Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.399547445522640.0
Sklu_2401.747340010301e-136
Scas_716.344794218781e-113
KLLA0D14883g4673708171e-104
YGR091W (PRP31)4943798191e-104
CAGL0G03025g4793476554e-80
ADR032W4392363643e-38
Kwal_56.246545072151672e-12
Sklu_1985.14982151672e-12
CAGL0A04015g5082151673e-12
YLR197W (SIK1)5042151639e-12
ACL144C5492151612e-11
Scas_537.75102151602e-11
KLLA0D12254g5132151602e-11
YOR310C (NOP58)5112211333e-08
AFR328C5132431333e-08
Scas_665.125152481272e-07
Kwal_34.158945122431244e-07
KLLA0F08613g5112201228e-07
CAGL0I09790g5131711164e-06
YIL087C15742681.5
Scas_620.3215121653.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3995
         (468 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3995                                                          876   0.0  
Sklu_2401.7 YGR091W, Contig c2401 14483-15904                         401   e-136
Scas_716.34                                                           342   e-113
KLLA0D14883g 1254381..1255784 some similarities with sp|P49704 S...   319   e-104
YGR091W (PRP31) [2051] chr7 (666343..667827) Protein required fo...   320   e-104
CAGL0G03025g 280230..281669 similar to sp|P49704 Saccharomyces c...   256   4e-80
ADR032W [1773] [Homologous to ScYGR091W (PRP31) - SH] complement...   144   3e-38
Kwal_56.24654                                                          69   2e-12
Sklu_1985.1 YLR197W, Contig c1985 148-1644 reverse complement          69   2e-12
CAGL0A04015g complement(397378..398904) similar to sp|Q12460 Sac...    69   3e-12
YLR197W (SIK1) [3600] chr12 (546099..547613) Nucleolar protein c...    67   9e-12
ACL144C [905] [Homologous to ScYLR197W (SIK1) - SH] (94809..9645...    67   2e-11
Scas_537.7                                                             66   2e-11
KLLA0D12254g 1045077..1046618 highly similar to sp|Q12460 Saccha...    66   2e-11
YOR310C (NOP58) [5094] chr15 complement(896820..898355) Nucleola...    56   3e-08
AFR328C [3520] [Homologous to ScYOR310C (NOP58) - SH] (1032031.....    56   3e-08
Scas_665.12                                                            54   2e-07
Kwal_34.15894                                                          52   4e-07
KLLA0F08613g complement(801623..803158) similar to sp|Q12499 Sac...    52   8e-07
CAGL0I09790g complement(934746..936287) highly similar to sp|Q12...    49   4e-06
YIL087C (YIL087C) [2588] chr9 complement(199643..200116) Protein...    31   1.5  
Scas_620.3                                                             30   3.8  

>Kwal_23.3995
          Length = 474

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/455 (94%), Positives = 428/455 (94%)

Query: 14  FGSXXXXXXXXXXXXXXXNDNGGSSDDLSELLEAQQPSLSSEGSLKGPLEVSRVYSKRFK 73
           FGS               NDNGGSSDDLSELLEAQQPSLSSEGSLKGPLEVSRVYSKRFK
Sbjct: 14  FGSEEEEEEVVEVELEEENDNGGSSDDLSELLEAQQPSLSSEGSLKGPLEVSRVYSKRFK 73

Query: 74  LYEMMGQKSSFNAMQLSKLQPIVLEEMGLLQKLMAKIYERRFPELQSLMTSPKGYAQVVK 133
           LYEMMGQKSSFNAMQLSKLQPIVLEEMGLLQKLMAKIYERRFPELQSLMTSPKGYAQVVK
Sbjct: 74  LYEMMGQKSSFNAMQLSKLQPIVLEEMGLLQKLMAKIYERRFPELQSLMTSPKGYAQVVK 133

Query: 134 HLETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFKQDVPLTAEDSRLVIQTADVLLELC 193
           HLETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFKQDVPLTAEDSRLVIQTADVLLELC
Sbjct: 134 HLETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFKQDVPLTAEDSRLVIQTADVLLELC 193

Query: 194 DIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAVAGGLSELSEIPSCNLSSIGKTKNS 253
           DIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAVAGGLSELSEIPSCNLSSIGKTKNS
Sbjct: 194 DIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAVAGGLSELSEIPSCNLSSIGKTKNS 253

Query: 254 SHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALRMVCAKVSLCARADRSKSCPSGTLG 313
           SHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALRMVCAKVSLCARADRSKSCPSGTLG
Sbjct: 254 SHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALRMVCAKVSLCARADRSKSCPSGTLG 313

Query: 314 AKWKEQVLEKLRKLQDPPNISNTKALPIPEDKPKKKRAGRRFRKYKEQFQLSHTRQLQNR 373
           AKWKEQVLEKLRKLQDPPNISNTKALPIPEDKPKKKRAGRRFRKYKEQFQLSHTRQLQNR
Sbjct: 314 AKWKEQVLEKLRKLQDPPNISNTKALPIPEDKPKKKRAGRRFRKYKEQFQLSHTRQLQNR 373

Query: 374 MEFGKQENTTFDAFGEEIGMGMAHTLRAPTTVFRNRAKMRKSMQQRLLSESQGTQDFLTT 433
           MEFGKQENTTFDAFGEEIGMGMAHTLRAPTTVFRNRAKMRKSMQQRLLSESQGTQDFLTT
Sbjct: 374 MEFGKQENTTFDAFGEEIGMGMAHTLRAPTTVFRNRAKMRKSMQQRLLSESQGTQDFLTT 433

Query: 434 DDRSNILGNTSTALSASPVXXXXXXXXXXXXWYRK 468
           DDRSNILGNTSTALSASPV            WYRK
Sbjct: 434 DDRSNILGNTSTALSASPVTSTQKSKTSDTDWYRK 468

>Sklu_2401.7 YGR091W, Contig c2401 14483-15904
          Length = 473

 Score =  401 bits (1030), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 197/400 (49%), Positives = 275/400 (68%), Gaps = 4/400 (1%)

Query: 41  LSELLEAQQPSLSSEGSLKGPLEVSRVYSKRFKLYEMMGQKSSFNAMQLSKLQPIVLEEM 100
           L  L    +P   S G+L GP E+ ++   +  + ++M          LS+LQP++  E+
Sbjct: 47  LRALAREYKPINLSTGALNGPKELCQLLPLQNGIKKLMLNNKFSTVTLLSELQPVIQSEL 106

Query: 101 GLLQKLMAKIYERRFPELQSLMTSPKGYAQVVKHLETSDINEGNLRGLEDIISKEHFLVL 160
            LL   +  +Y ++F EL SL+  P+ Y++++K LETSD  +  L  LE I+SKE  L++
Sbjct: 107 ALLHNYIKSLYSKKFSELDSLVNPPRSYSKLIKFLETSDARD--LSTLEGILSKEQILIV 164

Query: 161 SMAMHTGFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGS 220
           SM+M TGFK+D+ L +++   ++   D+L++L D++D+I  ++AS V ++APN+C +VG 
Sbjct: 165 SMSMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGP 224

Query: 221 QIAASLIAVAGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQP 280
           Q+A+ +++ AGGL ELS++PSCNL+SIGK +  SH  +TD SGVRQ+GY+Y   L+  QP
Sbjct: 225 QVASKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQP 284

Query: 281 VSFQKQALRMVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKLRKLQDPPNISNTKALP 340
               KQALRMVCAKVSL AR D S +    +LG KW  ++ EKL KLQDPPNISNTK LP
Sbjct: 285 PHVHKQALRMVCAKVSLAARVDISNN-KDNSLGVKWANEISEKLNKLQDPPNISNTKPLP 343

Query: 341 IPEDKPKKKRAGRRFRKYKEQFQLSHTRQLQNRMEFGKQENTTFDAFGEEIGMGMAHTLR 400
           IPEDKPKKKRAGR+FRKYK+QFQLSH RQLQNR+EFG QE T  D++GEEIGMGMA +L+
Sbjct: 344 IPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQNRVEFGTQERTVIDSYGEEIGMGMAGSLQ 403

Query: 401 APT-TVFRNRAKMRKSMQQRLLSESQGTQDFLTTDDRSNI 439
           A   +   N AKMRKSM++R+       +DF+  DDR  +
Sbjct: 404 ATQYSTHNNTAKMRKSMKRRIADAEDNVRDFVLLDDRMGV 443

>Scas_716.34
          Length = 479

 Score =  342 bits (878), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/421 (45%), Positives = 271/421 (64%), Gaps = 19/421 (4%)

Query: 32  NDNGGSSDDLSELLEAQQPS--LSSEGSLKGPLEVSRVYSKRFKLYEMM-GQKSSFNAM- 87
           ND    +  L+EL++  +PS  LSS      P ++S VY    KL  M   Q +SF  + 
Sbjct: 53  NDLTNDTAFLNELVKTFKPSTMLSSVDMNMEPKKLSIVYRAIEKLKAMFHSQSTSFIEVL 112

Query: 88  -QLSKLQPIVLEEMGLLQKLMAKIYERRFPELQSLMTSPKGYAQVVKHLE-TSDINEGNL 145
             L++L   +  E+ +L +    IY  RF EL ++  +P  YA+V   +E TSD   G L
Sbjct: 113 PHLNELSHQIRREIDILYQYSKNIYSTRFTELDTIAATPYQYAKVTSLIEGTSDDKAGQL 172

Query: 146 R---GLEDIISKEHFLVLSMAMHTGFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIERY 202
                +E  +SKE  LVL M+M T F ++ PL  +   L+++   ++++L D+++ I +Y
Sbjct: 173 PINIEIEAKLSKEQVLVLRMSMQTSFLKNKPLEKKVKHLLLEACSMIIQLTDLQNVILQY 232

Query: 203 VASLVSDVAPNLCILVGSQIAASLIAVAGGLSELSEIPSCNLSSIGKTKNSSHTSDTDAS 262
           ++S VSD+APNLC+LVG ++A+ LIA  GG+ +L+EIPSCNL+SIGK ++ SH   T  S
Sbjct: 233 ISSNVSDIAPNLCVLVGPEVASLLIAHTGGILQLAEIPSCNLASIGKNRHLSHELHTTLS 292

Query: 263 GVRQKGYIYQSDLVSGQPVSFQKQALRMVCAKVSLCARADRSK--SCPSGTLGAKWKEQV 320
           GVRQ+GYIY S+LV  QP+   KQ LRMVCAKV+L AR D  +  +  +  LG +W+E++
Sbjct: 293 GVRQEGYIYSSELVQNQPIQNHKQMLRMVCAKVALAARVDAGQRGAAKNDLLGQRWREEL 352

Query: 321 LEKLRKLQDPPNISNTKALPIPEDKPKKKRAGRRFRKYKEQFQLSHTRQLQNRMEFGKQE 380
             K++K+ + PNISN K LPIPEDKPKKKRAGR+FRKYK+QFQLSH RQLQNRMEFGKQE
Sbjct: 353 ETKIQKVTESPNISNVKPLPIPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQNRMEFGKQE 412

Query: 381 NTTFDAFGEEIGMGMAHT--------LRAPTTVFRNRAKMRKSMQQRLLSESQGTQDFLT 432
            +T DAFGEEIGMGM  +        +RA +    N AK+ K M++RL      +++F +
Sbjct: 413 QSTMDAFGEEIGMGMTSSSIQQSIGGIRASSQRVDNSAKITKVMKRRLKEADSQSKEFAS 472

Query: 433 T 433
           +
Sbjct: 473 S 473

>KLLA0D14883g 1254381..1255784 some similarities with sp|P49704
           Saccharomyces cerevisiae YGR091w PRP31 pre-mRNA splicing
           protein, hypothetical start
          Length = 467

 Score =  319 bits (817), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/370 (47%), Positives = 236/370 (63%), Gaps = 22/370 (5%)

Query: 84  FNAMQLSKLQPIVLEEMGLLQKLMAKIYERRFPELQSLMTSPKGYAQVVKHLETSDINEG 143
           +N ++L +L P+   E+ ++ + +   Y+ +FP L++++   K Y  VVK L+  DI   
Sbjct: 87  YNVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ-QDI--P 143

Query: 144 NLRGLEDIISKEHFLVLSMAMHTGFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIERYV 203
           N++ L+ ++SKE  LV+SM++ T FK+   +  +     I   D+L  L   RD +  YV
Sbjct: 144 NVQ-LDQVLSKEETLVVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNL---RDNVSHYV 199

Query: 204 ASLVSDVAPNLCILVGSQIAASLIAVAGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASG 263
            + +  VAPNLC L+G   AA L+   G + ELS +PSCNL+SIG+ K + H    D SG
Sbjct: 200 ETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDK-TLHGKSLDISG 258

Query: 264 VRQKGYIYQSDLVSGQPVSFQKQALRMVCAKVSLCARADRSKSC----PSGT-------- 311
           VRQKGY++ +D+V  QP  FQKQALRMV AKV+L ARAD +       P G         
Sbjct: 259 VRQKGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDAS 318

Query: 312 -LGAKWKEQVLEKLRKLQDPPNISNTKALPIPEDKPKKKRAGRRFRKYKEQFQLSHTRQL 370
            LG KW+ +++EKL+K+ DPPNISN K LPIPED PKKKRAGRRFRKYKEQF++SH RQ+
Sbjct: 319 KLGLKWRHEIVEKLKKIIDPPNISNIKPLPIPEDAPKKKRAGRRFRKYKEQFKMSHLRQM 378

Query: 371 QNRMEFGKQENTTFDAFGEEIGMGMAHTLRAPTTVFRNRAKMRKSMQQRLLSESQGTQDF 430
           QNRMEFGK+E TT D +GEEIG GMA +         N+ KMRKSM+ RL  E++ T  F
Sbjct: 379 QNRMEFGKEEQTTMDPYGEEIGFGMADSKNVSALSSFNKTKMRKSMRLRLDQETKNTHSF 438

Query: 431 LTTDDRSNIL 440
           L  D+RS  L
Sbjct: 439 L-QDERSEKL 447

>YGR091W (PRP31) [2051] chr7 (666343..667827) Protein required for
           pre-mRNA splicing, associated with U4/U6.U5 tri-snRNP
           [1485 bp, 494 aa]
          Length = 494

 Score =  320 bits (819), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 171/379 (45%), Positives = 245/379 (64%), Gaps = 22/379 (5%)

Query: 89  LSKLQPIVLEEMGLLQKLMAKIYERRFPELQSLMTSPKGYAQVVKHLETSDI--NEGN-- 144
            +++ P++   + L+   +  +Y RRFPEL SL+ SP  Y++V+  LE  +   NE +  
Sbjct: 98  FNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYSKVISILENENYSKNESDEL 157

Query: 145 LRGLEDI--ISKEHFLVLSMAMHTGFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIERY 202
              LE+   +++E  LVL+M+M T FK   PL  +    +++   +L  L  +++ I +Y
Sbjct: 158 FFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQY 217

Query: 203 VASLVSDVAPNLCILVGSQIAASLIAVAGGLSELSEIPSCNLSSIGKTKNSSHTSDTDAS 262
           +AS +S +APN+C LVG +IAA LIA AGG+ E S IPSCN++SIGK K+ SH   T  S
Sbjct: 218 IASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLES 277

Query: 263 GVRQKGYIYQSDLVSGQPVSFQKQALRMVCAKVSLCARAD--RSKSCPSGTLGAKWKEQV 320
           GVRQ+GY++ SD++   PVS  KQ LRM+CAKVSL AR D  +     +  L  KWK ++
Sbjct: 278 GVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDAGQKNGDRNTVLAHKWKAEL 337

Query: 321 LEKLRKLQDPPNISNTKALPIPEDKPKKKRAGRRFRKYKEQFQLSHTRQLQNRMEFGKQE 380
            +K RKL + P+IS TKALPIPED+PKKKRAGR+FRKYKE+F+LSH RQLQNRMEFGKQE
Sbjct: 338 SKKARKLSEAPSISETKALPIPEDQPKKKRAGRKFRKYKEKFRLSHVRQLQNRMEFGKQE 397

Query: 381 NTTFDAFGEEIGMGMAHT-----LRAPTTVFR---NRAKMRKSMQQRLLSESQGTQDFLT 432
            T  D++GEE+G+GM++T     + A +   R   N+AK+ K M+ R+   +Q   +FL 
Sbjct: 398 QTVLDSYGEEVGLGMSNTSLQQAVGATSGSRRSAGNQAKLTKVMKHRISEANQQADEFLI 457

Query: 433 TDDRSNILGNTSTALSASP 451
           +      LG+ +   + SP
Sbjct: 458 S------LGHNTEQPNLSP 470

>CAGL0G03025g 280230..281669 similar to sp|P49704 Saccharomyces
           cerevisiae YGR091w PRP31 pre-mRNA splicing protein,
           hypothetical start
          Length = 479

 Score =  256 bits (655), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 214/347 (61%), Gaps = 16/347 (4%)

Query: 107 MAKIYERRFPELQSLMTSPKGYAQVVKHLETSDINEGNLRGLEDI--ISKEHFLVLSMAM 164
           + +IYE +F EL+S++  P  YAQ +  LE     E  +   E++   S+E  +VL+M++
Sbjct: 131 LTEIYEDKFSELKSILRLPHQYAQCISLLEQGLELEQVVLRFEELCSTSRELIMVLNMSL 190

Query: 165 HTGFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAA 224
              +K +  LT  + + + +   ++ E  DI   +   +A+ + ++APNLC L+G+  A+
Sbjct: 191 RADYKGNYKLTDTNKKSLHKLTSIIFEAHDIIRFVSVEIANRIGEIAPNLCALLGTNTAS 250

Query: 225 SLIAVAGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQ 284
            L++  GGL +LS+IPSCN+++IGK     H      +     GYI+Q++LV  QP+   
Sbjct: 251 LLVSHTGGLLQLSKIPSCNIANIGKKNTKDHNI---LNFSNPGGYIFQNELVQNQPIENH 307

Query: 285 KQALRMVCAKVSLCARADRSKSC--PSGTLGAKWKEQVLEKLRKLQDPPNISNTKALPIP 342
           KQ +RM+ +KVSL AR D        +  LG +W+ ++ EK++K++ PPNIS+ KALPIP
Sbjct: 308 KQMMRMLSSKVSLAARVDAGLKTGDKNNKLGKQWRVEIEEKIKKIRAPPNISDVKALPIP 367

Query: 343 EDKPKKKRAGRRFRKYKEQFQLSHTRQLQNRMEFGKQENTTFDAFGEEIGMGMA----HT 398
           EDKPKKKRAGR+FRKYKEQF+LS TRQLQNRM FGKQE T +D FG+E+G+GM     + 
Sbjct: 368 EDKPKKKRAGRKFRKYKEQFKLSGTRQLQNRMVFGKQEATIYDTFGDEVGLGMTSQRKNG 427

Query: 399 LRAPTTVFRNRAKMRKSMQQRLLSESQGTQDFLTT-----DDRSNIL 440
           L   TT      K  + +Q++L    + TQ+++       D+ +N++
Sbjct: 428 LAISTTGSSFGVKKPQYIQKKLKDSKRSTQEYIDALADRIDEHANLI 474

>ADR032W [1773] [Homologous to ScYGR091W (PRP31) - SH]
           complement(763163..764482) [1320 bp, 439 aa]
          Length = 439

 Score =  144 bits (364), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 137/236 (58%), Gaps = 12/236 (5%)

Query: 89  LSKLQPIVLEEMGLLQKLMAKIYERRFPELQSLMTSPKGYAQVVKHLETSDINEGNLRGL 148
           L +L P++ +E   + + +   Y   FPEL  L+ S + Y +V++ LET          L
Sbjct: 67  LGQLLPVLRDEAADVYRQLEARYRPVFPELAELVPSQRTYVRVLRALETGA-------PL 119

Query: 149 EDIISKEHFLVLSMAMHTGFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVS 208
           ++++++E  ++++M      + D    A   R +   AD   +L    D I+ ++     
Sbjct: 120 DELLTREQAMLVAMTRPQAPRAD---PARWPRELAPHADRHEQLHTAVDAIDAHIVRQAH 176

Query: 209 DVAPNLCILVGSQIAASLIAVAGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKG 268
            +AP +  LVG  +AA+L++ AG + EL+++P+CNL++IG  ++++H   TDASGVR +G
Sbjct: 177 RLAPTVTALVGPVVAAALLSHAGSVRELAQVPACNLAAIGAPRHAAHARRTDASGVRLRG 236

Query: 269 YIYQSDLVSGQPVSFQKQALRMVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324
           +++ + LV  QP + Q+QALRM+CA+++L AR D   S P   L A+W+  +L ++
Sbjct: 237 HVWDTPLVQEQPPALQRQALRMLCARLALAARVD--ASAPDPALAARWRADILARI 290

>Kwal_56.24654
          Length = 507

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 96/215 (44%), Gaps = 2/215 (0%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169
           Y   FPEL  L+     +AQ+V  + + + ++E +L  L  I+  +  +   +  +    
Sbjct: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDNDAGIAERVIDNARIS 257

Query: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229
               L+  D   V   A+ +  L D R ++  Y+ S +  VAPNL  L+G  I A LI+ 
Sbjct: 258 MGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAPNLSELIGEVIGARLISH 317

Query: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289
           AG L+ LS+  +  +  +G  K       T  +   + G IY S  +       + +  R
Sbjct: 318 AGSLTNLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFIGKAAAKNKGRISR 376

Query: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324
            +  K S+ +R D     P+   G   K+QV ++L
Sbjct: 377 YLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRL 411

>Sklu_1985.1 YLR197W, Contig c1985 148-1644 reverse complement
          Length = 498

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 99/215 (46%), Gaps = 2/215 (0%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169
           Y   FPEL  L+     +AQ+V  + + + ++E +L  L  I++ +  +   +  +    
Sbjct: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDDAGIAERVIDNARIS 257

Query: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229
               L+  D   V   A+ ++ L D R ++  Y+   +  VAPNL  L+G  I A LI+ 
Sbjct: 258 MGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISH 317

Query: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289
           AG L+ LS+  +  +  +G  K       T  +   + G IY S  ++      + +  R
Sbjct: 318 AGSLTNLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFIAKASAKNKGRISR 376

Query: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324
            +  K S+ +R D     P+   G+  K+QV ++L
Sbjct: 377 YLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRL 411

>CAGL0A04015g complement(397378..398904) similar to sp|Q12460
           Saccharomyces cerevisiae YLR197w SIK1 involved in
           pre-rRNA processing, hypothetical start
          Length = 508

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 99/215 (46%), Gaps = 2/215 (0%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169
           Y   FPEL  L+     +A++V  + + + +NE +L  L  +++++  +   +  +    
Sbjct: 197 YGWHFPELAKLVPDNYTFAKLVLFIKDKASLNEESLHDLAAVVNEDAGIAERIIDNARIS 256

Query: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229
               L+  D   V   A  ++ L D R ++  Y+   +  VAPNL  L+G  I A LI+ 
Sbjct: 257 MGQDLSETDMENVCVFAQRVVSLVDYRKQLYDYLCEKMHTVAPNLSGLIGEVIGARLISH 316

Query: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289
           AG L+ LS+  +  +  +G  K       T  +   + G IY S  ++      + +  R
Sbjct: 317 AGSLTSLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFIAKASAKNKGRISR 375

Query: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324
            +  K S+ +R D     P+   G+  K+QV ++L
Sbjct: 376 YLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRL 410

>YLR197W (SIK1) [3600] chr12 (546099..547613) Nucleolar protein
           component of box C/D snoRNPs, which are necessary for
           2'-O-methylation of ribosomal RNAs, component of U3
           snoRNP (also called small subunit processome), which is
           required for 18S rRNA biogenesis [1515 bp, 504 aa]
          Length = 504

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 98/215 (45%), Gaps = 2/215 (0%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169
           Y   FPEL  L+     +A++V  + + + +N+ +L  L  +++++  +   +  +    
Sbjct: 199 YGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAALLNEDSGIAQRVIDNARIS 258

Query: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229
               ++  D   V   A  +  L D R ++  Y+   +  VAPNL  L+G  I A LI+ 
Sbjct: 259 MGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISH 318

Query: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289
           AG L+ LS+  +  +  +G  K       T  +   + G IY S  +S      + +  R
Sbjct: 319 AGSLTNLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFISKASAKNKGRISR 377

Query: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324
            +  K S+ +R D     PS   G+  K+QV ++L
Sbjct: 378 YLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRL 412

>ACL144C [905] [Homologous to ScYLR197W (SIK1) - SH] (94809..96458)
           [1650 bp, 549 aa]
          Length = 549

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 98/215 (45%), Gaps = 2/215 (0%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169
           Y   FPEL  L+     +A++V  + + + +N+ +L  L  I+ ++  +   +  +    
Sbjct: 198 YGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGEDAGIAERVISNARIS 257

Query: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229
               L+  D   V   A+ ++ L + R ++  Y+   +  VAPNL  L+G  I A LI+ 
Sbjct: 258 MGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAPNLSELIGEVIGARLISH 317

Query: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289
           AG L+ LS+  +  +  +G  K       T  +   + G IY S  +S      + +  R
Sbjct: 318 AGSLTNLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFISKASAKNKGRISR 376

Query: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324
            +  K S+ +R D     P+   G   K+QV ++L
Sbjct: 377 YLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRL 411

>Scas_537.7
          Length = 510

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 98/215 (45%), Gaps = 2/215 (0%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169
           Y   FPEL  L+     +AQ+V  + + + +N+ +L  L  I++ +  +   +  +    
Sbjct: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAILNDDAGIAERVIDNARIS 257

Query: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229
               ++  D   V   A  ++ L + R ++  Y+   +  VAPNL  L+G  I A LI+ 
Sbjct: 258 MGQDISETDMENVGVFAQRVVSLVEYRKQLYDYLCEKMHTVAPNLSELIGEVIGARLISH 317

Query: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289
           AG L+ LS+  +  +  +G  K       T  +   + G IY S  ++      + +  R
Sbjct: 318 AGSLTNLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFIAKASAKNKGRISR 376

Query: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324
            +  K S+ +R D     P+   GA  K+QV ++L
Sbjct: 377 YLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRL 411

>KLLA0D12254g 1045077..1046618 highly similar to sp|Q12460
           Saccharomyces cerevisiae YLR197w SIK1 involved in
           pre-rRNA processing, start by similarity
          Length = 513

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 97/215 (45%), Gaps = 2/215 (0%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169
           Y   FPEL  L+     +A++V  + + + +NE +L  L +I+  +  +   +  +    
Sbjct: 198 YGWHFPELAKLVPDNYKFAKLVLFIKDKASLNEESLHDLSEILDNDAGISERVIDNARIS 257

Query: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229
               L+  D   V   A  ++ L + R ++  Y+   +  VAPNL  L+G  I A LI+ 
Sbjct: 258 MGQDLSETDMENVTIFAKRVVSLVEYRKQLYDYLCEKMHTVAPNLSELIGEVIGARLISH 317

Query: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289
           +G L+ LS+  +  +  +G  K       T  +  +  G IY S  ++      + +  R
Sbjct: 318 SGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKY-GLIYHSGFIAKASAKNKGRISR 376

Query: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324
            +  K S+ +R D     PS   G   K+QV ++L
Sbjct: 377 YLANKCSMASRIDNYSDEPSNVFGQVLKKQVEQRL 411

>YOR310C (NOP58) [5094] chr15 complement(896820..898355) Nucleolar
           protein component of box C/D snoRNPs, which are
           necessary for 2'-O-methylation of ribosomal RNAs,
           component of U3 snoRNP (also called small subunit
           processome), which is required for 18S rRNA biogenesis
           [1536 bp, 511 aa]
          Length = 511

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 104/221 (47%), Gaps = 9/221 (4%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHLETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFKQ 170
           Y   FPEL  ++T    YA+++  L     ++ +   L +I+ +E    +  A       
Sbjct: 188 YGWHFPELAKIVTDSVAYARII--LTMGIRSKASETDLSEILPEEIEERVKTAAEVSMGT 245

Query: 171 DVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAVA 230
           ++  T  D+  +   A+ ++E    R+++  Y+++ +  +APNL  LVG  + A LIA +
Sbjct: 246 EITQTDLDN--INALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLIAHS 303

Query: 231 GGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQAL-R 289
           G L  L++ P+  +  +G  K       T      + G +Y + LV GQ     K  + R
Sbjct: 304 GSLISLAKSPASTIQILGAEKALFRALKTK-HDTPKYGLLYHASLV-GQATGKNKGKIAR 361

Query: 290 MVCAKVSLCARAD--RSKSCPSGTLGAKWKEQVLEKLRKLQ 328
           ++ AK ++  R D        SG +G + + +V  +L +L+
Sbjct: 362 VLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRLSQLE 402

>AFR328C [3520] [Homologous to ScYOR310C (NOP58) - SH]
           (1032031..1033572) [1542 bp, 513 aa]
          Length = 513

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 112/243 (46%), Gaps = 17/243 (6%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHLET-SDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169
           Y   FPEL  ++T    +A+++  +   S+  E ++    +I+ +E    +  A      
Sbjct: 188 YGWHFPELAKIVTDSVAFARIILTMGVRSNAAETDM---SEILPEEIEERVKSAAEVSMG 244

Query: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229
            ++  T  D   +   A+ ++E    R+++  Y++S +  +APNL  LVG  + A LIA 
Sbjct: 245 TEI--TQVDLDNIKSLAEQIVEFAAYREQLSNYLSSRMKAIAPNLTQLVGELVGARLIAH 302

Query: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQAL- 288
           AG L  L++ P+  +  +G  K       T      + G +Y + LV GQ     K  + 
Sbjct: 303 AGSLVSLAKAPASTIQILGAEKALFRALKTK-HDTPKYGLLYHASLV-GQATGKNKGKIA 360

Query: 289 RMVCAKVSLCARAD--RSKSCPSGTLGAKWKEQVLEKL-----RKLQDPPNIS-NTKALP 340
           R++ AK ++  R D        SG +G + + +V  +L     R L+  P +S + K + 
Sbjct: 361 RVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRLSQLEGRDLRTTPKVSRDAKKIE 420

Query: 341 IPE 343
           I E
Sbjct: 421 ISE 423

>Scas_665.12
          Length = 515

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 113/248 (45%), Gaps = 23/248 (9%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHL----ETSDINEGNLRGLEDIISKEHFLVLSMAMHT 166
           Y   FPEL  ++T    YA+++  +    + +D +   +  L + I +       ++M T
Sbjct: 188 YGWHFPELAKIVTDSVAYARIILTMGIRSKAADTDMSEI--LPEEIEERVKTAAEVSMGT 245

Query: 167 GFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASL 226
              Q   L  E+ + +   AD ++E    R+++  Y+++ +  +APNL  LVG  + A L
Sbjct: 246 EITQ---LDLENIKCL---ADQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARL 299

Query: 227 IAVAGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQ 286
           IA +G L  L++ P+  +  +G  K       T      + G +Y + LV GQ     K 
Sbjct: 300 IAHSGSLISLAKSPASTIQILGAEKALFRALKTK-HDTPKYGLLYHASLV-GQATGKNKG 357

Query: 287 AL-RMVCAKVSLCARAD--RSKSCPSGTLGAKWKEQVLEKLRKLQ------DPPNISNTK 337
            + R++ AK ++  R D        +G +G + + +V  +L +L+       P  +   K
Sbjct: 358 KIARVLAAKAAVSIRYDALAEDRDDAGDIGLESRAKVENRLSQLEGRDLRTTPKVVREAK 417

Query: 338 ALPIPEDK 345
            + I E +
Sbjct: 418 KVEISESR 425

>Kwal_34.15894
          Length = 512

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 109/243 (44%), Gaps = 17/243 (6%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHLET-SDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169
           Y   FPEL  ++T    +A+++  +   S+  E +L    +I+ +E    +  A      
Sbjct: 188 YGWHFPELAKIVTDSVAFARIILTMGVRSNAAETDL---SEILPEEIEERVKSAAEISMG 244

Query: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229
            ++  T+ D   +   A  + E    R+++  Y+++ +  +APNL  LVG  + A LIA 
Sbjct: 245 TEI--TSVDLDNIKSLATQITEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLIAH 302

Query: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQAL- 288
           AG L  L++ P+  +  +G  K       T      + G +Y + LV GQ     K  + 
Sbjct: 303 AGSLISLAKSPASTIQILGAEKALFRALKTK-HDTPKYGLLYHASLV-GQATGKNKGKIA 360

Query: 289 RMVCAKVSLCARAD--RSKSCPSGTLGAKWKEQVLEKLRKLQ------DPPNISNTKALP 340
           R++ AK ++  R D        SG +G + + +V  +L +L+       P  +   K + 
Sbjct: 361 RVLAAKAAVSLRYDALAEDRDDSGDIGLESRSKVESRLSQLEGRDLRTTPKVVREAKKVE 420

Query: 341 IPE 343
           I E
Sbjct: 421 ITE 423

>KLLA0F08613g complement(801623..803158) similar to sp|Q12499
           Saccharomyces cerevisiae YOR310c NOP58 required for
           pre-18S rRNA processing, start by similarity
          Length = 511

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 100/220 (45%), Gaps = 7/220 (3%)

Query: 111 YERRFPELQSLMTSPKGYAQVVKHLETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFKQ 170
           Y   FPEL  ++T    YA+++  +    +N      + +I+ +E    +  A       
Sbjct: 188 YGWHFPELAKIVTDSVAYARIILTMGIR-VNAAE-TDMSEILPEEIEERVKTAAEVSMGT 245

Query: 171 DVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAVA 230
           ++  T  D   +   A+ ++E    R+++  Y++S +  +APNL  LVG  + A LIA +
Sbjct: 246 EI--TPVDLINIKCLAEQIVEFAAYREQLSNYLSSRMKAIAPNLTQLVGELVGARLIAHS 303

Query: 231 GGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALRM 290
           G L  L++ P+  +  +G  K       T      + G +Y + LV       + +  R+
Sbjct: 304 GSLISLAKSPASTIQILGAEKALFRALKTK-HDTPKYGLLYHASLVGQASGKNKGKIARV 362

Query: 291 VCAKVSLCARAD--RSKSCPSGTLGAKWKEQVLEKLRKLQ 328
           + AK ++  R D        SG +G + + +V  +L +L+
Sbjct: 363 LAAKAAVSLRYDALAEDRDDSGDIGLESRAKVESRLSQLE 402

>CAGL0I09790g complement(934746..936287) highly similar to sp|Q12499
           Saccharomyces cerevisiae YOR310c, start by similarity
          Length = 513

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 80/171 (46%), Gaps = 14/171 (8%)

Query: 91  KLQPIVLEEMGLLQKLMAKI----------YERRFPELQSLMTSPKGYAQVVKHLETSDI 140
           K+  ++++ + LL  L  ++          Y   FPEL  ++T    YA+++  L     
Sbjct: 158 KVDVMIIQAIALLDDLDKEVNTYSMRCKEWYGWHFPELAKIVTDSVAYARLI--LTMGVR 215

Query: 141 NEGNLRGLEDIISKEHFLVLSMAMHTGFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIE 200
           ++     + +I+ +E    +  A       ++  T  D   +   AD ++E    R+++ 
Sbjct: 216 SKAAETDMSEILPEEIEERVKAAAEVSMGTEI--TDVDLINIRALADQIVEFAAYREQLS 273

Query: 201 RYVASLVSDVAPNLCILVGSQIAASLIAVAGGLSELSEIPSCNLSSIGKTK 251
            Y++S +  +APNL  LVG  + A LIA AG L  L++ P+  +  +G  K
Sbjct: 274 NYLSSRMKAIAPNLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEK 324

>YIL087C (YIL087C) [2588] chr9 complement(199643..200116) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.5619p [474 bp, 157 aa]
          Length = 157

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 74  LYEMMGQKSSFNAMQLSKLQPIVLEEMGLLQKLMAKIYERRF 115
           LY ++G K SF+A++  +  P+VL  + L     A +Y +RF
Sbjct: 113 LYLIVGGKKSFSALRYGRTWPLVLSSVSLAN---AVLYGQRF 151

>Scas_620.3
          Length = 215

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 64/121 (52%), Gaps = 18/121 (14%)

Query: 304 SKSCPSGTLGAKWKEQVLEKLRKLQDPPNISNTKALPIPEDKPKKKRAG--RRFRKYKEQ 361
           + + PS  +  +W+E+ +E+++KL +    +N KA    +D+  K        + + KEQ
Sbjct: 95  ANAAPSEAV-TEWRERRVEEIKKLDE----ANEKAKGELQDEAVKHIDNFYEDYNRKKEQ 149

Query: 362 FQLSHTRQ-----LQNRMEFGKQENTTFDAFGEEIGMGMAHTLRAPTTVFRNRAKMRKSM 416
            Q+  T++     L+ R +F +Q+NTT+D       + + +T  A +   R+R+K ++ +
Sbjct: 150 -QIEVTQKEAEEFLKERDQFFQQDNTTWDRV-----LQLINTEDADSVAGRDRSKFKEIL 203

Query: 417 Q 417
           Q
Sbjct: 204 Q 204

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,919,068
Number of extensions: 526809
Number of successful extensions: 1939
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1949
Number of HSP's successfully gapped: 29
Length of query: 468
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 363
Effective length of database: 12,961,219
Effective search space: 4704922497
Effective search space used: 4704922497
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)