 IFLAASASAEFIADIFLC-PWEAIKVRQQTAVPPPFA-----RNVFDAYSKMVGAEGFAS 171
           I+   S +A  ++++ +  P + +K R Q  V            V D   ++V  EGF+ 
Sbjct: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68

Query: 172 LYKGITPLWFRQIPYTMCKFT---SFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLA 228
           LYKGI+     + P    KF    S++++ + +Y         + +L Q  +S   G LA
Sbjct: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYG--------VDKLTQ-QISILSGSLA 119

Query: 229 GILCAVVSHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGL 276
           G+  A V  P +++  ++ +        ++   +   + G   L+NGL
Sbjct: 120 GVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGL 167

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 66/177 (37%), Gaps = 25/177 (14%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIG 83
           L G +A       + P +LVK R Q   S +   ++   + +R  G   ++ G+ +T   
Sbjct: 114 LSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTM-- 171

Query: 84  YSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWE----- 138
              + AF  GGY     Q   L+     ++ +T   L A     +      C +      
Sbjct: 172 --WRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGY------CRYSTEHTI 223

Query: 139 --AIKVRQQTAVPPPFAR-NVFDAYS-------KMVGAEGFASLYKGITPLWFRQIP 185
              +K R Q+      A   V   Y+       K+   EGF +LYKG  P   R  P
Sbjct: 224 LSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280

>Scas_632.9
          Length = 292

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 87/209 (41%), Gaps = 22/209 (10%)

Query: 2   SQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGW 61
           +Q S++L   T  SP   +   L G  A       +TP++L+KC+ QV  S  ++ ++G 
Sbjct: 96  NQCSNVLEKFTNVSP--LSNILLSGAFAGSCASFVLTPVELIKCKLQV--SNLQTAVEGQ 151

Query: 62  RQ----------IVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETA 111
            +          ++R +G   ++ G  +T I  SL G   +  YE  K         +T 
Sbjct: 152 IKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQGLKDR-RKDTE 210

Query: 112 HSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFAS 171
           +     +   ASA   F A IF  P + +K   QT         + +A  K++   G   
Sbjct: 211 NKTWELLVSGASAGLAFNASIF--PADTVKSMMQTE-----HITLINAVKKVLTTYGITG 263

Query: 172 LYKGITPLWFRQIPYTMCKFTSFERIVEM 200
            Y+G+     R +P     F  +E + +M
Sbjct: 264 FYRGLGITLIRAVPANATVFYMYETLSKM 292

>Scas_645.9
          Length = 391

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/255 (21%), Positives = 106/255 (41%), Gaps = 35/255 (13%)

Query: 54  YKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHS 113
           +   L+ + +I + EG T ++ G+    +         + GYE+ +       S  T + 
Sbjct: 129 FNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSPLATSSPTFNP 188

Query: 114 YRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARN----------VFDAYSKM 163
              G      A A  +A   + P E +K + Q+   P  +++          + +   +M
Sbjct: 189 LMCG------AIARILAASTVAPLELLKTKLQSI--PRVSKSTTSWMMVKELLKETRQEM 240

Query: 164 VGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFA 223
             +    +L+KG+    +R +P++   + S+E     ++  + T K   S L     SF 
Sbjct: 241 RISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLW--MDTSKSH-SNLTFFINSFI 297

Query: 224 GGYLAGILCAVVSHPADV-----MVSKVNNERKS---------GESTLQATSRIYGKIGF 269
           GG ++G + A+V+HP DV      +S + N  KS          ++  +    I+   G+
Sbjct: 298 GGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGW 357

Query: 270 PGLWNGLAVRILMIG 284
             L+ GL  R++ I 
Sbjct: 358 GALYTGLVPRMVKIA 372

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 74/184 (40%), Gaps = 24/184 (13%)

Query: 35  SAVTPLDLVKCRRQVDASLYKSN---------LDGWRQIVRSEGATK-VFTGVGATAIGY 84
           S V PL+L+K + Q    + KS          L   RQ +R  GA+  +F G+  T    
Sbjct: 201 STVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGASNALFKGLEITLWRD 260

Query: 85  SLQGAFKYGGYEFFK-HQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVR 143
               A  +G YEF K H +       +  ++    F+  S S   IA +   P++  K R
Sbjct: 261 VPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGT-IAALVTHPFDVGKTR 319

Query: 144 QQ---------TAVPPPF---ARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKF 191
            Q         + V  P     +N+F     +   EG+ +LY G+ P   +  P      
Sbjct: 320 WQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMI 379

Query: 192 TSFE 195
           +S+E
Sbjct: 380 SSYE 383

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 65/182 (35%), Gaps = 4/182 (2%)

Query: 15  SPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVF 74
           +P   A     G ++  PT     P + +K   Q ++    S +   + IV + G   +F
Sbjct: 128 APLTTAQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFKGSFIKAAKHIVSTGGVKSLF 187

Query: 75  TGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFL 134
            G  AT        A  +  YE  K   ++ V+ +            A   A     + +
Sbjct: 188 NGSLATLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVV 247

Query: 135 CPWEAIKVRQQTAVPP-PFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193
            P + IK R Q A  P    +   D Y +  G +GF   + G+ P   R  P     F  
Sbjct: 248 FPIDTIKTRLQVATTPISMVQATKDIYIQRGGIKGF---FPGLGPALLRSFPANAATFLG 304

Query: 194 FE 195
            E
Sbjct: 305 VE 306

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/246 (19%), Positives = 102/246 (41%), Gaps = 14/246 (5%)

Query: 43  VKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQY 102
           +  R    A  YK  LD  ++I  +EG   ++ G+G++ +   +Q    +  Y   +  Y
Sbjct: 61  IALRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHY 120

Query: 103 SQLVSPETAHS-YRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYS 161
            +L       + + T   L     A   + +F+ P   +  RQQT      A ++     
Sbjct: 121 FRLKQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAR 180

Query: 162 KMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISV- 220
           ++    G+   + G+       +  ++  + ++ER+ E ++   PTP      +   ++ 
Sbjct: 181 EVHAENGWRGFWAGLKVSLVLTVNPSIT-YATYERLREALF---PTPAAASHLVDSAALL 236

Query: 221 ----SFAGGYLAGILCAVVSHPADVMVSKVNNERKSG--ESTLQATSRIYGKIGFPGLWN 274
               +F  G L+ I+  V++ P  ++++K + +R     +   Q    +Y   G   LW 
Sbjct: 237 SPGQNFVMGVLSKIVSTVLTQP--LIIAKASLQRSGSCFQDFHQVLHHLYSTEGPLSLWK 294

Query: 275 GLAVRI 280
           GL  +I
Sbjct: 295 GLGPQI 300

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 88/199 (44%), Gaps = 32/199 (16%)

Query: 23  TLGGLVACGPTHSAVT-PLDLVKCRRQVDASLYKSNL-DGWRQIVRSEGATKVFTGVGAT 80
           T+G L   G T S V+ PLDL++ R   + + +++++ +  RQ+  +EG    FTG+   
Sbjct: 119 TVGAL--AGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTA 176

Query: 81  AIGYSLQGAFKYGGYEFFK-----HQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLC 135
               +L  A  +  YE        H+      P +A S   GI       A F++   + 
Sbjct: 177 MTTVTLSTAIMFLTYETVNIVCENHEKEFWSRPVSASS---GII------AGFVSKTMVF 227

Query: 136 PWEAIKVRQQ----------TAVPPPFARNVFDAYS----KMVGAEGFASLYKGITPLWF 181
           P + ++ R Q          T  P  +    + + +    K++  EG ++LY+G+T    
Sbjct: 228 PIDTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLC 287

Query: 182 RQIPYTMCKFTSFERIVEM 200
           + +P T      +ER +++
Sbjct: 288 KSVPTTAISLFVYERTMDL 306

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 91/223 (40%), Gaps = 19/223 (8%)

Query: 36  AVTPLDLVKCRRQ---VDASLYKSNLDGWRQIVRSEGATKVFTG-VGATAIGYSLQGAFK 91
           A  P+D VK R Q   V    YK      R I++ EG   ++ G + ATA+ Y + GA +
Sbjct: 35  ATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNIPATAM-YVVYGAVQ 93

Query: 92  YGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPP 151
           +G Y +F + +S    P  +   +T   L   A A   + +   P + ++ R   A    
Sbjct: 94  FGSYSWFNNVWSAKF-PRFSQQGQT---LTVGALAGMTSSVVSYPLDLLRTR-LIANRTS 148

Query: 152 FARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKRE 211
              +V +   +M   EG    + GI+         T   F ++E +       +     E
Sbjct: 149 HRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYETV------NIVCENHE 202

Query: 212 MSQLGQISVSFAGGYLAGILCAVVSHPADVMVSK--VNNERKS 252
             +     VS + G +AG +   +  P D +  +  V N +++
Sbjct: 203 -KEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRT 244

>Scas_558.2
          Length = 289

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 107/279 (38%), Gaps = 38/279 (13%)

Query: 19  YAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVG 78
           +    L G  A   T     P+D +K R Q     +++            G   ++ G+G
Sbjct: 6   FVMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFQNG-----------GYHGIYRGLG 54

Query: 79  ATAIGYSLQGAFKYGGYEFFKHQYSQLVS-------PETAHSYRTGIFLAASASAEFIAD 131
           +  +  +   +  +  Y+  K +    V          + HS  T + + AS+  E  A 
Sbjct: 55  SAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAAC 114

Query: 132 IFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFA-SLYKGITPLWFRQIPYTMCK 190
           +   P E IK R Q       +   F    K    EG   +LY+G +    R+IP+T  +
Sbjct: 115 LVRVPAEVIKQRTQVHSTNS-SWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQ 173

Query: 191 FTSFERIVEMIYARLPTPKREMSQL----GQISVSFAGGYLAGILCAVVSHPADVMVSK- 245
           F  +    E +         E+  L    G I  S AGG     + A  + P D + ++ 
Sbjct: 174 FPLY----EFMKKEWALYDNEVGHLKPWKGAICGSIAGG-----IAAATTTPLDFLKTRL 224

Query: 246 -VNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMI 283
            +N +    +S ++    IY + GF   ++G+  R + I
Sbjct: 225 MLNKDSIPIKSLIR---NIYKEEGFKIFFSGIYPRTMWI 260

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 37/87 (42%), Gaps = 5/87 (5%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQV--DASLYKSNLDGWRQIVRSEGATKVFTGVGATAIG 83
           G +A G   +  TPLD +K R  +  D+   KS +   R I + EG    F+G+    + 
Sbjct: 203 GSIAGGIAAATTTPLDFLKTRLMLNKDSIPIKSLI---RNIYKEEGFKIFFSGIYPRTMW 259

Query: 84  YSLQGAFKYGGYEFFKHQYSQLVSPET 110
            S  GA   G YE        L   +T
Sbjct: 260 ISAGGAIFLGVYETMHFMLQSLEETKT 286

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 107/265 (40%), Gaps = 24/265 (9%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIG 83
           L G  A   T     P+D +K R Q     + +   G++ I R  G+  V +  GA+   
Sbjct: 9   LSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANG--GYKGIYRGLGSAVVASAPGASLFF 66

Query: 84  YSLQGAFKYGGYEFFKHQ----YSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
            S         Y++ K +     S+L S  +     T   + +S+  E  A +   P E 
Sbjct: 67  IS---------YDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEV 117

Query: 140 IKVRQQTAVPPPFARNVFDAYSKMVGAEGF-ASLYKGITPLWFRQIPYTMCKFTSFERIV 198
           +K R Q       +     +  +    EG   +LY+G +    R+IP+T  +F  +E + 
Sbjct: 118 VKQRTQVHSTNS-SWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYL- 175

Query: 199 EMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQ 258
           +  +A+     +     G I  S AGG     + A  + P D + +++    K+  S   
Sbjct: 176 KKTWAKANGQSQVEPWKGAICGSIAGG-----IAAATTTPLDFLKTRL-MLNKTTASLGS 229

Query: 259 ATSRIYGKIGFPGLWNGLAVRILMI 283
              RIY + G    ++G+  R + I
Sbjct: 230 VIIRIYREEGPAVFFSGVGPRTMWI 254

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 7/74 (9%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVD---ASLYKSNLDGWRQIVRSEGATKVFTGVGATAI 82
           G +A G   +  TPLD +K R  ++   ASL    +    +I R EG    F+GVG   +
Sbjct: 197 GSIAGGIAAATTTPLDFLKTRLMLNKTTASLGSVII----RIYREEGPAVFFSGVGPRTM 252

Query: 83  GYSLQGAFKYGGYE 96
             S  GA   G YE
Sbjct: 253 WISAGGAIFLGMYE 266

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 63/149 (42%), Gaps = 15/149 (10%)

Query: 151 PFAR--NVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTP 208
           P AR   +  A   M    G A+  +G T   FRQI  T  +FT++     ++ AR    
Sbjct: 136 PVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQAR---N 192

Query: 209 KREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKV--NNERKSGESTLQATSRIYGK 266
            +  S +  ++ SF            ++ P DV+ +++   N +   ++TL    RI+ +
Sbjct: 193 DKASSVITGLATSFT--------LVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQ 244

Query: 267 IGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
            G    W G   R + +G      + +Y+
Sbjct: 245 EGMATFWKGSIFRFMKVGISGGLTFTVYE 273

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 64/151 (42%), Gaps = 15/151 (9%)

Query: 149 PPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTP 208
           P     NV    +++    G  + +KG  P   RQ+  ++ +FT+F  + +         
Sbjct: 174 PEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQNN 233

Query: 209 KREMSQLGQISVSFAGGYLAGILCAVV--SHPADVMVSKVNNERKSG--ESTLQATSRIY 264
           +   + LG IS            CAVV  + P DV+ +++  +       +++    RI+
Sbjct: 234 EYFATLLGLISS-----------CAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIF 282

Query: 265 GKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
            + GF  LW G   R++ +G   S  + IY 
Sbjct: 283 VEEGFAMLWKGWLPRLMKVGLSGSVSFGIYQ 313

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 17  EYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDAS--LYKSNLDGWRQIVRSEGATKVF 74
           EY+A  TL GL++      A  PLD++K R Q   S  LY+++++   +I   EG   ++
Sbjct: 234 EYFA--TLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGFAMLW 291

Query: 75  TGVGATAIGYSLQGAFKYGGYEFFKH 100
            G     +   L G+  +G Y++ ++
Sbjct: 292 KGWLPRLMKVGLSGSVSFGIYQYTEN 317

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/308 (20%), Positives = 117/308 (37%), Gaps = 34/308 (11%)

Query: 12  TLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN---LDGWRQIVRSE 68
           T+Y  + + A   GG V    + + V+P++ VK   QV +S    N   +   +Q+ + E
Sbjct: 10  TVYKNDGFIAFVAGG-VGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEE 68

Query: 69  GATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEF 128
           G   +F G G   +      A +Y  YEF K +    V        R+   L   A    
Sbjct: 69  GVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFH-VGQSGHEQLRSWERLVGGALGGG 127

Query: 129 IADIFLCPWEAIKVRQ--QTAVPPPFARN----------VFDAYSKMVGAE-GFASLYKG 175
            + +   P + ++ R   QTA      R+          + +   ++   E G    Y+G
Sbjct: 128 ASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRG 187

Query: 176 ITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVV 235
           + P     +P+    F  +ER+  +I         +       +   A G ++G +   V
Sbjct: 188 VYPTSLGVVPFVALNFALYERLKALI-------PHDYDAGSVAAAKLAIGAVSGGIAQTV 240

Query: 236 SHPADVMVSKVNNERKSGESTL--------QATSRIYGKIGFPGLWNGLAVRILMIGTLT 287
            +P D++  +       G+S L         A   I  + G  G + GL   ++ +    
Sbjct: 241 VYPFDLLRRRF-QVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAM 299

Query: 288 SFQWLIYD 295
           + QW +Y+
Sbjct: 300 AVQWFVYE 307

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 78/190 (41%), Gaps = 34/190 (17%)

Query: 39  PLDLVKCRRQVD----ASLYKSN----------LDGWRQIVRSEGATKV-FTGVGATAIG 83
           PLDLV+ R  +     A L++S           ++  R+I R EG  +  + GV  T++G
Sbjct: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194

Query: 84  YSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIF----LAASASAEFIADIFLCPWEA 139
                A  +  YE  K            H Y  G      LA  A +  IA   + P++ 
Sbjct: 195 VVPFVALNFALYERLK--------ALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDL 246

Query: 140 IKVR------QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193
           ++ R       Q+ +   +A +V DA   +   EG    YKG+T    + +P    ++  
Sbjct: 247 LRRRFQVLTMGQSELGFRYA-SVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFV 305

Query: 194 FERIVEMIYA 203
           +E I E ++ 
Sbjct: 306 YELISENMHG 315

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 81/187 (43%), Gaps = 23/187 (12%)

Query: 21  ACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           + T G L+  G     + PLD++K +RQ +   ++    G+ +I+R EG   ++ G G T
Sbjct: 121 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPESFRGR--GFLRILRDEG-MGLYRGWGWT 175

Query: 81  AIGYSLQGAFK-YGGYEFFKH------QYSQLVSPETAHSYRTGIFLAASASAEFIADIF 133
           A   +  G+F  +GG  F K        YSQ        ++ + IF    ASA  I    
Sbjct: 176 A-ARNAPGSFALFGGNAFAKEYILGLKDYSQAT---WGQNFVSSIF---GASASLIVS-- 226

Query: 134 LCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193
             P + IK R Q+      A + F      +  EG  + +KG+TP      P  +  F  
Sbjct: 227 -APLDVIKTRIQSRNFES-AESGFTIVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFAI 284

Query: 194 FERIVEM 200
            + ++ M
Sbjct: 285 AQTLIPM 291

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 110/285 (38%), Gaps = 37/285 (12%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATK--------VFTGV 77
           G++  G  H    P+D +  +R +      +N      +V  E A+K        +F G+
Sbjct: 20  GILEIGVFH----PVDTI-SKRLMSNHTKITNAQQLNDVVFREHASKPFGQRLFTLFPGL 74

Query: 78  GATAIGYSLQGAFKYGGYEF--------FKHQYSQLVSPETAHSYRTGIFLAASASAEFI 129
           G  A     Q  +KYGG  F        FK  +      +T  + R+    A + S   I
Sbjct: 75  GYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKALRS----ATAGSLIGI 130

Query: 130 ADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMC 189
            +I L P + +K+++QT  P  F       + +++  EG   LY+G      R  P +  
Sbjct: 131 GEIVLLPLDVLKIKRQTN-PESFRGR---GFLRILRDEGMG-LYRGWGWTAARNAPGSFA 185

Query: 190 KFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNE 249
            F       E I   L       +  GQ  VS   G  A +   +VS P DV+ +++ + 
Sbjct: 186 LFGGNAFAKEYI---LGLKDYSQATWGQNFVSSIFGASASL---IVSAPLDVIKTRIQSR 239

Query: 250 R-KSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLI 293
             +S ES            G    + GL  ++L  G    F + I
Sbjct: 240 NFESAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFAI 284

>Scas_687.15*
          Length = 328

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/132 (18%), Positives = 61/132 (46%), Gaps = 11/132 (8%)

Query: 155 NVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQ 214
           N+F    ++    G     +G  P  FRQ+  +  +FT++  + ++I     +P + +++
Sbjct: 179 NIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLI-----SPTQPLNE 233

Query: 215 LGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKS--GESTLQATSRIYGKIGFPGL 272
           +     +F  G  +      ++ P DV+ +++ ++      +++L    R++ + G   L
Sbjct: 234 V----YAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSL 289

Query: 273 WNGLAVRILMIG 284
           W G   R+  +G
Sbjct: 290 WKGWLPRLFKVG 301

 Score = 34.7 bits (78), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 55/139 (39%), Gaps = 20/139 (14%)

Query: 59  DGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYS-------------QL 105
           + WRQ+     ++ +F+ V    +   L+G F  G       Q S             QL
Sbjct: 166 EQWRQVYSKYPSSNIFSVVKEIYLTRGLRG-FAQGAMPTVFRQVSNSTVRFTAYTTLKQL 224

Query: 106 VSPETA--HSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKM 163
           +SP       Y  GI L +S +   +      P + +K R Q+     F +N  +   ++
Sbjct: 225 ISPTQPLNEVYAFGIGLFSSCAVVALTQ----PIDVVKTRMQSKTAHYFYKNSLNCAYRV 280

Query: 164 VGAEGFASLYKGITPLWFR 182
              EG  SL+KG  P  F+
Sbjct: 281 FVEEGMVSLWKGWLPRLFK 299

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 4/95 (4%)

Query: 8   LNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDAS--LYKSNLDGWRQIV 65
           L SPT    E YA     GL +     +   P+D+VK R Q   +   YK++L+   ++ 
Sbjct: 224 LISPTQPLNEVYAFGI--GLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVF 281

Query: 66  RSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKH 100
             EG   ++ G         L G   +G Y++ ++
Sbjct: 282 VEEGMVSLWKGWLPRLFKVGLSGGISFGVYQYVEN 316

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 70/335 (20%), Positives = 127/335 (37%), Gaps = 52/335 (15%)

Query: 15  SPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDA---SLYKSNLDGW----RQIVRS 67
           S +Y     L G V+     + + PLD +K   Q      S Y  +L G     + I  +
Sbjct: 14  SLDYVVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWIN 73

Query: 68  EGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAE 127
           +G    F G   T +      A K+  YE    Q   ++ P  +  Y +     AS S  
Sbjct: 74  DGIRGFFQGHSVTLLRIFPYAAVKFVAYE----QIRSILIP--SREYESHWRRLASGSLA 127

Query: 128 FIADIFLC-PWEAIKVRQQ--TAVPPPFARNVFDAYSKMVGAEGFAS------------- 171
            +  +F+  P +  +VR    T       R++         +EG  S             
Sbjct: 128 GLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCN 187

Query: 172 LYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTP----------KREMSQLGQIS-- 219
            Y+G  P     IPY    F + + I +++ + L  P          + E  +L Q +  
Sbjct: 188 FYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPL 247

Query: 220 ---VSFAGGYLAGILCAVVSHPADVMVSKVN----NERKSGESTLQATSRI----YGKIG 268
                   G L+GIL    ++P +++  ++     + RK  +   Q+ S I    Y + G
Sbjct: 248 RTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKG 307

Query: 269 FPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAGL 303
           + G + GL++  + +  + +  + +Y+  K   G+
Sbjct: 308 WRGFFVGLSIGYIKVTPMVACSFFVYERMKWHLGI 342

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 101/236 (42%), Gaps = 24/236 (10%)

Query: 54  YKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQL--VSPETA 111
           YK  LD   ++ R+EG   ++ G+ A+ +G  +Q    +  Y   +  Y ++  V  E A
Sbjct: 87  YKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAA 146

Query: 112 HSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFAS 171
             + T   L  S  A   + +F  P   +  +QQT        N F A +K V  E    
Sbjct: 147 R-FSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLE-GDNSFKAIAKEVYDED--- 201

Query: 172 LYKGITPLWFRQIPYTMC-------KFTSFERIVEMIYARLPTPKREMSQLGQIS--VSF 222
              GIT  W + +  ++         + S E++ +++Y      K       Q+    +F
Sbjct: 202 ---GITGFW-KSLKVSLVLTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLKPGQNF 257

Query: 223 AGGYLAGILCAVVSHPADVMVSKVNNERKSGEST--LQATSRIYGKIGFPGLWNGL 276
             G L+ I+   ++HP  ++V+K + +R S + T   +  + +Y   G   LW GL
Sbjct: 258 LIGVLSKIISTCLTHP--LIVAKASLQRSSSKFTSFQEVLTYLYRHEGAHALWKGL 311

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/293 (18%), Positives = 118/293 (40%), Gaps = 23/293 (7%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYK--SNLDGWRQIVRSEGATK-----VFTG 76
           + GL A   T     PLDL+K R Q+ A   K  S  +  ++I++    T+      + G
Sbjct: 17  ISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEAYRG 76

Query: 77  VGATAIGYSLQGAFKYGGYEFFKH-QYSQLVSPETAHSY------RTGIFLAASASAEFI 129
           +G   IG ++     +G Y   K   YS    P   + +       + ++L ++ ++   
Sbjct: 77  LGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGASGLA 136

Query: 130 ADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMC 189
             +   P   IK R  +        ++ +A +++   EG  + ++G+ P  F  +     
Sbjct: 137 TALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSLF-GVTQGAL 195

Query: 190 KFTSFERI-VEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNN 248
            F  ++ + ++ ++ R    +R ++ +  I +      L+ ++     +P  ++ + +  
Sbjct: 196 YFAIYDTLKLKYLHDRNDIQERRLNAVETIGII----SLSKMISVSSVYPLQLLKTNLQT 251

Query: 249 ERKSGESTLQATS---RIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298
            R       +  S    I+   G  G + GL   ++     T   + +Y+ FK
Sbjct: 252 FRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYEHFK 304

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 81/193 (41%), Gaps = 18/193 (9%)

Query: 17  EYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDA-----SLYKSNLDGWRQIVRSEGAT 71
           +YY      G V+        TP++ V+ R Q+       + Y+ +LD  +++++ +   
Sbjct: 120 QYYTC----GFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKALM 175

Query: 72  KVFTGVGATAIGYSLQGAFKYGGYE-FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIA 130
           + FT   AT +  S      +  YE    +Q    V  +    ++  +F  A + A F A
Sbjct: 176 RGFT---ATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVF-GAFSGAFFWA 231

Query: 131 DIFLCPWEAIK--VRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTM 188
             +  P++ +K  ++    V P   +NVF     +    G+ +  KG  P   R +P   
Sbjct: 232 MTY--PFDVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNG 289

Query: 189 CKFTSFERIVEMI 201
             F +FE  + ++
Sbjct: 290 ATFATFEVTMRLL 302

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 73/180 (40%), Gaps = 18/180 (10%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQ------VDASLYKSNLDGWRQIVRSEGATKVFTGVGA 79
           G +A   T   +TP++LVKC+ Q      V    Y + L   R IV+  G   ++ G   
Sbjct: 109 GAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSG 168

Query: 80  TAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEA 139
           T I  S  GA  +  YE  K   ++     T ++    +   A A A F A IF  P + 
Sbjct: 169 TFIRESAGGAVWFTAYEVLKGWLARR-RGSTENTVWELLASGAGAGAAFHASIF--PADT 225

Query: 140 IKVRQQTAV--PPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERI 197
           +K   QT      P  R V   +    G  GF   Y+G+     R +P     F  +E +
Sbjct: 226 VKSTMQTEHLGLGPAVRTVLKKH----GPTGF---YRGVGITLLRALPANAVIFYVYESL 278

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 106/269 (39%), Gaps = 37/269 (13%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYS 85
           G  A   T  A  P+D +K R Q     + +            G   V+ G+G+  I  +
Sbjct: 13  GAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG-----------GYKGVYRGLGSAVIASA 61

Query: 86  LQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLA---ASASAEFIADIFLCPWEAIKV 142
              +  +  Y+  K     ++S     + +    L+   +S+  E  A +   P E IK 
Sbjct: 62  PSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLVRVPAEVIKQ 121

Query: 143 RQQTAVPPPFARNVFDAYSKMVGAEG----FASLYKGITPLWFRQIPYTMCKFTSFERIV 198
           R QT        + +  ++K++  E       +LY+G      R+IP+T  +F  +E   
Sbjct: 122 RTQTHK----TNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFPLYE--- 174

Query: 199 EMIYARLPTPKREMSQLGQISVSFAGGYLAGIL----CAVVSHPADVMVSKVNNERKSGE 254
              + +    KR     GQ  V+   G + G +     A  + P DV+ +++    KS  
Sbjct: 175 ---FLKKTWAKRN----GQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKS-I 226

Query: 255 STLQATSRIYGKIGFPGLWNGLAVRILMI 283
              Q    IY + GF   ++G+  R + I
Sbjct: 227 PVAQLAKNIYAEEGFKVFFSGVGPRTMWI 255

>Kwal_33.15446
          Length = 305

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 82/192 (42%), Gaps = 22/192 (11%)

Query: 20  AACTLGGLVACGPTHSAVTPLDLVKCRRQV--DA--SLYKSNLDGWRQIVRSEGATKVFT 75
           + C L G++A         P++L K + QV  DA  + Y+  LD  +++  ++G   ++ 
Sbjct: 117 SGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYK 176

Query: 76  GVGATAIGYSLQGAFKYGGYEFFKHQYSQLVS-PETAHSYRTGIFLAA------SASAEF 128
           G+ +T I +     + +G YE     +    +  +TA ++  G F A+      +  ++ 
Sbjct: 177 GLVSTLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDV 235

Query: 129 IADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTM 188
           I  + LC       +   ++     R+  +A S +    G    +KG  P + R  P   
Sbjct: 236 IKQVILC-----NDKYDGSL-----RSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANA 285

Query: 189 CKFTSFERIVEM 200
               SFE ++ +
Sbjct: 286 AALASFEFVLRV 297

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 67/176 (38%), Gaps = 13/176 (7%)

Query: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195
           P++ IKVR QT+      +   D   + +  +G    Y G TP     I           
Sbjct: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97

Query: 196 RIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGES 255
               ++   +   + ++   G I      G LAG   + ++ P ++  +K+  +  +  +
Sbjct: 98  NYRMLLKKYVYQHEEKLPLSGCI----LSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTT 153

Query: 256 T----LQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQW----LIYDSFKAAAGL 303
                L    ++Y   G  G++ GL V  L+  T   + W    L+   FKA   L
Sbjct: 154 RYRGPLDVIKKVYAADGIRGMYKGL-VSTLIFRTHFVYWWGSYELLTRWFKANTNL 208

>Scas_578.3*
          Length = 524

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/285 (19%), Positives = 105/285 (36%), Gaps = 28/285 (9%)

Query: 34  HSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYG 93
           H  +  L+L K R  +        +   R + R  G    + G G +      + + K+G
Sbjct: 252 HLRIQGLNLAKIRSPI--------IKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFG 303

Query: 94  GYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFA 153
            +E  K   + L   +  +         A   A  +A I + P + +K R Q A   P  
Sbjct: 304 TFELAKRLMANLSGDKLVNDLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCA---PLE 360

Query: 154 RNV------FDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERI----VEMIYA 203
            N+           +M    G    Y+G+        PY      +F  +    ++    
Sbjct: 361 GNLKGNALLISTAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSK 420

Query: 204 RLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSR- 262
           +L  P++++  L  + V   G + +G + A   +P +++ +++  +            R 
Sbjct: 421 KLNIPEKDV-MLSYLLVLPMGAF-SGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRD 478

Query: 263 ----IYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAGL 303
                  + G PG + GL   ++ +    S  +L Y+ FKAA  L
Sbjct: 479 VFMQTLKREGVPGFYKGLVPTLVKVCPAVSIGYLCYEKFKAAMSL 523

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/286 (18%), Positives = 112/286 (39%), Gaps = 19/286 (6%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQ--VDASLYKS--NLDGWRQIVRSEGATKVFTGVGA 79
           +GG V    +   + P DL+K R Q   D +L+ +   +   +Q+ R    + + T +G+
Sbjct: 12  IGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIRSPKQLWRGALPSSLRTSIGS 71

Query: 80  TAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIF--LAASASAEFIADIFLCPW 137
            A+  S    F+           +Q ++P ++   +  ++  LA+ A    +      P 
Sbjct: 72  -ALYLSTLNVFRTA----MAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITMPI 126

Query: 138 EAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERI 197
             IKVR ++ +     +++ +A   +   EG    + G      R  PY       +E+ 
Sbjct: 127 TIIKVRYESTMYS--YKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLYEKA 184

Query: 198 VEMIYARLPTPKREMSQLGQIS------VSFAGGYLAGILCAVVSHPADVMVSKVNNERK 251
             ++   LP+      + G  +      V+    +++  L   ++ P D + +++  +  
Sbjct: 185 KLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQLDPT 244

Query: 252 SGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSF 297
                 +    I  K  F  L++GL +R+          W IY+  
Sbjct: 245 KFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGIYEEL 290

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/293 (18%), Positives = 110/293 (37%), Gaps = 28/293 (9%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG--WRQIVRSEGATKVFTGVGATA 81
           +GG      +  A+ PLDL+K R       ++    G  W+ +   +   +++ G   +A
Sbjct: 9   IGGFAGGLSSAVALQPLDLLKTR-------FQQTKGGTLWQTVKSLDTPWQLWRGTLPSA 61

Query: 82  IGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGI-----------FLAASASAEFIA 130
           I  S+  A         +   ++    +TA S  TG             L   A A    
Sbjct: 62  IRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTV 121

Query: 131 DIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190
                P   IKVR ++ +     +++ +A   +   EG    ++G  P   R  PY+   
Sbjct: 122 GYITMPITIIKVRYESTLYN--YKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLY 179

Query: 191 FTSFERIVEMIYARLPTPKREMSQLGQ------ISVSFAGGYLAGILCAVVSHPADVMVS 244
              +E++   +   LP    ++   G+       +++     L+  +   V+ P D + +
Sbjct: 180 VLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKT 239

Query: 245 KVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSF 297
           ++  E    ++     + I  +     +++GL++R+          W IY+  
Sbjct: 240 RMQLEPTKFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEEL 292

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 39  PLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGY-EF 97
           P D +K R Q++ + +K+       IV  E   K+F+G+       +L     +G Y E 
Sbjct: 233 PFDTIKTRMQLEPTKFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEEL 292

Query: 98  FKH 100
            KH
Sbjct: 293 IKH 295

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 107/250 (42%), Gaps = 34/250 (13%)

Query: 66  RSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGI------- 118
           R +   +++ G+G   +G S+  A  +G Y   K    + +  E+A    TGI       
Sbjct: 58  RQQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESA----TGIMDRRLPA 113

Query: 119 --FLAASASAEFIADIFLCPWEAIKVR-QQTAVPPPFARNVFDAYSKMVGAEGFASLYKG 175
             ++ A+ S+     +   P   IK R   T+   P+ ++ FD   K+   EG  + ++G
Sbjct: 114 HAYMLAAGSSGIATAVLTNPIWVIKTRIMATSRAGPY-KSTFDGVYKLYQTEGVLAFWRG 172

Query: 176 ITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILC--- 232
           + P     +      F  ++ + +  Y    T K E     ++SVS     + GI C   
Sbjct: 173 VVPSLL-GVSQGAIYFALYDTL-KFHYLHSSTDKAER----RLSVS----EIIGITCISK 222

Query: 233 --AVVS-HPADVMVSKVNN-ERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTS 288
             +V S +P  ++ SK+ +    SG + L  T  +Y + G  G + GL+  +L     T 
Sbjct: 223 MISVTSVYPFQLLKSKLQDFGAPSGITQLVQT--VYSREGIRGFYRGLSANLLRAVPATC 280

Query: 289 FQWLIYDSFK 298
             + +Y++ K
Sbjct: 281 ITFFVYENIK 290

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/297 (21%), Positives = 120/297 (40%), Gaps = 32/297 (10%)

Query: 16  PEYYAACTLGGLVACGPTHSAVTPLDLVKCR-RQVDASLYKSNL-------DGWRQIVRS 67
           P +  +   GGL +      A+ PLDL+K R +Q  AS  +S L       + WR  + S
Sbjct: 9   PAHLVSGFFGGLASV----CALQPLDLLKTRLQQAQASSLRSVLREVRTTRELWRGTLPS 64

Query: 68  EGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAE 127
              T + + +  + + YS + A   G     + + S L   ++  +  TG    A+    
Sbjct: 65  ALRTSIGSALYLSLLNYS-RSALARGSEA--RTRSSLLPRLQSYQNLLTGALSRAAV--- 118

Query: 128 FIADIFLCPWEAIKVRQQTAVPPPFARN-VFDAYSKMVGAEGFASLYKGITPLWFRQIPY 186
               +   P   IKVR ++ +   +A N + +A   +  +EG    +KG      R  PY
Sbjct: 119 ---GLVTMPITVIKVRYESTL---YAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPY 172

Query: 187 TMCKFTSFERIVEMIYARLPTPKREMSQLGQIS------VSFAGGYLAGILCAVVSHPAD 240
                  +E+  EM+   LP       + G+++      V+    +L+  L   ++ P D
Sbjct: 173 AGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFD 232

Query: 241 VMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSF 297
            + +++  +       +Q    I  +     L++GL++R+          W IY+  
Sbjct: 233 TIKTRMQLQSHP-VGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEEL 288

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/252 (18%), Positives = 97/252 (38%), Gaps = 28/252 (11%)

Query: 64  IVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAAS 123
           IVR E    ++ G+    +GY       +  YE  K  Y +  +     S+      A +
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSALTAGA 227

Query: 124 ASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQ 183
            S      I++     +    +        +N  DA+ K+   EG  S Y G+ P  F  
Sbjct: 228 ISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSLF-G 286

Query: 184 IPYTMCKFTSFERIVEMIYARLPT--PKREMS----------------QLGQISVSFAGG 225
           + +    F  +E++ ++++   P+  P +E                  QLG++ V+  G 
Sbjct: 287 LLHVAIHFPVYEKLKKVLHC-YPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVASCG- 344

Query: 226 YLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIG- 284
             + ++ + +++P +++ +++  +     S        Y K G  G ++G    +     
Sbjct: 345 --SKMIASTLTYPHEILRTRLQLKSDMKPSIKSIIRTTYAKEGIRGFYSGFLTNMFRTVP 402

Query: 285 ----TLTSFQWL 292
               TL SF++ 
Sbjct: 403 ASAITLVSFEYF 414

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 76/195 (38%), Gaps = 37/195 (18%)

Query: 109 ETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTA---VPPPFAR----------- 154
           E  H   T I   + A A F+A + +CP +  K R Q     +  P  R           
Sbjct: 96  EEGHFNDTEITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGG 155

Query: 155 ----NVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKR 210
                ++   + +V  E    LYKGI P+     P  M  F+ +ER  ++ Y R      
Sbjct: 156 KYYSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYER-CKLSYPRYFNNSE 214

Query: 211 EMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSG---------ESTLQATS 261
            +S     S+S      AG +   +++P  + V K     +SG         ++TL A  
Sbjct: 215 FLSH----SMS---ALTAGAISTTLTNP--IWVVKTRLMLQSGKNIKGMTHYKNTLDAFI 265

Query: 262 RIYGKIGFPGLWNGL 276
           +IY   G    ++GL
Sbjct: 266 KIYKVEGIKSFYSGL 280

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 68/179 (37%), Gaps = 13/179 (7%)

Query: 19  YAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVG 78
           + A  + G  A   T     P+D +K R Q     + +   G+R I R  G+  V +  G
Sbjct: 5   FLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNG--GYRGIYRGLGSAVVASAPG 62

Query: 79  ATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIF--LAASASAEFIADIFLCP 136
           A+           +  Y+  K Q   ++   TA      +   + +S+  E  A +   P
Sbjct: 63  ASLF---------FVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVP 113

Query: 137 WEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195
            E IK R QT       + +        G      LY+G      R+IP+T  +F  +E
Sbjct: 114 AEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLYE 172

 Score = 28.9 bits (63), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 39  PLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
           PLD++K R  +        L   R + R EGA   F G+G   +  S  GA   G YE
Sbjct: 209 PLDVLKTRMMLHERRVP-MLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYE 265

>Kwal_0.232
          Length = 274

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 105/260 (40%), Gaps = 15/260 (5%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIG 83
           L G  A   T     P+D +K R Q     + +   G+  + R  G+  V +   A+   
Sbjct: 11  LAGAAAGTSTDLFFFPIDTLKTRLQAAGGFFANG--GYLGVYRGLGSAVVASAPSASLFF 68

Query: 84  YSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVR 143
            +  G   Y      +  ++ L++  +     T   + +S++ E  A +   P E IK R
Sbjct: 69  VTYDGMKSYS-----RPIFNNLIT-SSDQVAETATHMFSSSAGEIAACMVRVPAEVIKQR 122

Query: 144 QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA 203
            QT       + +        G     +LY+G +    R+IP+T  +F  +E + +    
Sbjct: 123 TQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFPLYEFLKKQWAI 182

Query: 204 RLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSRI 263
              +  RE  Q+     +F  G +AG + A  + P DV+ +++     S    L    +I
Sbjct: 183 ---SGGRE--QVAPWQGAFC-GCVAGGIAAATTTPLDVLKTRLMLSHTS-VPVLHLARQI 235

Query: 264 YGKIGFPGLWNGLAVRILMI 283
           Y   G+   ++G+  R + I
Sbjct: 236 YATEGWKVFFSGVGPRTVWI 255

 Score = 34.7 bits (78), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYS 85
           G VA G   +  TPLD++K R  +  +     L   RQI  +EG    F+GVG   +  S
Sbjct: 198 GCVAGGIAAATTTPLDVLKTRLMLSHTSVPV-LHLARQIYATEGWKVFFSGVGPRTVWIS 256

Query: 86  LQGAFKYGGYE 96
             GA   G YE
Sbjct: 257 AGGAIFLGVYE 267

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 71/184 (38%), Gaps = 17/184 (9%)

Query: 17  EYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTG 76
           + + A  + G  A   T  A  P+D +K R Q     + +            G   V+ G
Sbjct: 4   QMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG-----------GYKGVYRG 52

Query: 77  VGATAIGYSLQGAFKYGGYEFFK----HQYSQLVSPETAHSYRTGIFLAASASAEFIADI 132
           +G+  +  +   +  +  Y+  K        QL+      +  T   + +S+  E  A +
Sbjct: 53  LGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACM 112

Query: 133 FLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFA-SLYKGITPLWFRQIPYTMCKF 191
              P E IK R QT      +     A  +    EG   +LY+G +    R+IP+T  +F
Sbjct: 113 VRVPAEVIKQRTQTHRTNS-SLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQF 171

Query: 192 TSFE 195
             +E
Sbjct: 172 PLYE 175

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 38  TPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
           TPLD++K R  +      S L   + +++ EG    F+GVG   +  S  GA   G YE
Sbjct: 211 TPLDVLKTRIMLHHKSV-SALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYE 268

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 98/261 (37%), Gaps = 37/261 (14%)

Query: 39  PLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE-- 96
           P D  K R Q  +S+  + LD  +++V++EG    + G     +G     + ++G  E  
Sbjct: 43  PFDTTKVRLQT-SSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAM 101

Query: 97  --FFKHQYSQLVSPETA---HSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPP 151
             FF  +       ET      Y  G   A   +  F+A     P E +++R QT     
Sbjct: 102 KRFFHSRNGNSGPNETLGLLQYYLCG--FAGGTANSFLAS----PIEHVRIRLQTQTGTG 155

Query: 152 FA---RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIV----EMIYAR 204
            A       D   K+       SL +G+TP   R+       F ++E ++        +R
Sbjct: 156 AAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSR 212

Query: 205 LPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER----KSGESTLQAT 260
              P  ++   G  S         G    ++ +P DV+ S +  +     K G++ LQ  
Sbjct: 213 SEIPTWKLCLFGATS---------GTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVA 263

Query: 261 SRIYGKIGFPGLWNGLAVRIL 281
             IY   G    + G    +L
Sbjct: 264 KTIYSTRGLSSFFKGFGPTML 284

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 34/172 (19%), Positives = 70/172 (40%), Gaps = 14/172 (8%)

Query: 38  TPLDLVKCRRQVD-----ASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKY 92
           +P++ V+ R Q       A+ +   LD  +++  +     +  G+  T +  S      +
Sbjct: 139 SPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYF 195

Query: 93  GGYE-FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTA--VP 149
             YE    ++  + VS     +++  +F A S +  ++    + P + IK   QT   + 
Sbjct: 196 LTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWL---MIYPLDVIKSVMQTDSLLQ 252

Query: 150 PPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201
           P   +N+      +    G +S +KG  P   R  P     F +FE  + ++
Sbjct: 253 PKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304

>Scas_718.24
          Length = 337

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 69/180 (38%), Gaps = 38/180 (21%)

Query: 17  EYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN--------LDGWRQIVRSE 68
           +++A     G  A G +   V  LD  + R   D+   K          +D +++ ++S+
Sbjct: 144 KWFAGNLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSD 203

Query: 69  GATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEF 128
           G   ++ G   + +G  +     +G Y+  K                  + L  S    F
Sbjct: 204 GVAGLYRGFLPSVVGIIVYRGLYFGLYDSIKP-----------------VLLTGSLEGSF 246

Query: 129 IADIFL----------CPWEAIKVRQQTAVPPPFA---RNVFDAYSKMVGAEGFASLYKG 175
           +A   L          C +    VR++  +    A   +  FD + K+V AEG ASL+KG
Sbjct: 247 LASFLLGWVVTTGASTCSYPLDTVRRKMMMTSGQAVKYKGAFDCFKKIVAAEGVASLFKG 306

 Score = 31.6 bits (70), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 18  YYAACTLGGLVACGPTHSAVTPLDLVKCRRQV---DASLYKSNLDGWRQIVRSEGATKVF 74
           + A+  LG +V  G +  +  PLD V+ +  +    A  YK   D +++IV +EG   +F
Sbjct: 246 FLASFLLGWVVTTGASTCSY-PLDTVRRKMMMTSGQAVKYKGAFDCFKKIVAAEGVASLF 304

Query: 75  TGVGATAI 82
            G GA  +
Sbjct: 305 KGCGANIL 312

 Score = 31.2 bits (69), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 56/258 (21%), Positives = 98/258 (37%), Gaps = 29/258 (11%)

Query: 8   LNSPTLYSPE----YYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASL---------Y 54
           + S T+ S E     +A   L G V+     +A +P++ VK   Q    +         Y
Sbjct: 27  IQSNTIMSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKY 86

Query: 55  KSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSY 114
           K  +D +R+  + EG    + G  A  I Y    A  +   +  K  +      E  +  
Sbjct: 87  KGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFG--FKKEDGYGK 144

Query: 115 RTGIFLAASASAEFIADIFLCPWEAIKVR---QQTAVPPPFARN---VFDAYSKMVGAEG 168
                LA+  +A  ++ +F+   +  + R      +     +R    + D Y K + ++G
Sbjct: 145 WFAGNLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDG 204

Query: 169 FASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLA 228
            A LY+G  P     I Y    F  ++ I  +    L T   E    G    SF  G++ 
Sbjct: 205 VAGLYRGFLPSVVGIIVYRGLYFGLYDSIKPV----LLTGSLE----GSFLASFLLGWVV 256

Query: 229 GILCAVVSHPADVMVSKV 246
               +  S+P D +  K+
Sbjct: 257 TTGASTCSYPLDTVRRKM 274

>Kwal_33.12988
          Length = 303

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 87/208 (41%), Gaps = 20/208 (9%)

Query: 3   QKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQV------DASLYKS 56
            K +   S +L  PEYYA     G V+        TP++ V+   QV      DA  Y+ 
Sbjct: 106 HKRNNFQSTSLRLPEYYAC----GFVSGCANAFLATPIEHVRILLQVQTKSRADAE-YQG 160

Query: 57  NLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE-FFKHQYSQLVSPETAHSYR 115
            +D  +++++ EG  K+  G   T +  S      +  YE     +  + ++ +   +++
Sbjct: 161 AMDCIKKLLK-EG--KLMRGFTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWK 217

Query: 116 TGIFLAASASAEFIADIFLCPWEAIKVRQQTAV--PPPFARNVFDAYSKMVGAEGFASLY 173
             ++ A S S  +     + P++ IK   Q+     P +  NVF     +    G  +  
Sbjct: 218 LCLYGAFSGSLLWA---MVYPFDVIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFV 274

Query: 174 KGITPLWFRQIPYTMCKFTSFERIVEMI 201
           KG  P   R +P     FT+FE  + ++
Sbjct: 275 KGFGPTMLRSLPVNGATFTAFEMAMRIL 302

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 69/182 (37%), Gaps = 23/182 (12%)

Query: 37  VTPLDLVKCRRQVD---------------ASLYKSNLDGWRQIVRSEGATKVFTGVGATA 81
           +TP++L+KC+ QV                   +   +   + ++++ G   ++ G   T 
Sbjct: 125 LTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTF 184

Query: 82  IGYSLQGAFKYGGYEFFK---HQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWE 138
           I  S  G   +  YE  K        +  P   +  +T   LA+ ASA    +  + P +
Sbjct: 185 IRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPAD 244

Query: 139 AIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIV 198
            +K   QT         +  A  K+   +G    Y+G+     R IP     F  +E + 
Sbjct: 245 TVKSMMQTE-----HLGLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYETLS 299

Query: 199 EM 200
           ++
Sbjct: 300 KL 301

>Kwal_27.11419
          Length = 298

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 55/132 (41%), Gaps = 11/132 (8%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIG 83
           + G +       A  P+ ++K R +     YKS  +    I RSEG   +F+G GAT + 
Sbjct: 113 ISGAITRAAVGVATMPITVLKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMR 172

Query: 84  YSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIF----------LAASASAEFIADIF 133
            +         YE  K Q  +++         +G+F          +AA +SA  +A   
Sbjct: 173 DAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSAS-LATTI 231

Query: 134 LCPWEAIKVRQQ 145
             P++ IK R Q
Sbjct: 232 TSPFDTIKTRMQ 243

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 38  TPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
           +P D +K R Q++ S Y   +  ++ I+R E    +F G+       +L     +G YE
Sbjct: 233 SPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIYE 291

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 104/258 (40%), Gaps = 26/258 (10%)

Query: 64  IVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVS-PETAHSYRTGIFLAA 122
           + R  G    + G G  A+    + + K+G +E  K   +++ +  +T    +   F+A 
Sbjct: 268 LYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLSTFIAG 327

Query: 123 SASAEFIADIFLCPWEAIKVRQQTAVPPPFA----RNVFDAYSKMVGAEGFASL-YKGIT 177
              A   A   + P + +K R Q A  P  A    R +    +K +  EG   L Y+G+T
Sbjct: 328 GL-AGVCAQFSVYPIDTLKFRMQCA--PLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVT 384

Query: 178 PLWFRQIPYTMCKFTSFERIVEMIY---ARLPTPKREMSQLGQISVSFAGGYLAGILCAV 234
                  PY      +F  + +      A+    K E  +L  + V   G + +G   A 
Sbjct: 385 VGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAF-SGTFGAT 443

Query: 235 VSHPADVMVSKVNNE-------RKSG--ESTLQATSRIYGKIGFPGLWNGLAVRILMIGT 285
           V +P +++ +++  +       R  G  +  L+   R     G+PGL+ GL   +  +  
Sbjct: 444 VVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQRE----GYPGLFKGLVPTLAKVCP 499

Query: 286 LTSFQWLIYDSFKAAAGL 303
             S  +L Y++ K    L
Sbjct: 500 AVSISYLCYENLKKLMKL 517

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 73/192 (38%), Gaps = 18/192 (9%)

Query: 25  GGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRS------EGATKVF-TGV 77
           GGL       S V P+D +K R Q   +   + L G + ++++      EG  K+F  GV
Sbjct: 327 GGLAGVCAQFS-VYPIDTLKFRMQ--CAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGV 383

Query: 78  GATAIGYSLQGAFKYGGYEFFKHQY-----SQLVSPETAHSYRTGIFLAASASAEFIADI 132
               +G     A   G +   K  Y      +L   E        + L   A +      
Sbjct: 384 TVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGAT 443

Query: 133 FLCPWEAIKVRQQT--AVPPPFARNVF-DAYSKMVGAEGFASLYKGITPLWFRQIPYTMC 189
            + P   ++ R Q       P+  + F D   K +  EG+  L+KG+ P   +  P    
Sbjct: 444 VVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAVSI 503

Query: 190 KFTSFERIVEMI 201
            +  +E + +++
Sbjct: 504 SYLCYENLKKLM 515

>Scas_662.12
          Length = 308

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 62/307 (20%), Positives = 119/307 (38%), Gaps = 43/307 (14%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLY-KSNLDGWRQIVR----------SEG--- 69
           + GL A   T   V PLDL+K R Q+ A+   + +  G+  ++           S+G   
Sbjct: 12  ISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPIY 71

Query: 70  --ATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAE 127
               + + G+    +G ++  +  +  Y   K     +      H+  T IFL +   + 
Sbjct: 72  NLIKESYRGLPINLLGNAVAWSLYFTIYNSTK---DYMFQNNYLHNNNTTIFLTSGLISG 128

Query: 128 FIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLY--KGITPLWFRQIP 185
               +   P   IK R  +      +R+  D+Y  +    GF SL   +G   +W   +P
Sbjct: 129 ISTTLLTNPLWVIKTRIMST-----SRHHKDSYKSI--RHGFKSLLTKEGPKAIWMGLLP 181

Query: 186 YTM------CKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPA 239
             +        F  ++ +       L   K++ +      V  +   L+ +L  +  +P 
Sbjct: 182 SLLGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISS--LSKMLSVMSVYPF 239

Query: 240 DVMVSKV-------NNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWL 292
            ++ S +       NN  ++    +    +IY   G  GL+ GL+  +L     T   + 
Sbjct: 240 QLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFC 299

Query: 293 IYDSFKA 299
           IY++FK+
Sbjct: 300 IYENFKS 306

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 85/214 (39%), Gaps = 17/214 (7%)

Query: 1   MSQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQ---VDASLYKSN 57
           M++  ++ ++  L     Y A  LGG+ A      +V P+D +K R Q   ++ +L KS+
Sbjct: 305 MARLENVKDTSELSRLSTYIAGGLGGVAA----QFSVYPIDTLKYRIQCAPLNTNLKKSS 360

Query: 58  --LDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE-----FFKHQYSQLVSPET 110
             L   +++ +  G    + GV    +G     A   G +      + K +  +   PE 
Sbjct: 361 ILLQTAKEMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPED 420

Query: 111 AHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQT--AVPPPFARNVF-DAYSKMVGAE 167
                  I L   A +  +    + P   ++ R Q       P   N F D   K +  E
Sbjct: 421 EVIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQRE 480

Query: 168 GFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201
           G+  L+KG+ P   +  P     +  +E +  ++
Sbjct: 481 GYQGLFKGLVPNLAKVCPAVSISYLCYENLKRLM 514

>Kwal_56.23011
          Length = 303

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 81/193 (41%), Gaps = 18/193 (9%)

Query: 17  EYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVD-----ASLYKSNLDGWRQIVRSEGAT 71
           +YYA     G V+        TP++ V+ R Q+      A+ Y  +LD  R++++     
Sbjct: 120 QYYAC----GFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGALM 175

Query: 72  KVFTGVGATAIGYSLQGAFKYGGYE-FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIA 130
           + FT   AT +  S      +  YE    +Q    V  E   +++  ++  A + A F A
Sbjct: 176 RGFT---ATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKVCVY-GAFSGAFFWA 231

Query: 131 DIFLCPWEAIK-VRQQTAVPPP-FARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTM 188
             +  P++ +K V Q   +  P + RN       +    G  +  KG TP   R +P   
Sbjct: 232 MTY--PFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNG 289

Query: 189 CKFTSFERIVEMI 201
             F +FE  + +I
Sbjct: 290 ATFAAFEITMRLI 302

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 79/193 (40%), Gaps = 26/193 (13%)

Query: 20  AACTLGGLVACGPTHSAVTPLDLVKCRRQVD----ASLYKSNLDGWRQIVRSEGATKVFT 75
           + C + G++A         P++L K + QV      + YK  LD  ++I  ++G   ++ 
Sbjct: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK 181

Query: 76  GVGATAIGYSLQGAFKYGGYEFFKHQYSQLVS-PETAHSYRTGIFLAA------SASAEF 128
           G+ +T I +     + +G YE     + +     E A ++  G F A+      +  ++ 
Sbjct: 182 GLISTLI-FRTHFVYWWGSYELLTRWFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDV 240

Query: 129 IADIFLC--PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPY 186
           +  + LC   ++      +TAV         D Y     ++G    +KG  P + R  P 
Sbjct: 241 VKQVVLCNDKYDGSFKSWRTAVK--------DIYQ----SKGINGFFKGFVPSFLRSFPA 288

Query: 187 TMCKFTSFERIVE 199
                 +FE ++ 
Sbjct: 289 NAAALAAFEFVLR 301

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 61/164 (37%), Gaps = 9/164 (5%)

Query: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195
           P++ IKVR QT+      +   D   K    +G    Y G TP     I           
Sbjct: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102

Query: 196 RIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGES 255
               M+  +   P  E   L    +S   G LAG   + ++ P ++  +K+  +     +
Sbjct: 103 N-YRMLMHKYVYPNDEKLPLSGCIIS---GVLAGWSVSFIAPPIELAKAKLQVQYDKTTT 158

Query: 256 T----LQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
                L    +IY   G  GL+ GL +  L+  T   + W  Y+
Sbjct: 159 RYKGPLDVIKKIYSAQGIRGLYKGL-ISTLIFRTHFVYWWGSYE 201

>Kwal_27.12481
          Length = 304

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 66/181 (36%), Gaps = 38/181 (20%)

Query: 16  PEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN--------LDGWRQIVRS 67
            +++A     G  A G +   V  LD  + R   D+   K          +D +++ + S
Sbjct: 111 AKWFAGNLASGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLAS 170

Query: 68  EGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAE 127
           +G   ++ G   + +G  +     +GGY+  K                  + L  S    
Sbjct: 171 DGIAGLYRGFLPSVVGIVVYRGLYFGGYDSLKP-----------------LLLTGSLEGS 213

Query: 128 FIADIFLC------------PWEAIKVRQQTAVPPPFARN-VFDAYSKMVGAEGFASLYK 174
           F+A   L             P + ++ R           N  FDA+ K+V AEG  SL+K
Sbjct: 214 FLASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFK 273

Query: 175 G 175
           G
Sbjct: 274 G 274

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 113/304 (37%), Gaps = 58/304 (19%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQV----DASL-------------------------- 53
           L G VA    ++ V PLDLVK   Q     D  L                          
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 54  -------YKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLV 106
                  Y S  D   +I + EG   ++ G+  + +    Q    +  Y F +  Y ++ 
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 107 SPETAHSYRTGI---FLAASASAEFIADIFLCPWEAIKVRQQTAV----PPPFARNVFDA 159
                ++  T I    L   A+A   + IF  P   I  RQQT         F     + 
Sbjct: 128 LINRKNTKFTTIEELLLGIVAAA--TSQIFTNPISLISARQQTRQGIDGDNDFLTVAKEI 185

Query: 160 YSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA--RLPTPKREMSQLGQ 217
           Y +    +GF   +KG+       I  ++  +TS+E++ + ++    +   K  +    Q
Sbjct: 186 YKEQRSIKGF---WKGLKVSLMLTINPSIT-YTSYEKLKDALFTTDTMNLKKELVDSSSQ 241

Query: 218 IS--VSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGE--STLQATSRIYGKIGFPGLW 273
           +S   +F  G L+ ++ A+++ P  +++SK   +R      S  Q    +Y   G    W
Sbjct: 242 LSPYQNFTLGVLSKMISAIITMP--LIISKAWLQRNGSNFSSFQQVLYYLYKNEGLRSWW 299

Query: 274 NGLA 277
            GL+
Sbjct: 300 KGLS 303

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 31/62 (50%)

Query: 35  SAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGG 94
           +   P D +K R Q++ S + ++ + +  IV++E   K+F+G+       +      +G 
Sbjct: 239 TVTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGI 298

Query: 95  YE 96
           YE
Sbjct: 299 YE 300

>Kwal_26.7972
          Length = 358

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 62/146 (42%), Gaps = 17/146 (11%)

Query: 103 SQLVSPETAHS-YRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARN-----V 156
           +Q V   +AH   R+G+   A   A   A   + P + IK+  QT+ P     +     +
Sbjct: 16  NQSVDKRSAHYILRSGL---AGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGL 72

Query: 157 FDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLG 216
             A + +   +G    Y+G +    R  PY   KF ++E+I   +      P +E     
Sbjct: 73  IRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFM-----IPSKEYETHA 127

Query: 217 QISVSFAGGYLAGILCAVVSHPADVM 242
           +     A G +AG+    +++P D++
Sbjct: 128 R---RLASGSMAGLCSVFMTYPLDLI 150

 Score = 35.0 bits (79), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 115/308 (37%), Gaps = 50/308 (16%)

Query: 15  SPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRS------- 67
           S  Y     L G +A     + + PLD +K   Q     Y         ++R+       
Sbjct: 23  SAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAH 82

Query: 68  EGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAE 127
           +G    + G  AT I      A K+  YE  +H     + P  +  Y T     AS S  
Sbjct: 83  DGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRH----FMIP--SKEYETHARRLASGSMA 136

Query: 128 FIADIFLC-PWEAIKVR-------QQTAVPPPFARNVFDAYSKMVGAEGFA--------S 171
            +  +F+  P + I+VR        +  + P   +   +  S+ + ++ +         +
Sbjct: 137 GLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCN 196

Query: 172 LYKGITPLWFRQIPYTMCKFTSFERIVEMI-------YARLPTPKREMSQLGQISVS--- 221
            Y+G TP     IPY    F + +   +++       Y+ LP    E++   +   S   
Sbjct: 197 FYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPL 256

Query: 222 -----FAGGYLAGILCAVVSHPADVM-----VSKVNNERKSGESTLQATSR-IYGKIGFP 270
                   G LAG+     S+P +++     VS V+        T+    R IY + G+ 
Sbjct: 257 KTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWR 316

Query: 271 GLWNGLAV 278
           G + GL++
Sbjct: 317 GFFVGLSI 324

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 73/191 (38%), Gaps = 29/191 (15%)

Query: 2   SQKSSILNSPTLYSPEYYAACT--LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLD 59
           S  SS L    +Y   +  A T  L GL+          P+ ++K R +     Y S   
Sbjct: 93  STGSSYLPQLNMYENMFSGAVTRALTGLITM--------PITVIKVRYESTLYQYTSLRY 144

Query: 60  GWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLV------------S 107
               I R+EG    F G GATA    L+ A   G Y  F  +   LV            S
Sbjct: 145 ATSHIFRTEGLRGFFRGFGATA----LRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNS 200

Query: 108 PETAHSYRTGIFLAASA-SAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGA 166
                +Y + +   +SA SA  IA     P++ +K R Q  + P    +    +  +   
Sbjct: 201 DNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRMQ--LEPAKFHSFTSTFWHIATK 258

Query: 167 EGFASLYKGIT 177
           E   +L+ GI+
Sbjct: 259 ESVRNLFAGIS 269

 Score = 32.3 bits (72), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 56/286 (19%), Positives = 111/286 (38%), Gaps = 30/286 (10%)

Query: 25  GGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGY 84
           GGLV+       + P DL+K R Q D +   S L  W+ +   E  ++++ G   + I  
Sbjct: 17  GGLVSA----IILQPFDLLKTRLQQDKT---STL--WKTLKSIETPSQLWRGALPSCIRT 67

Query: 85  SLQGAFKYGGYEFFKHQYSQLVSP-----ETAHSYRTGIFLAAS----ASAEFIADIFLC 135
           S+  A     Y    +   Q +S       T  SY   + +  +    A    +  +   
Sbjct: 68  SVGSAM----YLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITM 123

Query: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195
           P   IKVR ++ +      ++  A S +   EG    ++G      R  PY       ++
Sbjct: 124 PITVIKVRYESTLYQ--YTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLYMLFYD 181

Query: 196 RIVEMIYARLPTPKREMSQLGQIS------VSFAGGYLAGILCAVVSHPADVMVSKVNNE 249
           R+  ++   LP+   +++   + S      ++ +  + A ++   ++ P D + +++  E
Sbjct: 182 RMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRMQLE 241

Query: 250 RKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
                S       I  K     L+ G+++R+          W IY+
Sbjct: 242 PAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGIYE 287

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 35/92 (38%), Gaps = 5/92 (5%)

Query: 8   LNSPTLYSPEYYAACTLGG---LVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQI 64
           LNS   YS   YA+  + G     A     S   P D VK R Q++ + + S    +  I
Sbjct: 198 LNSDNRYST--YASTLINGSSAFSAAVIATSITAPFDTVKTRMQLEPAKFHSFTSTFWHI 255

Query: 65  VRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
              E    +F G+       +      +G YE
Sbjct: 256 ATKESVRNLFAGISLRLTRKAFSAGIAWGIYE 287

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 35.8 bits (81), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 82/195 (42%), Gaps = 18/195 (9%)

Query: 20  AACTLGGLVACGPTHSAVTPLDLVKCRRQV--DA--SLYKSNLDGWRQIVRSEGATKVFT 75
           + C + G++A         P++L K + QV  DA  + Y   +D  +++  S G   ++ 
Sbjct: 159 SGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYK 218

Query: 76  GVGATAIGYSLQGAFKYGGYEFFKHQYSQLVS-PETAHSYRTGIFLAASASAEFIADIFL 134
           G+ +T I +     F +G YE     + +  +  +TA ++ +G F   SAS  F    + 
Sbjct: 219 GLTSTLI-FRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWSGGF---SASFGFWTTAY- 273

Query: 135 CPWEAIKVRQQTAVPPPFARNVFDAYS----KMVGAEGFASLYKGITPLWFRQIPYTMCK 190
            P + IK   Q  +        F ++      +    G+   +KG  P + R  P     
Sbjct: 274 -PSDVIK---QVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAA 329

Query: 191 FTSFERIVEMIYARL 205
             +FE ++    A++
Sbjct: 330 LAAFEFVLRTSGAKV 344

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 62/164 (37%), Gaps = 9/164 (5%)

Query: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195
           P++ IKVR QT+      +   D   K    +G    Y G TP     I           
Sbjct: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139

Query: 196 RIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSK--VNNERKSG 253
               M+  +      E   L    +S   G +AG   + ++ P ++  +K  V  + K+ 
Sbjct: 140 N-YRMLLKKYVYYNEEKLPLSGCIIS---GVMAGWSVSFIAAPVELAKAKLQVQYDAKTT 195

Query: 254 EST--LQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295
           + T  +    ++Y   G  GL+ GL    L+  T   F W  Y+
Sbjct: 196 KYTGPVDVIKKVYSSNGVRGLYKGLT-STLIFRTNFVFWWGSYE 238

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 74/197 (37%), Gaps = 27/197 (13%)

Query: 19  YAACTLGGLVACGPTHSAVTPLDLVKCRRQ---VDAS------LYKSNLDGWRQIVRSEG 69
           Y A  LGG++A      +V P+D +K R Q   +D        L K+  D +R     EG
Sbjct: 299 YVAGGLGGIMA----QFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYR-----EG 349

Query: 70  ATKVF-TGVGATAIGYSLQGAFKYGGYEFFKHQY-----SQLVSPETAHSYRTGIFLAAS 123
             ++F  G+G   +G     A   G +   K  Y     + L   E        + L   
Sbjct: 350 GLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMG 409

Query: 124 ASAEFIADIFLCPWEAIKVR---QQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLW 180
           A +  +    + P   ++ R   Q T   P       D + K V  EG   LYKG+ P  
Sbjct: 410 AFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTL 469

Query: 181 FRQIPYTMCKFTSFERI 197
            +  P     +  +E +
Sbjct: 470 AKVCPAVAISYLCYENL 486

 Score = 34.7 bits (78), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 61/285 (21%), Positives = 104/285 (36%), Gaps = 27/285 (9%)

Query: 38  TPLDLVKCRRQVDASLYKSNL-DGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
           TP  L+    + D +  +S L      + R  G    + G G   I    + A K+G +E
Sbjct: 216 TPEQLLHHNPRADPAKIRSPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFE 275

Query: 97  FFKHQYSQLVS-PETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARN 155
             K   + L    ET    R   ++A       +A   + P + +K R Q A      R 
Sbjct: 276 LAKRVLAGLEGCGETGELSRLSTYVAGGLGG-IMAQFSVYPIDTLKFRIQCAPLDTRCRG 334

Query: 156 V---FDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYAR----LPTP 208
           +         M    G    Y+G+        PY      +F  +      R    L   
Sbjct: 335 LPLLIKTAKDMYREGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGIS 394

Query: 209 KRE--MSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNE-------RKSG-ESTLQ 258
           + E  MS L    V    G  +G + A V +P +++ +++  +       R  G +   +
Sbjct: 395 ENEVVMSNL----VVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFR 450

Query: 259 ATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAGL 303
            T +   + G PGL+ GL   +  +    +  +L Y++ K A  L
Sbjct: 451 KTVQ---REGLPGLYKGLVPTLAKVCPAVAISYLCYENLKRAMRL 492

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 35.8 bits (81), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 74/196 (37%), Gaps = 17/196 (8%)

Query: 19  YAACTLGGLVACGPTHSAVTPLDLVKCRRQ---VDASLYKSNL--DGWRQIVRSEGATKV 73
           Y A  L G+ A      +V P+D +K R Q   +D  L  +NL     + + R  G    
Sbjct: 351 YIAGGLAGMAA----QFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLF 406

Query: 74  FTGVGATAIGYSLQGAFKYGGYEFFKHQY-----SQLVSPETAHSYRTGIFLAASASAEF 128
           + GV    +G     A   G +   K  Y       L  P+   +    + L   A +  
Sbjct: 407 YRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGT 466

Query: 129 IADIFLCPWEAIKVRQQT--AVPPPFARNVF-DAYSKMVGAEGFASLYKGITPLWFRQIP 185
           +    + P   ++ R Q       P+  N F D   K +  EG+  L+KG+ P   +  P
Sbjct: 467 VGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCP 526

Query: 186 YTMCKFTSFERIVEMI 201
                +  +E + + +
Sbjct: 527 AVSISYLCYENLKKFM 542

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 34.7 bits (78), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 32/163 (19%), Positives = 71/163 (43%), Gaps = 6/163 (3%)

Query: 115 RTGIFLAASASAEFIADIFLCPWEAIKVRQQT-AVPPPFARNVFDAYSKMVGAEGFASLY 173
            + I   A   A  ++   + P+E +K+  Q  +    +   + +A  ++   EG A L+
Sbjct: 10  ESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLF 69

Query: 174 KGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCA 233
           +G      R  PY+  +F  +E   + I+    T  +E     Q     + G L G +  
Sbjct: 70  RGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQ---RLSAGALCGGMSV 126

Query: 234 VVSHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGL 276
           + ++P D++ ++++ +  +     ++ ++   K   PG+W  L
Sbjct: 127 LATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKP--PGVWELL 167

>Scas_714.18
          Length = 305

 Score = 35.0 bits (79), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 45/228 (19%), Positives = 93/228 (40%), Gaps = 41/228 (17%)

Query: 2   SQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGW 61
           +Q SS LN+ T +S       + G   +C      +TP++L+KC+ Q+ ++L+ S  D  
Sbjct: 91  NQCSSFLNAFTEFSAFLIILISAGFAGSCASF--VLTPVELIKCKLQI-SNLHYSLHDND 147

Query: 62  ---------------------------RQIVRSEGATKVFTGVGATAIGYSLQGAFKYGG 94
                                      + I++ +G   ++ G  +T I  S+     +  
Sbjct: 148 GEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFAT 207

Query: 95  YEFFKHQYSQLVSPETAHSYRTGIFLA-ASASAEFIADIFLCPWEAIKVRQQTAVPPPFA 153
           YE  K     L  P++  +    + ++ A+A   F   +F  P + +K   QT       
Sbjct: 208 YELMKQ---TLRDPKSEVNTTWQLLISGATAGLAFNGSVF--PADTVKSIMQTE-----H 257

Query: 154 RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201
             + +    ++  +G A  Y+G+     R +P     F ++E++ +++
Sbjct: 258 LALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTYEKLSKIL 305

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 84/217 (38%), Gaps = 22/217 (10%)

Query: 1   MSQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQ---VDASLYKSN 57
           M+    + ++  L     Y A  +GG+VA      +V P+D +K R Q   +D +L  + 
Sbjct: 301 MAHLEGVHHTSELSKFSTYIAGGMGGVVA----QFSVYPIDTLKYRVQCAPLDTALKGNE 356

Query: 58  L--DGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFK-----HQYSQLVSPET 110
           L     RQ+ R  G    + GV    +G     A   G +   K      Q      P  
Sbjct: 357 LLISTARQMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVD 416

Query: 111 AHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ---TAVPPPFARNVFDAYSKMVGAE 167
             +    I L   A +  +    + P   ++ R Q   T   P       D   K V  E
Sbjct: 417 QVTISNFIVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQRE 476

Query: 168 GFASLYKGITPLWFRQIPYT----MCKFTSFERIVEM 200
           G+  L+KG+ P   +  P      +C + +F+R++++
Sbjct: 477 GYQGLFKGLVPNLAKVCPAVSISYLC-YENFKRLMKL 512

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 49/248 (19%), Positives = 93/248 (37%), Gaps = 16/248 (6%)

Query: 64  IVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVS-PETAHSYRTGIFLAA 122
           + R  G    + G G   I    + A K+G +E  K   + L     T+   +   ++A 
Sbjct: 263 LYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFSTYIAG 322

Query: 123 SASAEFIADIFLCPWEAIKVRQQTA-VPPPFARN--VFDAYSKMVGAEGFASLYKGITPL 179
                 +A   + P + +K R Q A +      N  +     +M    G    Y+G+T  
Sbjct: 323 GMGG-VVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGVTVG 381

Query: 180 WFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVS----FAGGYLAGILCAVV 235
                PY      +F  + +   AR    K     + Q+++S       G  +G + A V
Sbjct: 382 VMGIFPYAALDLGTFSALKKWYIAR--QAKMTGVPVDQVTISNFIVLPMGAFSGTVGATV 439

Query: 236 SHPADVMVSKVNNERKSGESTLQATSR-----IYGKIGFPGLWNGLAVRILMIGTLTSFQ 290
            +P +++ +++  +            R        + G+ GL+ GL   +  +    S  
Sbjct: 440 VYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPAVSIS 499

Query: 291 WLIYDSFK 298
           +L Y++FK
Sbjct: 500 YLCYENFK 507

>Kwal_34.15907
          Length = 312

 Score = 34.7 bits (78), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 60/141 (42%), Gaps = 4/141 (2%)

Query: 143 RQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEM-- 200
           + ++AV     ++ + A+ ++   EG   + KG+  +  RQ+     +F    R+VE   
Sbjct: 140 KAKSAVAGAIPQSSWSAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRF-GLSRLVEQGI 198

Query: 201 -IYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQA 259
             +     P  +++ L +I  S  GG L+     +     ++   K +  R    +   A
Sbjct: 199 RDFTGKTNPDDKLTALEKIFASALGGGLSAWNQPIEVIRVEMQSKKEDPNRPKKLTVGSA 258

Query: 260 TSRIYGKIGFPGLWNGLAVRI 280
              IY   G  GL+ G+A RI
Sbjct: 259 FKYIYQSSGIKGLYRGVAPRI 279

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/145 (20%), Positives = 58/145 (40%), Gaps = 9/145 (6%)

Query: 40  LDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFK 99
           +++ K +  V  ++ +S+   +++I   EG   +  GV A AI        ++G     +
Sbjct: 136 VEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVE 195

Query: 100 H---QYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPF---A 153
                ++   +P+   +    IF +A          +  P E I+V  Q+    P     
Sbjct: 196 QGIRDFTGKTNPDDKLTALEKIFASALGGG---LSAWNQPIEVIRVEMQSKKEDPNRPKK 252

Query: 154 RNVFDAYSKMVGAEGFASLYKGITP 178
             V  A+  +  + G   LY+G+ P
Sbjct: 253 LTVGSAFKYIYQSSGIKGLYRGVAP 277

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 34.7 bits (78), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 72/173 (41%), Gaps = 16/173 (9%)

Query: 38  TPLDLVKCRRQVDA-----SLYKSNLDGWRQIVRSEGATKVFTG-VGATAIGYSLQGAFK 91
           TP++ V+ R Q+       + Y+ +LD  R++++     + FT  +  T  G+ +     
Sbjct: 137 TPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQGALMRGFTATLMRTCHGFGIY---- 192

Query: 92  YGGYE-FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTA--V 148
           +  YE    +Q+ + +  +    ++  IF A S +  +       P + +K   Q+   V
Sbjct: 193 FSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWA---MAYPIDVVKSIMQSDRLV 249

Query: 149 PPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201
            P    NV+     +    G  +  KG  P   R +P     F +FE  + ++
Sbjct: 250 SPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMRLL 302

>Kwal_55.21338
          Length = 323

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 113/261 (43%), Gaps = 40/261 (15%)

Query: 39  PLDLVKCRRQV-DASLYKSNL-DGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96
           PL +V  + Q  DA   K +L D  + I R +GA   F G+ +   G +L     Y  YE
Sbjct: 42  PLIVVTTKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYE 101

Query: 97  -----FFKHQYSQLVSPETAHSYRTGIFL----AASASAEFIADIFLCPWEAIKVRQQTA 147
                  + +++Q ++  TA S   G       A +A+  ++A+  +   ++ +    T 
Sbjct: 102 ASSRCVLRARHTQRLT--TAESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGTLST- 158

Query: 148 VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPT 207
                   +FD    +V  EG + L+KG+ P     I   + ++T +E++   I +   T
Sbjct: 159 --------IFD----IVKDEGISGLFKGLNPALILVIN-PIIQYTVYEQLKNWILSSRQT 205

Query: 208 PKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVN--NERKSG-----ESTLQAT 260
             R +S     S +F  G +  +     ++P   M ++++   E KS       S L   
Sbjct: 206 --RTLSP----SWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLM 259

Query: 261 SRIYGKIGFPGLWNGLAVRIL 281
           + I  K G  GL+ G+ ++++
Sbjct: 260 AEIIKKDGILGLYRGIGIKLV 280

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 34.3 bits (77), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 18  YYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASL---YKSNLDGWRQIVRSEGATKVF 74
           + A+  LG ++  G + +A  PLD V+ R  + +     Y   LD  R+IV+ EGA  +F
Sbjct: 218 FVASFLLGWVITMGAS-TASYPLDTVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSLF 276

Query: 75  TGVGAT 80
            G GA 
Sbjct: 277 KGCGAN 282

 Score = 31.6 bits (70), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 77/207 (37%), Gaps = 24/207 (11%)

Query: 109 ETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVP-------PPFARNVFDAYS 161
           +T  S+    FL    SA  IA     P E +K+  Q               + + D + 
Sbjct: 7   QTQQSHFGVDFLMGGVSAA-IAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFK 65

Query: 162 KMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVS 221
           +    EG  S ++G T    R  P     F   ++I  ++     +  RE     +    
Sbjct: 66  RTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLL-----SYDRERDGYAKWFAG 120

Query: 222 --FAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQ----ATSRIYGKI----GFPG 271
             F+GG  AG L  +  +  D   +++  + +  +ST Q        +Y K     G  G
Sbjct: 121 NLFSGG-AAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLG 179

Query: 272 LWNGLAVRILMIGTLTSFQWLIYDSFK 298
           L+ G    +L I       + +YDSFK
Sbjct: 180 LYRGFVPSVLGIIVYRGLYFGLYDSFK 206

>Scas_667.4
          Length = 308

 Score = 34.3 bits (77), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 18  YYAACTLGGLVACGPTHSAVTPLDLVKCRRQV---DASLYKSNLDGWRQIVRSEGATKVF 74
           + A+  LG +V  G + +A  PLD V+ R  +    A  Y    D +R++V +EG + +F
Sbjct: 217 FLASFLLGWIVTTGAS-TASYPLDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLF 275

Query: 75  TGVGATAI 82
            G GA  +
Sbjct: 276 KGCGANIL 283

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 65/181 (35%), Gaps = 40/181 (22%)

Query: 17  EYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDAS--------LYKSNLDGWRQIVRSE 68
           +++A     G  A G +   V  LD  + R   DA          YK  +D ++Q + ++
Sbjct: 115 KWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATD 174

Query: 69  GATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEF 128
           G   ++ G   + +G  +     +G Y+  K        P        G FLA+      
Sbjct: 175 GMAGLYRGFLPSVVGIIVYRGLYFGLYDSLK--------PAVLTGSLEGSFLAS------ 220

Query: 129 IADIFLCPWEAIKVRQQTAVPPPFARN--------------VFDAYSKMVGAEGFASLYK 174
               FL  W         + P    R                FD + K+V AEG +SL+K
Sbjct: 221 ----FLLGWIVTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLFK 276

Query: 175 G 175
           G
Sbjct: 277 G 277

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 61/141 (43%), Gaps = 4/141 (2%)

Query: 143 RQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIY 202
           ++++A      ++ + A+ ++   +G   + KG+  +  RQ+     +F  F R+VE   
Sbjct: 140 KKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNAVAIRQMTNWGSRF-GFSRLVEEGI 198

Query: 203 ARLP---TPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQA 259
                   P  +++ L +I+ S  GG L+     +     ++   K +  R    +   A
Sbjct: 199 RNATGKTNPDDKLTALEKIAASAIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVSSA 258

Query: 260 TSRIYGKIGFPGLWNGLAVRI 280
              IY   G  GL+ G+A RI
Sbjct: 259 FKYIYQSSGIKGLYRGVAPRI 279

>Kwal_27.12599
          Length = 304

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 83/193 (43%), Gaps = 20/193 (10%)

Query: 12  TLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDAS-----LYKSNLDGWRQIVR 66
           TL  P+YY    +GG+          +P++ V+ R Q   +      +K  LD   ++ R
Sbjct: 116 TLTLPQYYICGFVGGVA----NSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-R 170

Query: 67  SEGATKVFTGVGATAIGYSLQGAFKYGGYE-FFKHQYSQLVSPETAHSYRTGIFLAASAS 125
           + GA  +  G+  T +  +   A  +  YE    +Q  + ++     +++  +F A S  
Sbjct: 171 ANGA--LMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGV 228

Query: 126 AEFIADIFLCPWEAIKVRQQTA--VPPPFARNVFDAYSKMVGAE-GFASLYKGITPLWFR 182
             ++    + P + IK   QT     P   +N+    +++V A+ G+ S +KG  P   R
Sbjct: 229 TLWLT---VYPLDVIKSLMQTDNLKNPVRGKNIIQV-ARLVNAKYGWKSFFKGFGPTMLR 284

Query: 183 QIPYTMCKFTSFE 195
             P     F +FE
Sbjct: 285 AAPANGATFATFE 297

 Score = 31.6 bits (70), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 41/103 (39%), Gaps = 5/103 (4%)

Query: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKG-ITPLWFRQIPYTMCKFTSF 194
           P++  KVR QT+  P  A  V     K+V  EG    YKG +TPL       + C+F   
Sbjct: 44  PFDTTKVRLQTSTTPTTAVEV---VKKLVKNEGLRGFYKGTLTPLVGVGACVS-CQFGVN 99

Query: 195 ERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSH 237
           E +          P + ++        F GG     L + + H
Sbjct: 100 EAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEH 142

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 60/152 (39%), Gaps = 34/152 (22%)

Query: 130 ADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGA--------------EGFASLYKG 175
           A   + P + IK+  QT+ P          Y+K  G+              +G    ++G
Sbjct: 47  AKTLIAPLDRIKILFQTSNP---------HYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 176 ITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVV 235
            +    R  PY   KF ++E+I   +      P +E     +  VS   G LAG+    +
Sbjct: 98  HSATLLRIFPYAAVKFVAYEQIRNTL-----IPSKEFESHWRRLVS---GSLAGLCSVFI 149

Query: 236 SHPADVMVSKVNNERKSGESTLQATSRIYGKI 267
           ++P D++  ++  E +     L    RI  KI
Sbjct: 150 TYPLDLVRVRLAYETEHKRVKL---GRIIKKI 178

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 18  YYAACTLGGLVACGPTHSAVTPLDLVKCRRQV---DASLYKSNLDGWRQIVRSEGATKVF 74
           + A+  LG  V  G + +A  PLD V+ R  +    A  Y    D +R+IV +EG   +F
Sbjct: 214 FIASFLLGWAVTTGAS-TASYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKSLF 272

Query: 75  TGVGATAI 82
            G GA  +
Sbjct: 273 KGCGANIL 280

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 65/181 (35%), Gaps = 40/181 (22%)

Query: 17  EYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN--------LDGWRQIVRSE 68
           +++A     G  A G +   V  LD  + R   D+   K          +D +++ + S+
Sbjct: 112 KWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASD 171

Query: 69  GATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEF 128
           G   ++ G   + +G  +     +G Y+  K                  + L  +  + F
Sbjct: 172 GIAGLYRGFLPSVVGIVVYRGLYFGMYDSLKP-----------------LLLTGNLESSF 214

Query: 129 IADIFLCPWEAIKVRQQTAVPPPFARN--------------VFDAYSKMVGAEGFASLYK 174
           IA  FL  W         + P    R                FDA+ K+V AEG  SL+K
Sbjct: 215 IAS-FLLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKSLFK 273

Query: 175 G 175
           G
Sbjct: 274 G 274

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 5/85 (5%)

Query: 13  LYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQ-VDASLYKSNLDGWRQIVRSEGAT 71
           L S + +    L G+V    T  A  P+D VK R Q +DA+ Y S +  +R +VR EG  
Sbjct: 209 LGSGQTFLVGALSGIV----TVYATMPVDTVKTRMQALDAARYGSTVGCFRAVVREEGVR 264

Query: 72  KVFTGVGATAIGYSLQGAFKYGGYE 96
            ++ G         L G   +  YE
Sbjct: 265 ALWRGATPRLGRLVLSGGIVFTAYE 289

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 97/226 (42%), Gaps = 16/226 (7%)

Query: 63  QIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAA 122
           +  R++GA  ++ G  A  +G + +   ++ G++  +     L     A S   G+ LA 
Sbjct: 57  RTARTQGAGALYVGCPAFVVGNTCKAGVRFLGFDALRRA---LQDERGALSGPRGM-LAG 112

Query: 123 SASAEFIADIFLCPWEAIKV---RQQTAVPPPFARNVFDA---YSKMVGAEGFASLYKGI 176
             +    + + + P+EA+K      + A  P +  N   A   Y+ ++   G   LY G+
Sbjct: 113 LGAGLLESVLAVTPFEAVKTALIDDRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGL 172

Query: 177 TPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVS 236
            P+  RQ      +F  + ++ + +     TP  +    GQ   +F  G L+GI+    +
Sbjct: 173 VPVALRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQ---TFLVGALSGIVTVYAT 229

Query: 237 HPADVMVSKVN--NERKSGESTLQATSRIYGKIGFPGLWNGLAVRI 280
            P D + +++   +  + G ST+     +  + G   LW G   R+
Sbjct: 230 MPVDTVKTRMQALDAARYG-STVGCFRAVVREEGVRALWRGATPRL 274

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/113 (19%), Positives = 44/113 (38%), Gaps = 1/113 (0%)

Query: 89  AFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAV 148
           A ++G Y   K    +           +G      A +  +      P + +K R Q   
Sbjct: 184 AVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQALD 243

Query: 149 PPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201
              +   V   +  +V  EG  +L++G TP   R +      FT++E+++ ++
Sbjct: 244 AARYGSTV-GCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLLVLL 295

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 18  YYAACTLGGLVACGPTHSAVTPLDLVKCRRQV---DASLYKSNLDGWRQIVRSEGATKVF 74
           + A+  LG  V  G + +A  PLD V+ R  +    A  Y    D +R+IV +EG   +F
Sbjct: 214 FLASFLLGWAVTTGAS-TASYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGIKSLF 272

Query: 75  TGVGATAI 82
            G GA  +
Sbjct: 273 KGCGANIL 280

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 60/148 (40%), Gaps = 14/148 (9%)

Query: 37  VTPLDLVKCRRQVDASLYKSN--------LDGWRQIVRSEGATKVFTGVGATAIGYSLQG 88
           V  LD  + R   D+   K          +D +++ + S+G   ++ G   + +G  +  
Sbjct: 132 VYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYR 191

Query: 89  AFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAV 148
              +G Y+  K     L++    +S+     L  + +    A     P + ++ R     
Sbjct: 192 GLYFGLYDSLK---PLLLTGSLENSFLASFLLGWAVTTG--ASTASYPLDTVRRRMMMTS 246

Query: 149 PPPFARN-VFDAYSKMVGAEGFASLYKG 175
                 +  FDA+ K+V AEG  SL+KG
Sbjct: 247 GQAVKYDGAFDAFRKIVAAEGIKSLFKG 274

>Scas_667.22
          Length = 306

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 80/191 (41%), Gaps = 25/191 (13%)

Query: 119 FLAASASAEFIADIFLC-PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKG-I 176
            LA +A    IA + +  P++  KVR QT+  P  A  V     K  G +GF   YKG +
Sbjct: 29  LLAGTAGG--IAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGF---YKGTL 83

Query: 177 TPLWFRQIPYTMC---KFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCA 233
           TPL    I    C   +F   E +    ++R P    ++  L Q  +    G   GI  +
Sbjct: 84  TPL----IGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYIC---GLTGGITNS 136

Query: 234 VVSHPADVMVSKVNNERKSGEST-----LQATSRIYGKIGFPGLWNGLAVRILMIGTLTS 288
            ++ P + +  ++  +  SG +      L    ++  + GF     GL   +L  G    
Sbjct: 137 FLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGF---MRGLTPTMLREGHGCG 193

Query: 289 FQWLIYDSFKA 299
             +L+Y++  A
Sbjct: 194 TYFLVYEAMVA 204

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 78/199 (39%), Gaps = 14/199 (7%)

Query: 10  SPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVD-ASLYKSNLDGWRQIVRSE 68
           S TL  P+YYA    GG+V         +P++ V+ R Q    S   +   G  + ++  
Sbjct: 115 SSTLSLPQYYACGVTGGIV----NSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKL 170

Query: 69  GATK-VFTGVGATAIGYSLQGAFKYGGYE-FFKHQYSQLVSPETAH--SYRTGIFLAASA 124
              K +  G+  T +         +  YE    +Q ++    E     +++  IF A S 
Sbjct: 171 RHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSG 230

Query: 125 SAEFIADIFLCPWEAIKVRQQTA--VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFR 182
           +A ++    + P + IK   QT     P F  ++      +    G  + +KG  P   R
Sbjct: 231 TALWL---MVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLR 287

Query: 183 QIPYTMCKFTSFERIVEMI 201
             P     F +FE  + ++
Sbjct: 288 AAPANGATFATFELAMRLL 306

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 71/173 (41%), Gaps = 23/173 (13%)

Query: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKG-ITPLWFRQIPYTMC---KF 191
           P++  KVR QT+  P  A  V     K++  EG    YKG +TPL    I    C   +F
Sbjct: 45  PFDTTKVRLQTSSTPTTAMEVV---RKLLANEGPRGFYKGTLTPL----IGVGACVSLQF 97

Query: 192 TSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERK 251
              E +    + R      +MS    +   +A G   GI+ + ++ P + +  ++  +  
Sbjct: 98  GVNEAMKRFFHHR----NADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTG 153

Query: 252 SGEST-----LQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKA 299
           SG +      L+   ++        L  GL   IL  G      +L+Y++  A
Sbjct: 154 SGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYFLVYEALIA 203

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 65/322 (20%), Positives = 119/322 (36%), Gaps = 44/322 (13%)

Query: 15  SPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRS------- 67
           S +Y     L G +A     + V PLD +K   Q     +         +VR+       
Sbjct: 15  SVDYIVKSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAH 74

Query: 68  EGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAE 127
           +G    F G  AT +      A K+  YE    Q   +V P   H       L+ S +  
Sbjct: 75  DGPRGFFQGHSATLLRIFPYAAIKFIAYE----QIRSVVIPTWRHESHWRRLLSGSLAG- 129

Query: 128 FIADIFLC-PWEAIKVRQQ--TAVPPPFARNVF---------DAYSKMVGAEGFA---SL 172
            +  +F+  P + ++VR    T       R +          +A  K    + FA   + 
Sbjct: 130 -LCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNF 188

Query: 173 YKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLG----------QISVSF 222
           Y+G TP     IPY    F + +   ++    +  P   +S  G          +     
Sbjct: 189 YRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQL 248

Query: 223 AGGYLAGILCAVVSHPADVM-----VSKVNNERKSGESTLQATSRI-YGKIGFPGLWNGL 276
             G LAG+     ++P +++     VS + +  +     +   ++I Y + G+ G + GL
Sbjct: 249 VAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGL 308

Query: 277 AVRILMIGTLTSFQWLIYDSFK 298
           ++  + +  + +  + IY+  K
Sbjct: 309 SIGYIKVTPMVACSFFIYERTK 330

>Scas_718.5
          Length = 324

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/68 (20%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 136 PWEAIK--VRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193
           P + +K  ++  T   P F  ++ +  + +   +G ++ +KG  P   R  P     F +
Sbjct: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVT 315

Query: 194 FERIVEMI 201
           FE ++ ++
Sbjct: 316 FELVMRLL 323

>Scas_328.1
          Length = 227

 Score = 32.3 bits (72), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 10  SPTLYSPEYYAACTLGGLVACGPTHSAVT---PLDLVKCRRQV---DASLYKSNLDGWRQ 63
            P L +  +  A     L+    T SA T   PLD V+ R  +    A  YK  +D ++Q
Sbjct: 124 KPVLLTGSFENAFLPSFLLGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQ 183

Query: 64  IVRSEGATKVFTGVGAT 80
           IV  EG   +F G GA 
Sbjct: 184 IVSQEGVYSLFKGCGAN 200

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 67/174 (38%), Gaps = 19/174 (10%)

Query: 19  YAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG--------WRQIVRSEGA 70
           + A  +GG+   G    A   +    C + V+ + +KS   G        +++I   EG 
Sbjct: 105 FGAGIMGGV--SGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKEIYNKEGI 162

Query: 71  TKVFTGVGATAIGYSLQGAFKYGGYEFFKH---QYSQLVSPETAHSYRTGIFLAASASAE 127
             +  GV A AI        ++G     +    +++   +P+   +    IF +A     
Sbjct: 163 RGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGG- 221

Query: 128 FIADIFLCPWEAIKVRQQTAVPPPF---ARNVFDAYSKMVGAEGFASLYKGITP 178
                +  P E I+V  Q+    P       V  A+  +  + G   LY+G+TP
Sbjct: 222 --LSAWNQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKGLYRGVTP 273

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 49/264 (18%), Positives = 104/264 (39%), Gaps = 20/264 (7%)

Query: 21  ACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGAT 80
           A +LGG  +   T+    PL  +    Q   +  +  L+  ++I    G    F G+ + 
Sbjct: 17  AGSLGGAASIAVTY----PLVTITTNLQTKENEARPKLETIKEIYNKNGIIGYFLGLESA 72

Query: 81  AIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAI 140
             G +      Y  YE+       L + +   ++ +   LA++ +    A      W A 
Sbjct: 73  VYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWES--ILASTIAGSMTAVASNPIWVAN 130

Query: 141 KVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEM 200
                        R V D    +V  +G  +L  G+ P     +   + ++T +E++  +
Sbjct: 131 TRMTVAKSNHSTLRTVID----IVKTDGPLTLLNGLKPA-LVLVSNPIIQYTVYEQLKNL 185

Query: 201 IYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVN---NERKSGESTL 257
           +       + +  ++   S +F  G +  +     ++P   + ++++   N+ K  +S  
Sbjct: 186 VL------RLQRKKVLSPSWAFLLGAIGKLAATGTTYPYITLKTRMHLMQNDPKHQKSMW 239

Query: 258 QATSRIYGKIGFPGLWNGLAVRIL 281
                I  K G  GL+NG+AV+++
Sbjct: 240 SLIVEIVKKDGVSGLYNGVAVKLV 263

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 31.6 bits (70), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 66/185 (35%), Gaps = 42/185 (22%)

Query: 16  PEYYAACTLGGLVACGPTHSA----VTPLDLVKCRRQVD--------ASLYKSNLDGWRQ 63
            E YA    G L + G   +     V  LD  + R   D        A  +   +D +++
Sbjct: 120 EEGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKK 179

Query: 64  IVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAAS 123
            ++S+G   ++ G   + +G  +     +G Y+  K                  + L  S
Sbjct: 180 TLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKP-----------------LLLTGS 222

Query: 124 ASAEFIADIFL----------CPWEAIKVRQQTAVPPPFA---RNVFDAYSKMVGAEGFA 170
               F+A   L          C +    VR++  +    A      FD   K+V AEG  
Sbjct: 223 LEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVG 282

Query: 171 SLYKG 175
           SL+KG
Sbjct: 283 SLFKG 287

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 49/236 (20%), Positives = 87/236 (36%), Gaps = 29/236 (12%)

Query: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN---------LDGWRQIVRSEGATKVF 74
           L G V+     +A +P++ VK   Q    + K           LD +++    EG    +
Sbjct: 28  LMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFW 87

Query: 75  TGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIF--LAASASAEFIADI 132
            G  A  I Y    A  +     FK +   +   +    Y       LA+  +A  ++ +
Sbjct: 88  RGNTANVIRYFPTQALNFA----FKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSLL 143

Query: 133 FLCPWEAIKVR---QQTAVPPPFARN---VFDAYSKMVGAEGFASLYKGITPLWFRQIPY 186
           F+   +  + R      +     AR    + D Y K + ++G A LY+G  P     + Y
Sbjct: 144 FVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVY 203

Query: 187 TMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVM 242
               F  ++ +  +    L T   E    G    SF  G++     +  S+P D +
Sbjct: 204 RGLYFGMYDSLKPL----LLTGSLE----GSFLASFLLGWVVTTGASTCSYPLDTV 251

>Kwal_23.2913
          Length = 320

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 67/191 (35%), Gaps = 8/191 (4%)

Query: 5   SSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQI 64
           + I  S +  +P   +   L G  +  PT     P + VK   Q   S   S L   R +
Sbjct: 127 TDIAGSSSKLTPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSES--GSFLGAARTL 184

Query: 65  VRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASA 124
           +R  G   +F G  AT        A  +  YE  K   S+    +   +        A  
Sbjct: 185 IREGGVRSLFQGTLATLARDGPGSALYFASYEVSKRFLSR---NQDTDALSVVSICVAGG 241

Query: 125 SAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQI 184
            A     I + P + IK + Q++     ++++  A  ++    G    + G+ P   R  
Sbjct: 242 VAGMSMWIGVFPIDTIKTKLQSS---SRSQSMVQAAREIYTRAGLRGFFPGLGPALMRSF 298

Query: 185 PYTMCKFTSFE 195
           P     F   E
Sbjct: 299 PANAATFLGVE 309

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 31.2 bits (69), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 63/280 (22%), Positives = 106/280 (37%), Gaps = 39/280 (13%)

Query: 26  GLVACGPTHSAVTPLDLVKCRRQV-----------DASLYKSNLDGWRQIVRSEGATKVF 74
           G VA     + V PLDL K   Q            +   YK+ +D   +I +  G   ++
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 75  TGVGATAIGYSLQGAFKY--------GGYEFFKHQYSQLVSPETAHSYRTGIFLAASASA 126
            G+ AT +  +    F Y          Y  FK    QL          T   LA   SA
Sbjct: 70  QGL-ATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSA 128

Query: 127 EFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLW--FRQI 184
             +  +   P   I  RQQ        ++  DA  K V  + +      +T  W  F+ +
Sbjct: 129 GAMTQVVTNPISVISTRQQ------LTKDGEDASLKAVIKQIYEESNGDLTAFWKGFK-V 181

Query: 185 PYTM-----CKFTSFERIVEMIY-ARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHP 238
              +       + S++++  MI  A+  +  +++S       +F  G  + ++   V+ P
Sbjct: 182 ALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQP 241

Query: 239 ADVMVSKVNNERKSGE-STLQAT-SRIYGKIGFPGLWNGL 276
             ++V+K+  + K  +  T Q     IY   GF  LW G+
Sbjct: 242 --LIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGV 279

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 11/67 (16%)

Query: 225 GYLAGILCAVVSHPADVMVSKVNNERKSGES-----------TLQATSRIYGKIGFPGLW 273
           G +A  L A   +P D+  + +  + K+ +S            +    +I+ K GF GL+
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 274 NGLAVRI 280
            GLA  +
Sbjct: 70  QGLATNV 76

>Scas_696.9
          Length = 312

 Score = 31.2 bits (69), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 67/152 (44%), Gaps = 18/152 (11%)

Query: 138 EAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERI 197
           E  +++  +A  P   ++ ++ +  +   EG   +YKG+  +  RQ+     +F  F R+
Sbjct: 137 EITRLKSASAGAP--VQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRF-GFSRL 193

Query: 198 VEMIYARLPT----PKREMSQLGQISVSFAGGYLAGILCAVVSHPADV----MVSKVNNE 249
           VE  + R  T    P+  ++   +I  +  GG L+       + P +V    M SK  + 
Sbjct: 194 VE-DWVRKATGKTKPEDRLNAWEKIGATAVGGGLSAW-----NQPIEVIRVEMQSKKEDP 247

Query: 250 RKSGESTLQATSR-IYGKIGFPGLWNGLAVRI 280
            +    T+  T + I    G  GL+ G+  RI
Sbjct: 248 NRPKNLTVAKTFKYIMKTNGVKGLYRGVTPRI 279

>Kwal_23.3042
          Length = 542

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 82/213 (38%), Gaps = 23/213 (10%)

Query: 1   MSQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG 60
           M+Q   + ++  L     Y A  LGG++A      +V P+D +K R Q      +S    
Sbjct: 330 MAQLEGVQDTAGLSRFSTYLAGGLGGVMA----QLSVYPIDTLKYRVQCAPLNTESK--- 382

Query: 61  WRQIVRS-------EGATKVF-TGVGATAIGYSLQGAFKYGGYEFFKHQY----SQLVS- 107
            RQ++ S       EG  ++F  G+    +G     A   G +   K  Y    ++L   
Sbjct: 383 GRQLLISTAKDMYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGL 442

Query: 108 PETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQT--AVPPPFARNVF-DAYSKMV 164
           PE   +      L   A +  +    + P   ++ R Q       P   N F D   K V
Sbjct: 443 PEDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTV 502

Query: 165 GAEGFASLYKGITPLWFRQIPYTMCKFTSFERI 197
             EG+  L+KG+ P   +  P     +  +E +
Sbjct: 503 QREGYQGLFKGLVPNLAKVCPAVSISYLCYENL 535

>Scas_717.20
          Length = 356

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 64/338 (18%), Positives = 130/338 (38%), Gaps = 58/338 (17%)

Query: 15  SPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDA---SLYKSNLDGWRQIVR----S 67
           S EY     L G ++     + + PLD +K   Q      + Y  +L G ++  +    +
Sbjct: 28  SLEYITRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLN 87

Query: 68  EGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAE 127
           +G    F G   T +      A K+  YE  ++  + + S E    +R       S S  
Sbjct: 88  DGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRN--TLIPSKEYESHWRR----LMSGSLA 141

Query: 128 FIADIFLC-PWEAIKVRQQTAVPPP------FARNVF-DAYSKMVGAEGF--------AS 171
            +  +F   P + I+VR                + ++ +  S  + A+G+         +
Sbjct: 142 GLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCN 201

Query: 172 LYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTP----------------KREMSQL 215
            Y+G TP     IPY    F + + + +++   +  P                K +   L
Sbjct: 202 FYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPL 261

Query: 216 GQISVSFAGGYLAGILCAVVSHPADVM----------VSKVNNERKSGESTLQATSRIYG 265
              +   +GG LAG+     ++P +++          VS++ + R   +S  +    IY 
Sbjct: 262 RTWAELLSGG-LAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHR--FQSISEIAKIIYK 318

Query: 266 KIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAGL 303
           + G+ G + GL++  + +  + +  + +Y+  K   G+
Sbjct: 319 ERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHLGI 356

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 67/186 (36%), Gaps = 21/186 (11%)

Query: 10  SPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASL---------YKSNLDG 60
           S T      +A   L G V+     +A +P++ VK   Q    +         YK  +D 
Sbjct: 2   SETKKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDC 61

Query: 61  WRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIF- 119
           +++  R EG    + G  A  I Y    A  +     FK Q   +   +    Y      
Sbjct: 62  FQRTARQEGIISFWRGNTANVIRYFPTQALNFA----FKDQIKAMFGFKKEEGYAKWFAG 117

Query: 120 -LAASASAEFIADIFLCPWEAIKVRQQTAVPPPFA------RNVFDAYSKMVGAEGFASL 172
            LA+   A  ++ +F+   +  + R                  + D Y K + ++G A L
Sbjct: 118 NLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGL 177

Query: 173 YKGITP 178
           Y+G  P
Sbjct: 178 YRGFLP 183

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 78/183 (42%), Gaps = 15/183 (8%)

Query: 28  VACGPTHSAV-TPLDLVKCRRQVDA-----SLYKSNLDGWRQIVRSEGATKVFTGVGATA 81
           VA G T+S + +P++ ++ R Q        + +K  +D  +++ R  G  ++  G+  T 
Sbjct: 126 VAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNG--QLMRGLTPTM 182

Query: 82  IGYSLQGAFKYGGYE-FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAI 140
           +  S      +  YE    HQ    +  +   +++  +F AAS +  +     + P + I
Sbjct: 183 LRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWT---MVYPLDVI 239

Query: 141 KVRQQTA--VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIV 198
           K   QT     P    N+      ++  +G + L+KG  P   R  P     F +FE  +
Sbjct: 240 KSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFETAM 299

Query: 199 EMI 201
            ++
Sbjct: 300 RLL 302

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 28.9 bits (63), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 9/100 (9%)

Query: 105 LVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFA-----RNVFDA 159
           +  P  A+ Y+    LA  A +  +A   + P++ ++ R Q             ++V DA
Sbjct: 3   VTDPNLANLYK----LAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDA 58

Query: 160 YSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVE 199
              +   EG    YKG+T   F+ IP T   +  +E I E
Sbjct: 59  LITIGKTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIRE 98

>Scas_712.8
          Length = 379

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 15/21 (71%)

Query: 7   ILNSPTLYSPEYYAACTLGGL 27
           I+NSP +Y PEY A+  L GL
Sbjct: 139 IINSPMIYDPEYNASKNLYGL 159

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 66/173 (38%), Gaps = 16/173 (9%)

Query: 19  YAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYK----------SNLDGWRQIVRSE 68
           + A  LGG+   G    A   +    C + V+ +  K          S+L  ++QI  +E
Sbjct: 107 FGAGILGGV--SGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAE 164

Query: 69  GATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEF 128
           G   +  GV A AI        ++G     +    ++    +         + ASA    
Sbjct: 165 GLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVASALGGG 224

Query: 129 IADIFLCPWEAIKVRQQTAVPPPFA-RN--VFDAYSKMVGAEGFASLYKGITP 178
           ++  +  P E I+V  Q+    P   +N  V   +  +    G   LY+G+TP
Sbjct: 225 LS-AWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGLYRGVTP 276

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 119 FLAASASAEFIADIFLC-PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKG-I 176
            LA +A    IA + +  P++  KVR QT+  P  A  V     K  G +GF   YKG +
Sbjct: 29  LLAGTAGG--IAQVLIGQPFDTTKVRLQTSKVPTSAAEVVKNLLKNEGPKGF---YKGTL 83

Query: 177 TPL 179
           TPL
Sbjct: 84  TPL 86

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 12/52 (23%), Positives = 21/52 (40%)

Query: 150 PPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201
           P +  ++  A   +    G  + +KG  P   R  P     F SFE  + ++
Sbjct: 259 PKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMTMRVL 310

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 28.1 bits (61), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 47/254 (18%), Positives = 99/254 (38%), Gaps = 26/254 (10%)

Query: 39  PLDLVKCRRQVD------ASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKY 92
           PL  +  R QV        +  KS L+  R+I R EG    + G+ +   G +   +  Y
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMA-ANSLNY 94

Query: 93  GGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPF 152
             Y F++      +    +    T   + +SA A  +  I   P   +  R   A     
Sbjct: 95  --YYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSE-- 150

Query: 153 ARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIY------ARLP 206
            ++       +V  +G  +L+ G+ P     +   + ++T FE++  ++         LP
Sbjct: 151 -QSTLAVLLDIVRKDGVTALFNGLRPA-LMLVSNPIIQYTVFEQLKNVVLKWSGSDVLLP 208

Query: 207 TPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSRIYGK 266
           +    +  +G+++ +       G     ++    + ++K   +  + +S       I  K
Sbjct: 209 SWAFLLGAVGKLAAT-------GSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKK 261

Query: 267 IGFPGLWNGLAVRI 280
            G  GL++G+ V++
Sbjct: 262 EGIQGLYHGIGVKL 275

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,029,154
Number of extensions: 340737
Number of successful extensions: 1577
Number of sequences better than 10.0: 207
Number of HSP's gapped: 1236
Number of HSP's successfully gapped: 396
Length of query: 303
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 202
Effective length of database: 13,099,691
Effective search space: 2646137582
Effective search space used: 2646137582
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)