Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.399257156328890.0
ADR033W57756322100.0
KLLA0D14905g56756621300.0
CAGL0B04147g56656220090.0
Scas_705.2355355319810.0
Scas_716.3357357219750.0
YGR092W (DBF2)57255919700.0
CAGL0G03047g53952419520.0
AFR035W7194825422e-60
CAGL0J06072g7734765344e-59
Kwal_33.145547144845307e-59
YNL161W (CBK1)7564615301e-58
KLLA0D07810g7184725229e-58
Scas_654.127374755168e-57
YMR104C (YPK2)6773523932e-40
CAGL0K07458g7043793933e-40
YNR047W8933773822e-38
KLLA0C18568g7743063784e-38
Scas_651.183713543634e-38
Kwal_23.64588683763775e-38
Scas_689.25*4093023647e-38
YCR091W (KIN82)7203513748e-38
CAGL0C03509g8952903751e-37
KLLA0B07205g4553443641e-37
YKL126W (YPK1)6803783721e-37
ADR167W8732983722e-37
YJL164C (TPK1)3973623583e-37
ABL028W7223433703e-37
Scas_717.696743503676e-37
Scas_720.1038042843696e-37
Scas_721.1246843533667e-37
Kwal_26.76356913433661e-36
Scas_629.169183283671e-36
Kwal_33.138463754083521e-36
Kwal_47.167617443823572e-35
CAGL0K03399g7033503562e-35
CAGL0G09020g3613653398e-35
AFL090W3463023388e-35
ADL389W7114153519e-35
CAGL0F09075g7464133519e-35
YKL166C (TPK3)3983443401e-34
KLLA0D03190g3723023372e-34
KLLA0B12716g7163443492e-34
YHR205W (SCH9)8243913492e-34
Kwal_56.240593533023343e-34
YPL203W (TPK2)3803623353e-34
CAGL0M08404g4623613394e-34
AEL115C3863783345e-34
KLLA0B03586g7343913431e-33
Scas_703.57494153421e-33
Scas_690.133543023246e-33
Scas_715.3411503323244e-31
Kwal_56.227885151973184e-31
CAGL0B04301g5422443186e-31
YBR028C5252193151e-30
YDR490C (PKH1)7663273102e-29
YBL105C (PKC1)11513323112e-29
Scas_593.14d4952163042e-29
KLLA0F24618g5562153062e-29
CAGL0M09361g11443323067e-29
Kwal_27.1058111543943067e-29
ACR191C11493643051e-28
KLLA0E06413g11613323041e-28
YOL100W (PKH2)10813653013e-28
Kwal_56.226939843342994e-28
CAGL0I07513g10763482852e-26
AFR377C7262492834e-26
YMR001C (CDC5)7053422825e-26
AEL083W5361972795e-26
Scas_660.209573012746e-25
AFR335C10332752746e-25
YDR466W (PKH3)8982602729e-25
KLLA0C12485g9253272702e-24
CAGL0K12562g16821652561e-22
CAGL0G04609g9652822532e-22
CAGL0K06479g9912602532e-22
YFL033C (RIM15)17701572533e-22
KLLA0F09020g9281562505e-22
Kwal_56.224766972102495e-22
Kwal_14.115915211692481e-21
Scas_707.315981852462e-21
KLLA0E03487g6472972433e-21
Kwal_47.183076212732423e-21
ACR218W15691522426e-21
ACL006W7082092381e-20
Scas_502.211163402382e-20
KLLA0B02332g3613052232e-19
KLLA0F11143g8132152273e-19
KLLA0C06138g7082102263e-19
YPL209C (IPL1)3672962205e-19
CAGL0J11638g7462352231e-18
Kwal_26.87967962162211e-18
KLLA0F09031g6331432183e-18
ACR142W8372652167e-18
Kwal_56.240913812942117e-18
CAGL0K05709g11032382168e-18
CAGL0K08514g14892362151e-17
KLLA0C01650g11122382141e-17
Scas_644.157262472122e-17
AFL101C3672122072e-17
YPL153C (RAD53)8212212113e-17
Scas_493.211172472113e-17
Scas_616.1014612462105e-17
YDR507C (GIN4)11422382088e-17
AFR696C11422382061e-16
KLLA0F11319g8431812015e-16
ABL034W14252502015e-16
YCL024W (KCC4)10372502015e-16
Scas_700.546982132006e-16
Kwal_14.24974181761976e-16
CAGL0I09504g5281681987e-16
CAGL0M02233g7672231998e-16
Scas_700.288962251999e-16
Scas_627.73492531939e-16
KLLA0F13552g12672361962e-15
AFR724C4402661922e-15
YPL150W9012251953e-15
YKL101W (HSL1)15182431944e-15
CAGL0M03729g8612021917e-15
Kwal_55.215458652311917e-15
CAGL0M02299g8931821901e-14
YGL158W (RCK1)5122261871e-14
YNR031C (SSK2)15791671882e-14
CAGL0E05720g3582991832e-14
Scas_675.25271961862e-14
AFL188C4722921852e-14
Kwal_26.778812672191872e-14
Scas_618.156202521853e-14
YCR073C (SSK22)13311681863e-14
CAGL0L11550g10722371863e-14
YBR274W (CHK1)5271691844e-14
CAGL0M02519g7562041844e-14
KLLA0B13112g7301911845e-14
YDL101C (DUN1)5132651818e-14
Scas_477.57031911829e-14
YNL298W (CLA4)8422021829e-14
CAGL0M08910g6122531811e-13
ACR133C8512251811e-13
YHR102W (KIC1)10802321811e-13
KLLA0C08525g15511651811e-13
ACL191C3651761762e-13
Scas_660.286232611782e-13
CAGL0K02673g9151941792e-13
Kwal_23.52908192021782e-13
Kwal_55.203267501911782e-13
KLLA0C04191g7972221773e-13
KLLA0A07403g8792021774e-13
AER264C14831651784e-13
Kwal_26.87518481671764e-13
YOL113W (SKM1)6552041755e-13
Scas_580.610152371765e-13
ABL011C7011921756e-13
AEL185C5152021746e-13
KLLA0F01276g5191821736e-13
CAGL0B02739g6761911747e-13
KLLA0A03806g6022531738e-13
CAGL0L07326g5062851738e-13
CAGL0L07810g5962241738e-13
YLR362W (STE11)7171911748e-13
AEL230W6082531739e-13
CAGL0C05005g10761941749e-13
KLLA0E21780g10161991731e-12
Scas_668.228931951731e-12
YDR477W (SNF1)6332531721e-12
KLLA0E01584g4152961701e-12
Scas_720.9416831671731e-12
AEL205W7932021721e-12
Kwal_23.35904992851702e-12
YGL179C (TOS3)5602231702e-12
Scas_628.96211771702e-12
Scas_598.67902021702e-12
KLLA0E11979g6142391702e-12
Kwal_33.13222148871572e-12
AER223C9021891702e-12
Kwal_47.182335982531692e-12
KLLA0A02497g3621931672e-12
ACL054W9722761702e-12
Kwal_33.131125052401692e-12
YOR233W (KIN4)8002041703e-12
CAGL0M10153g8671941693e-12
Scas_613.55172651683e-12
KLLA0F12188g5462251683e-12
Kwal_33.141678381991693e-12
Kwal_23.632515421661703e-12
AAL029W5342801683e-12
YHL007C (STE20)9391951693e-12
Kwal_55.217093402751653e-12
Kwal_27.97638681951684e-12
CAGL0J03828g4672071674e-12
Kwal_26.78619551951684e-12
ABR014W9711941684e-12
Kwal_0.1555872531675e-12
YPL141C8652491676e-12
Scas_640.14*7283281666e-12
Scas_573.105692161666e-12
CAGL0B03509g5972111657e-12
Kwal_0.3074902051657e-12
KLLA0C00979g4831951648e-12
YCR008W (SAT4)6032281659e-12
YPL140C (MKK2)5061891649e-12
KLLA0B13607g9891671651e-11
YLR248W (RCK2)6102401641e-11
ACL104C9472031641e-11
ADR300C8902681632e-11
YDL028C (MPS1)7641861632e-11
Scas_678.2416101671642e-11
AER195C5042241622e-11
Scas_673.20*7581971632e-11
Scas_640.165052031612e-11
Scas_685.245151911622e-11
YLR096W (KIN2)11473471622e-11
Kwal_33.138317001971622e-11
Scas_713.79831991613e-11
Kwal_14.14163651701583e-11
Scas_648.173402011583e-11
YDR283C (GCN2)16592811613e-11
YDR523C (SPS1)4902561593e-11
Scas_700.348642501604e-11
Scas_693.1710491831604e-11
Kwal_26.87098292051604e-11
CAGL0J03872g6612041594e-11
KLLA0D11990g3042051555e-11
ACR119W9311931595e-11
KLLA0E17127g8522591596e-11
CAGL0K04169g3981691566e-11
KLLA0D07304g4651911567e-11
CAGL0D02244g4872231568e-11
CAGL0B01925g9441931588e-11
CAGL0H01199g16481741588e-11
CAGL0H01639g5212031568e-11
KLLA0E10527g3712001549e-11
KLLA0F19536g11041831579e-11
CAGL0K01617g7742141579e-11
Kwal_23.566816891701589e-11
ACR117W5241911561e-10
CAGL0M11396g11921831571e-10
AEL284C4791911551e-10
YJL095W (BCK1)14781771561e-10
Scas_564.712101831561e-10
KLLA0B11946g4392581531e-10
KLLA0F16467g3401881521e-10
Scas_707.369152651552e-10
AGR058W10711831552e-10
Scas_711.2515151761552e-10
YOR231W (MKK1)5081901532e-10
Scas_633.297892111542e-10
KLLA0F23155g4272341522e-10
AAL083W16982621542e-10
Scas_710.283521761502e-10
ADL315C4341601513e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3992
         (563 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3992                                                         1117   0.0  
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...   855   0.0  
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...   825   0.0  
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...   778   0.0  
Scas_705.23                                                           767   0.0  
Scas_716.33                                                           765   0.0  
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...   763   0.0  
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...   756   0.0  
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...   213   2e-60
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...   210   4e-59
Kwal_33.14554                                                         208   7e-59
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...   208   1e-58
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...   205   9e-58
Scas_654.12                                                           203   8e-57
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...   155   2e-40
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...   155   3e-40
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...   151   2e-38
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...   150   4e-38
Scas_651.18                                                           144   4e-38
Kwal_23.6458                                                          149   5e-38
Scas_689.25*                                                          144   7e-38
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...   148   8e-38
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...   149   1e-37
KLLA0B07205g complement(624606..625973) some similarities with s...   144   1e-37
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...   147   1e-37
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...   147   2e-37
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...   142   3e-37
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...   147   3e-37
Scas_717.69                                                           145   6e-37
Scas_720.103                                                          146   6e-37
Scas_721.124                                                          145   7e-37
Kwal_26.7635                                                          145   1e-36
Scas_629.16                                                           145   1e-36
Kwal_33.13846                                                         140   1e-36
Kwal_47.16761                                                         142   2e-35
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...   141   2e-35
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...   135   8e-35
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...   134   8e-35
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...   139   9e-35
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...   139   9e-35
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...   135   1e-34
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...   134   2e-34
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...   139   2e-34
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...   139   2e-34
Kwal_56.24059                                                         133   3e-34
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...   133   3e-34
CAGL0M08404g complement(836791..838179) some similarities with s...   135   4e-34
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...   133   5e-34
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...   136   1e-33
Scas_703.5                                                            136   1e-33
Scas_690.13                                                           129   6e-33
Scas_715.34                                                           129   4e-31
Kwal_56.22788                                                         127   4e-31
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...   127   6e-31
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...   125   1e-30
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...   124   2e-29
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...   124   2e-29
Scas_593.14d                                                          121   2e-29
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...   122   2e-29
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...   122   7e-29
Kwal_27.10581                                                         122   7e-29
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...   122   1e-28
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....   121   1e-28
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...   120   3e-28
Kwal_56.22693                                                         119   4e-28
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...   114   2e-26
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...   113   4e-26
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...   113   5e-26
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....   112   5e-26
Scas_660.20                                                           110   6e-25
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...   110   6e-25
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...   109   9e-25
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...   108   2e-24
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...   103   1e-22
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...   102   2e-22
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...   102   2e-22
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...   102   3e-22
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...   100   5e-22
Kwal_56.22476                                                         100   5e-22
Kwal_14.1159                                                          100   1e-21
Scas_707.3                                                             99   2e-21
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    98   3e-21
Kwal_47.18307                                                          98   3e-21
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    98   6e-21
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    96   1e-20
Scas_502.2                                                             96   2e-20
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    91   2e-19
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    92   3e-19
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    92   3e-19
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    89   5e-19
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    91   1e-18
Kwal_26.8796                                                           90   1e-18
KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces c...    89   3e-18
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    88   7e-18
Kwal_56.24091                                                          86   7e-18
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    88   8e-18
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    87   1e-17
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    87   1e-17
Scas_644.15                                                            86   2e-17
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    84   2e-17
YPL153C (RAD53) [5294] chr16 complement(261726..264191) Serine/t...    86   3e-17
Scas_493.2                                                             86   3e-17
Scas_616.10                                                            86   5e-17
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    85   8e-17
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    84   1e-16
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    82   5e-16
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    82   5e-16
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    82   5e-16
Scas_700.54                                                            82   6e-16
Kwal_14.2497                                                           80   6e-16
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    81   7e-16
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    81   8e-16
Scas_700.28                                                            81   9e-16
Scas_627.7                                                             79   9e-16
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    80   2e-15
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    79   2e-15
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    80   3e-15
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    79   4e-15
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    78   7e-15
Kwal_55.21545                                                          78   7e-15
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    78   1e-14
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    77   1e-14
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    77   2e-14
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    75   2e-14
Scas_675.2                                                             76   2e-14
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    76   2e-14
Kwal_26.7788                                                           77   2e-14
Scas_618.15                                                            76   3e-14
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    76   3e-14
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    76   3e-14
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    75   4e-14
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    75   4e-14
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    75   5e-14
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    74   8e-14
Scas_477.5                                                             75   9e-14
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    75   9e-14
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    74   1e-13
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    74   1e-13
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    74   1e-13
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    74   1e-13
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    72   2e-13
Scas_660.28                                                            73   2e-13
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    74   2e-13
Kwal_23.5290                                                           73   2e-13
Kwal_55.20326                                                          73   2e-13
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    73   3e-13
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    73   4e-13
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    73   4e-13
Kwal_26.8751                                                           72   4e-13
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    72   5e-13
Scas_580.6                                                             72   5e-13
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    72   6e-13
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    72   6e-13
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    71   6e-13
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    72   7e-13
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    71   8e-13
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    71   8e-13
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    71   8e-13
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    72   8e-13
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    71   9e-13
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    72   9e-13
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    71   1e-12
Scas_668.22                                                            71   1e-12
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    71   1e-12
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    70   1e-12
Scas_720.94                                                            71   1e-12
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    71   1e-12
Kwal_23.3590                                                           70   2e-12
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    70   2e-12
Scas_628.9                                                             70   2e-12
Scas_598.6                                                             70   2e-12
KLLA0E11979g complement(1060048..1061892) some similarities with...    70   2e-12
Kwal_33.13222                                                          65   2e-12
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    70   2e-12
Kwal_47.18233                                                          70   2e-12
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    69   2e-12
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    70   2e-12
Kwal_33.13112                                                          70   2e-12
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    70   3e-12
CAGL0M10153g complement(1010688..1013291) some similarities with...    70   3e-12
Scas_613.5                                                             69   3e-12
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    69   3e-12
Kwal_33.14167                                                          70   3e-12
Kwal_23.6325                                                           70   3e-12
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    69   3e-12
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    70   3e-12
Kwal_55.21709                                                          68   3e-12
Kwal_27.9763                                                           69   4e-12
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    69   4e-12
Kwal_26.7861                                                           69   4e-12
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    69   4e-12
Kwal_0.155                                                             69   5e-12
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    69   6e-12
Scas_640.14*                                                           69   6e-12
Scas_573.10                                                            69   6e-12
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    68   7e-12
Kwal_0.307                                                             68   7e-12
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    68   8e-12
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    68   9e-12
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    68   9e-12
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    68   1e-11
YLR248W (RCK2) [3644] chr12 (634254..636086) Calcium/calmodulin-...    68   1e-11
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    68   1e-11
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    67   2e-11
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    67   2e-11
Scas_678.24                                                            68   2e-11
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    67   2e-11
Scas_673.20*                                                           67   2e-11
Scas_640.16                                                            67   2e-11
Scas_685.24                                                            67   2e-11
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    67   2e-11
Kwal_33.13831                                                          67   2e-11
Scas_713.7                                                             67   3e-11
Kwal_14.1416                                                           65   3e-11
Scas_648.17                                                            65   3e-11
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    67   3e-11
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    66   3e-11
Scas_700.34                                                            66   4e-11
Scas_693.17                                                            66   4e-11
Kwal_26.8709                                                           66   4e-11
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    66   4e-11
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    64   5e-11
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    66   5e-11
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    66   6e-11
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    65   6e-11
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    65   7e-11
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    65   8e-11
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    65   8e-11
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    65   8e-11
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    65   8e-11
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    64   9e-11
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    65   9e-11
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    65   9e-11
Kwal_23.5668                                                           65   9e-11
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    65   1e-10
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    65   1e-10
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    64   1e-10
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    65   1e-10
Scas_564.7                                                             65   1e-10
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    64   1e-10
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    63   1e-10
Scas_707.36                                                            64   2e-10
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    64   2e-10
Scas_711.25                                                            64   2e-10
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    64   2e-10
Scas_633.29                                                            64   2e-10
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    63   2e-10
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    64   2e-10
Scas_710.28                                                            62   2e-10
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    63   3e-10
Kwal_56.23717                                                          64   3e-10
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    64   3e-10
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    62   3e-10
Kwal_26.8703                                                           63   3e-10
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    62   3e-10
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    63   4e-10
Scas_700.35                                                            62   4e-10
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    63   4e-10
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    63   4e-10
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    62   4e-10
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    62   4e-10
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    62   5e-10
Scas_602.11                                                            63   5e-10
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    61   5e-10
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    62   5e-10
Scas_568.9*                                                            61   5e-10
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    61   5e-10
Kwal_17.2687                                                           62   5e-10
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    62   7e-10
Kwal_0.96                                                              62   7e-10
Scas_651.19                                                            62   7e-10
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    60   7e-10
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    62   8e-10
YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of t...    61   8e-10
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    61   8e-10
Scas_713.21                                                            62   8e-10
Scas_635.1                                                             61   9e-10
Kwal_47.17252                                                          62   9e-10
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    61   9e-10
Kwal_55.20189                                                          62   1e-09
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    61   1e-09
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    62   1e-09
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    61   1e-09
Kwal_47.18098                                                          60   1e-09
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    60   1e-09
Kwal_27.12559                                                          60   1e-09
Scas_707.34                                                            61   2e-09
Scas_619.5*                                                            60   2e-09
Scas_688.14                                                            60   2e-09
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    60   2e-09
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    61   2e-09
Kwal_47.17263                                                          60   2e-09
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    60   2e-09
Scas_713.38                                                            60   3e-09
Kwal_27.11803                                                          58   3e-09
Kwal_14.1273                                                           60   3e-09
Kwal_23.5576                                                           60   3e-09
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    60   3e-09
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    59   3e-09
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    60   3e-09
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    60   4e-09
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    59   4e-09
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    60   4e-09
Scas_704.50                                                            59   5e-09
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    59   5e-09
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    59   5e-09
Scas_683.6                                                             59   6e-09
Scas_689.24                                                            59   7e-09
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    59   7e-09
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    59   8e-09
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    58   9e-09
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    58   9e-09
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    58   1e-08
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    58   1e-08
Kwal_56.23841                                                          58   1e-08
Kwal_26.7355                                                           58   1e-08
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    57   1e-08
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    57   1e-08
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    57   2e-08
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    57   2e-08
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    58   2e-08
Scas_667.18                                                            57   2e-08
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    57   2e-08
Scas_680.20                                                            57   2e-08
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    57   2e-08
Scas_721.110                                                           57   2e-08
KLLA0A06820g complement(615686..618004) some similarities with s...    57   2e-08
Kwal_27.10004                                                          57   2e-08
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    57   3e-08
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    57   3e-08
Kwal_55.22001                                                          56   3e-08
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    56   3e-08
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    56   3e-08
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    56   4e-08
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    56   4e-08
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    56   4e-08
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    55   4e-08
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    56   5e-08
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    56   5e-08
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    56   5e-08
Kwal_27.9773                                                           55   6e-08
Kwal_33.14192                                                          55   7e-08
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    55   7e-08
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    55   7e-08
CAGL0K01661g complement(146952..148400) some similarities with t...    55   8e-08
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    55   1e-07
Scas_653.25                                                            55   1e-07
Scas_582.1                                                             55   1e-07
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    55   1e-07
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    55   1e-07
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    55   1e-07
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    55   1e-07
Scas_643.20                                                            55   1e-07
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    55   1e-07
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    54   1e-07
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    55   1e-07
Scas_201.1*                                                            54   1e-07
KLLA0D09328g complement(788565..791705) some similarities with s...    55   1e-07
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    54   1e-07
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    54   2e-07
Scas_548.6                                                             55   2e-07
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    54   2e-07
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    54   2e-07
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    54   2e-07
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    54   2e-07
Scas_677.18                                                            54   2e-07
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    54   2e-07
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    54   2e-07
KLLA0C16577g complement(1451181..1452695) some similarities with...    54   2e-07
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    54   2e-07
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    54   3e-07
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    54   3e-07
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    54   3e-07
Kwal_26.7552                                                           54   3e-07
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    53   3e-07
Scas_718.90                                                            54   3e-07
Scas_610.7                                                             54   3e-07
Scas_22.1                                                              52   3e-07
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    53   4e-07
CAGL0M08360g complement(833220..835520) some similarities with s...    53   4e-07
Kwal_33.14081                                                          53   5e-07
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    53   5e-07
Kwal_56.24584                                                          52   5e-07
Kwal_23.3471                                                           52   5e-07
Kwal_27.11830                                                          53   5e-07
Scas_623.11                                                            52   6e-07
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    53   6e-07
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    53   6e-07
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    53   7e-07
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    53   7e-07
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    52   7e-07
Scas_634.5                                                             52   8e-07
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    52   8e-07
Scas_683.12                                                            52   9e-07
Scas_698.37                                                            51   9e-07
Scas_544.6                                                             52   9e-07
Scas_649.30                                                            51   2e-06
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    50   2e-06
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    51   2e-06
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    51   2e-06
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    51   2e-06
Scas_618.8                                                             50   2e-06
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    50   2e-06
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    50   2e-06
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    50   3e-06
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    50   3e-06
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    50   3e-06
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    50   4e-06
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    49   4e-06
Scas_703.47                                                            50   4e-06
Scas_336.1                                                             50   4e-06
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    50   5e-06
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    50   5e-06
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    49   5e-06
Scas_721.46                                                            49   5e-06
Kwal_26.7154                                                           50   5e-06
Kwal_47.17868                                                          49   5e-06
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    50   6e-06
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    50   6e-06
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    49   7e-06
Kwal_33.14434                                                          49   7e-06
Kwal_23.4276                                                           49   8e-06
KLLA0F22297g complement(2083448..2085547) some similarities with...    49   8e-06
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    49   9e-06
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    48   9e-06
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    49   9e-06
Scas_716.73                                                            48   1e-05
Scas_584.11                                                            49   1e-05
Scas_613.13*                                                           48   1e-05
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    48   1e-05
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    49   1e-05
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    48   1e-05
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    47   1e-05
Scas_692.24                                                            48   1e-05
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    48   1e-05
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    48   2e-05
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    47   2e-05
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    48   2e-05
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    48   2e-05
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    47   2e-05
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    48   2e-05
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    48   2e-05
Kwal_47.17345                                                          48   2e-05
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    47   2e-05
YKL198C (PTK1) [3074] chr11 complement(68274..70223) Protein con...    47   2e-05
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    47   3e-05
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    47   3e-05
Scas_695.33                                                            47   3e-05
Scas_651.3                                                             47   4e-05
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    47   4e-05
Scas_711.15                                                            47   4e-05
Kwal_55.21900                                                          47   4e-05
Kwal_33.13984                                                          47   4e-05
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    47   5e-05
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    47   5e-05
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    47   5e-05
Scas_568.13                                                            46   5e-05
KLLA0C03938g complement(358851..360632) some similarities with s...    46   5e-05
KLLA0D12100g complement(1031728..1033161) some similarities with...    46   5e-05
Kwal_27.11919                                                          45   5e-05
Scas_655.2                                                             46   7e-05
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    45   7e-05
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    46   8e-05
Scas_673.34*                                                           45   9e-05
Scas_684.28                                                            45   1e-04
Scas_718.72                                                            45   1e-04
Kwal_33.13681                                                          45   1e-04
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    45   1e-04
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    45   1e-04
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    45   2e-04
Kwal_26.8347                                                           45   2e-04
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    45   2e-04
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    45   2e-04
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    45   2e-04
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    44   2e-04
Scas_671.16                                                            45   2e-04
KLLA0B06501g complement(576636..579089) some similarities with s...    45   2e-04
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    44   2e-04
YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine pr...    44   2e-04
Scas_721.132                                                           44   2e-04
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    44   3e-04
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    44   3e-04
Scas_721.61                                                            44   3e-04
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    44   4e-04
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    44   5e-04
Kwal_27.11777                                                          43   5e-04
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    43   5e-04
Kwal_27.9804                                                           43   6e-04
Kwal_26.8941                                                           43   6e-04
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    43   6e-04
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    43   7e-04
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    43   8e-04
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    42   0.001
YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I (s...    42   0.001
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    42   0.001
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    42   0.001
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    42   0.001
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    42   0.002
Kwal_33.14596                                                          42   0.002
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    42   0.002

>Kwal_23.3992
          Length = 571

 Score = 1117 bits (2889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/563 (95%), Positives = 539/563 (95%)

Query: 1   MYQKSTTNRYRDIESLTDNIGQLSFDAAVDSPKYHYPPSTPSKFRGDVDNPSPSKSVNGA 60
           MYQKSTTNRYRDIESLTDNIGQLSFDAAVDSPKYHYPPSTPSKFRGDVDNPSPSKSVNGA
Sbjct: 1   MYQKSTTNRYRDIESLTDNIGQLSFDAAVDSPKYHYPPSTPSKFRGDVDNPSPSKSVNGA 60

Query: 61  DVSRTSMMDIDDTSNVDIDYTQSPKKLPLDFHRKASSTNTKRLVNVCQMYFLDYYCDMFD 120
           DVSRTSMMDIDDTSNVDIDYTQSPKKLPLDFHRKASSTNTKRLVNVCQMYFLDYYCDMFD
Sbjct: 61  DVSRTSMMDIDDTSNVDIDYTQSPKKLPLDFHRKASSTNTKRLVNVCQMYFLDYYCDMFD 120

Query: 121 YVISRRERTRQVMKYLEQQRTQGIVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMIT 180
           YVISRRERTRQVMKYLEQQRTQGIVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMIT
Sbjct: 121 YVISRRERTRQVMKYLEQQRTQGIVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMIT 180

Query: 181 XXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLL 240
                      LARKRDTREICA             ETNHVLTERDILTTTRSEWLVKLL
Sbjct: 181 QVGQGGYGQVYLARKRDTREICALKILNKKLLIKLNETNHVLTERDILTTTRSEWLVKLL 240

Query: 241 YAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDL 300
           YAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDL
Sbjct: 241 YAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDL 300

Query: 301 KPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMY 360
           KPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMY
Sbjct: 301 KPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMY 360

Query: 361 TNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTN 420
           TNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTN
Sbjct: 361 TNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTN 420

Query: 421 ETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEIS 480
           ETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEIS
Sbjct: 421 ETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEIS 480

Query: 481 FENLRNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLV 540
           FENLRNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLV
Sbjct: 481 FENLRNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLV 540

Query: 541 GFTYRHKKGKNGSSGVIYGGPEH 563
           GFTYRHKKGKNGSSGVIYGGPEH
Sbjct: 541 GFTYRHKKGKNGSSGVIYGGPEH 563

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score =  855 bits (2210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/563 (73%), Positives = 476/563 (84%), Gaps = 7/563 (1%)

Query: 8   NRYRDIESLTDNIGQLSFDAAVDSPKYHY--PPSTPSKFRGDVDN-PSPSKSVNG---AD 61
           N  RD+++L  +IGQLSF+  +++ ++    PP TPS++     N  SP+    G    +
Sbjct: 7   NNVRDVDALAQDIGQLSFEGEMENRRHIVIDPPHTPSRYLQRTPNGKSPAGRQGGYLTVE 66

Query: 62  VSRTSMMDIDDTSNVDIDYTQSPKKLPLDFHRKASSTNTKRLVNVCQMYFLDYYCDMFDY 121
            +  S MD+D+    DID ++SPKKLP+DFH++ASST TKRLV+VCQM+FLDYYCDMFDY
Sbjct: 67  NADYSGMDVDERPRDDIDLSRSPKKLPMDFHKRASSTKTKRLVSVCQMFFLDYYCDMFDY 126

Query: 122 VISRRERTRQVMKYLEQQRTQGI-VGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMIT 180
           VISRRERTRQVM YLEQQR QG+   +E+S+EWQ YL +ET ILRKRRLKPKNKDFE+IT
Sbjct: 127 VISRRERTRQVMNYLEQQRAQGLHSAQEISEEWQNYLYRETDILRKRRLKPKNKDFEIIT 186

Query: 181 XXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLL 240
                      LARK+DT+EICA              T+HVLTERDILTTTRSEWLVKLL
Sbjct: 187 QVGQGGYGQVYLARKKDTKEICALKILNKNLLAKLNGTDHVLTERDILTTTRSEWLVKLL 246

Query: 241 YAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDL 300
           YAFQDP SLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALH+LGYTHRDL
Sbjct: 247 YAFQDPHSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHKLGYTHRDL 306

Query: 301 KPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMY 360
           KPENFLIDS+GHIKLTDFGLA+GTVSMERIESM+IRLEEVKNL+FP+F+E SM+ RR+MY
Sbjct: 307 KPENFLIDSKGHIKLTDFGLASGTVSMERIESMRIRLEEVKNLEFPEFKETSMDYRRKMY 366

Query: 361 TNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTN 420
             +RE ++NYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSS+N
Sbjct: 367 HRVREKELNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSSN 426

Query: 421 ETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEIS 480
           ETYENLR WKQVLRRPRC+NGR AFSDRTW+LI RLIADPI+RLRSFEHVKKMKYFAEI 
Sbjct: 427 ETYENLRRWKQVLRRPRCENGRPAFSDRTWELITRLIADPINRLRSFEHVKKMKYFAEID 486

Query: 481 FENLRNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLV 540
           F NLR++SPPFIPQLD+ETDAGYFDDFT+EADMAKYADVFKRQDKL+AMV++S   SKLV
Sbjct: 487 FANLRSMSPPFIPQLDSETDAGYFDDFTNEADMAKYADVFKRQDKLNAMVEESSNSSKLV 546

Query: 541 GFTYRHKKGKNGSSGVIYGGPEH 563
           GFT+RH+KGK GSSGV++ G EH
Sbjct: 547 GFTFRHRKGKTGSSGVLHNGSEH 569

>KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1
           Kluyveromyces lactis DBF2, start by similarity
          Length = 567

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/566 (70%), Positives = 469/566 (82%), Gaps = 10/566 (1%)

Query: 1   MYQKSTTNRYRDIESLTDNIGQLSFDAAVDSPKYHYPPSTPSKFRGDVDNPSPSKSVNGA 60
           M+ +    R++++++L D++   SFD   D+     PPSTP++ RG   +PSP++S+   
Sbjct: 1   MFTRDANGRHKEVDALVDDMVNFSFDT--DAKVMLDPPSTPTRIRG---SPSPTRSI--V 53

Query: 61  DVSRTSMMDIDDTSNVDI--DYTQSPKKLPLDFHRKASSTNTKRLVNVCQMYFLDYYCDM 118
                S+MDIDD +  D+  D T+SPKKLP DF++K+S T +KRLV+VCQMYFLDYYCDM
Sbjct: 54  KNPENSLMDIDDDTQGDLTADITKSPKKLPKDFYKKSSKTKSKRLVSVCQMYFLDYYCDM 113

Query: 119 FDYVISRRERTRQVMKYLEQQRTQGIVG-EELSKEWQAYLTKETGILRKRRLKPKNKDFE 177
           FDYVISRRERTRQV+ YLE+QR   ++G E+++ EWQ YLTKET ILRKRRLKPK+KDFE
Sbjct: 114 FDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETNILRKRRLKPKHKDFE 173

Query: 178 MITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLV 237
           MIT           LARK+DT+EICA              T+HVLTERDILTTTRSEWLV
Sbjct: 174 MITQVGQGGYGQVYLARKKDTKEICALKILNKKLLMKLEGTDHVLTERDILTTTRSEWLV 233

Query: 238 KLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTH 297
           KLLYAFQDP SLYLAMEFVPGGD+RTLL+NT+FLQAPHARFYISEMFCAV+ALHQLGYTH
Sbjct: 234 KLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTH 293

Query: 298 RDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRR 357
           RDLKPENFLIDS+GHIKLTDFGLA+GTVSMERIESMKIRL+EVKNL+FP+F E+SM+DRR
Sbjct: 294 RDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRR 353

Query: 358 EMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGS 417
            MY  LRE +V YA STVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSG+
Sbjct: 354 RMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGN 413

Query: 418 STNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFA 477
           STNETYENLR WK VL+RP+CDNGRYAFSDRTW+LI RLIADPI+RL+SFEHVK+M+YF+
Sbjct: 414 STNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRMRYFS 473

Query: 478 EISFENLRNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVS 537
           EI F  LR + PPFIPQLDNE D GYFDDFT+E  MA+Y DVFKRQD+L+AMVDDS + S
Sbjct: 474 EIDFNTLRTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDRLTAMVDDSLSDS 533

Query: 538 KLVGFTYRHKKGKNGSSGVIYGGPEH 563
           KLVGFT+RH+ GK+GSSGV+YGG E 
Sbjct: 534 KLVGFTFRHRNGKDGSSGVLYGGLEQ 559

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/562 (66%), Positives = 445/562 (79%), Gaps = 24/562 (4%)

Query: 13  IESLTDNIGQLSFDAAV-----DSPKYHYPPSTPSKFRGDVDNPSP-----SKSVNGADV 62
           +E +T NI QL  +  +     ++P   Y PSTP++++ +    SP     +KS+   + 
Sbjct: 10  VEDITGNISQLGLNGTLSPATGNTPFKKYAPSTPTQYKENRSGASPYSTSPTKSIFKKEK 69

Query: 63  SRTSMMDIDDTSNVDIDYTQSPKKLPLDFHRKASSTNTKRLVNVCQMYFLDYYCDMFDYV 122
            R  +++             SPKKLP DFHRKA+S  T+RLV+VCQMYFLDYYCDMFDYV
Sbjct: 70  PRERIIN-------------SPKKLPRDFHRKATSNKTQRLVSVCQMYFLDYYCDMFDYV 116

Query: 123 ISRRERTRQVMKYLEQ-QRTQGIVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMITX 181
           ISRR+RT+Q++  +++ ++   I  E+L++EW  YL KE  +LRKRRLKPKNKDFEMIT 
Sbjct: 117 ISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQKEHEVLRKRRLKPKNKDFEMITQ 176

Query: 182 XXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLY 241
                     LARKRDT+E+CA             ETNH+LTERDILTTTRSEWLVKLLY
Sbjct: 177 VGQGGYGQVYLARKRDTKEVCALKILNKKLLVKLNETNHILTERDILTTTRSEWLVKLLY 236

Query: 242 AFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLK 301
           AFQDP SLYLAMEFVPGGD+RTLLINTR L++PHARFYISEMFCAV+ALH+LGYTHRDLK
Sbjct: 237 AFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLK 296

Query: 302 PENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYT 361
           PENFLID+ GHIKLTDFGLAAGTVS ERIESMKIRLEEVKNL+FP F EKS+ DRR++Y 
Sbjct: 297 PENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQ 356

Query: 362 NLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNE 421
           NLR+ND+NYA+S VGSPDYMALEVLE K YD+TVDYWSLGC+LFE+L+GYTPFSGSSTNE
Sbjct: 357 NLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNE 416

Query: 422 TYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEISF 481
           TYENLR WK+ LRRP  ++GR A SDR W+LI RLIADPI+RLRSFEHVK+M YF EI+F
Sbjct: 417 TYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNYFHEINF 476

Query: 482 ENLRNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLVG 541
           + LR +SPPF PQLDNETDAGYFDDFT+EADMAKYADVFKRQDKL+AMVDDS+  SKL+G
Sbjct: 477 DTLRQLSPPFTPQLDNETDAGYFDDFTNEADMAKYADVFKRQDKLAAMVDDSEVDSKLIG 536

Query: 542 FTYRHKKGKNGSSGVIYGGPEH 563
           FT+RHK G  GSSGV+Y G E+
Sbjct: 537 FTFRHKNGNTGSSGVLYKGHEN 558

>Scas_705.23
          Length = 553

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/553 (67%), Positives = 435/553 (78%), Gaps = 14/553 (2%)

Query: 11  RDIESLTDNIGQLSFDAAVDSPKYHYPPSTPSKFRGDVDNPSPSKSVNGADVSRTSMMDI 70
           +D++ L  N+ QL     ++ P   +   TP++     +  + S        ++T     
Sbjct: 7   KDVDQLVGNLNQL----GLNKPNARFVSVTPTR----ANKENRSSLSPSPSPNKTKRFTA 58

Query: 71  DDTSNVDIDYTQSPKKLPLDFHRKASSTNTKRLVNVCQMYFLDYYCDMFDYVISRRERTR 130
           D+T     +   SPKKLP DF++KA S +TKR+VNVCQMYFLDYYCDMFDYVISRR+RT+
Sbjct: 59  DET-----ELKNSPKKLPHDFYKKALSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTK 113

Query: 131 QVMKYLEQQRTQGIVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMITXXXXXXXXXX 190
            V+ YLE+ +   +  EEL+ EW AYL +E  +LRKRRLKPKNKDFEMIT          
Sbjct: 114 SVLNYLERNQ-NSLSTEELNNEWTAYLQQEHDVLRKRRLKPKNKDFEMITQVGQGGYGQV 172

Query: 191 XLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLY 250
            LARKRDT+E+CA             ETNHVLTERDILTTTRS+WLVKLLYAFQD  SLY
Sbjct: 173 YLARKRDTKEVCALKILNKKLLFKLNETNHVLTERDILTTTRSDWLVKLLYAFQDTESLY 232

Query: 251 LAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSR 310
           LAMEFVPGGD+RTLLINTRFL+  HARFYISEMFCAV+ALH+LGYTHRDLKPENFLIDS 
Sbjct: 233 LAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSE 292

Query: 311 GHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNY 370
           GHIKLTDFGLAAGT+S ERI+SMKIRLEEVKNL+FP F EKS+ DRR+MYT+LR+ +VNY
Sbjct: 293 GHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNY 352

Query: 371 ASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWK 430
           A+S VGSPDYMALEVLE K YDFTVDYWSLGC+LFESLVGYTPFSGSSTNETYENLR WK
Sbjct: 353 ANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWK 412

Query: 431 QVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEISFENLRNVSPP 490
           + LRRP  DNGR AFSDRTWD+I RLIADPI+RLRSFEH+K+M YFAE++F  LR  +PP
Sbjct: 413 KTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPP 472

Query: 491 FIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLVGFTYRHKKGK 550
           F PQLD+ETDAGYFDDFT+EADMAKYADVFKRQ+KLS+MVDDS   SKLVGFT+RH+ G+
Sbjct: 473 FTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLSSMVDDSAVDSKLVGFTFRHRNGQ 532

Query: 551 NGSSGVIYGGPEH 563
            G SG++Y G EH
Sbjct: 533 KGLSGILYNGSEH 545

>Scas_716.33
          Length = 573

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/572 (65%), Positives = 444/572 (77%), Gaps = 29/572 (5%)

Query: 11  RDIESLTDNIGQLSFD-------------AAVDSPKYHYPPSTPSKFRGDVDNPSP---- 53
           R +E+LT  + QL+F+             A++D+       STP+K++ D  N SP    
Sbjct: 4   RKMENLTGTMHQLNFNLPNQPNRGSTSQFASLDNF------STPTKYKNDKLNGSPIPPG 57

Query: 54  --SKSVNGADVSRTSMMDIDDTSNVDIDYTQSPKKLPLDFHRKASSTNTKRLVNVCQMYF 111
                ++ +D    S MDID +S  DID T SPKKLP  F   AS+  T+RLV+VC+MYF
Sbjct: 58  ARRYEIDDSD----SKMDIDGSSYNDIDITNSPKKLPQGFQTMASNNKTQRLVSVCKMYF 113

Query: 112 LDYYCDMFDYVISRRERTRQVMKYLEQQRTQGIVGEELSKEWQAYLTKETGILRKRRLKP 171
           LDYYCDMFDYVISRR+RT++V++YLEQ++ + +    L+ EW  Y+ +E  +LRKRRLKP
Sbjct: 114 LDYYCDMFDYVISRRQRTKKVLEYLEQKKNENVDLNSLNNEWNGYIQREHQVLRKRRLKP 173

Query: 172 KNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTT 231
           K+KDFEMIT           LARK+DT E+CA             ETNHVLTERDILTTT
Sbjct: 174 KHKDFEMITQVGQGGYGQVYLARKKDTNEVCALKILNKKLLFKLNETNHVLTERDILTTT 233

Query: 232 RSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALH 291
           RS+WLVKLLYAFQD  +LYLAMEFVPGGD+RTLLINTRFL++ HARFYISEMF AV+ALH
Sbjct: 234 RSQWLVKLLYAFQDTQNLYLAMEFVPGGDFRTLLINTRFLKSTHARFYISEMFLAVNALH 293

Query: 292 QLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEK 351
            LGYTHRDLKPENFLID++GHIKLTDFGLAAGT+S +RI+SMK+RLEEVKNL+FP+F +K
Sbjct: 294 DLGYTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNDRIQSMKVRLEEVKNLEFPEFSDK 353

Query: 352 SMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGY 411
           S+ DRR+MY   RE +VNYA+S VGSPDYMALEVLE K YDFTVDYWSL C+LFESLVGY
Sbjct: 354 SIEDRRQMYQKYRETEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLSCMLFESLVGY 413

Query: 412 TPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVK 471
           TPFSGSSTNETYENLR WK+ LRRP  DNGR AFSDRTWD I RLIADPI+RLRSFEHVK
Sbjct: 414 TPFSGSSTNETYENLRHWKKTLRRPMLDNGRPAFSDRTWDFITRLIADPINRLRSFEHVK 473

Query: 472 KMKYFAEISFENLRNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVD 531
           +M YF  + F  LR++SPPFIPQLDNETDAGYFDDFT+EADMAKYADVFKRQ+KLS MV+
Sbjct: 474 RMTYFESVDFNTLRDLSPPFIPQLDNETDAGYFDDFTNEADMAKYADVFKRQNKLSTMVN 533

Query: 532 DSDAVSKLVGFTYRHKKGKNGSSGVIYGGPEH 563
           D+D  SKLVGFT+RH+ GKNGSSGV+Y G E 
Sbjct: 534 DADIDSKLVGFTFRHRYGKNGSSGVLYNGLEQ 565

>YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine
           protein kinase related to Dbf20p, required for events in
           anaphase/telophase, component of the CCR4-NOT
           transcriptional complex [1719 bp, 572 aa]
          Length = 572

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/559 (66%), Positives = 443/559 (79%), Gaps = 7/559 (1%)

Query: 11  RDIESLTDNIGQLSFDA-AVDSPKYHYPPSTPSKFR----GDVDNPSPSKSVNGADVSRT 65
           ++++ L  N+  LSFD          +P    +K R    G  D+PSP K  +      T
Sbjct: 7   KNVDLLAGNMSNLSFDGHGTPGGTGLFPNQNITKRRTRPAGINDSPSPVKP-SFFPYEDT 65

Query: 66  SMMDIDDTSNVDIDYTQSPKKLPLDFHRKASSTNTKRLVNVCQMYFLDYYCDMFDYVISR 125
           S MDID+ S  D+D + SPKKLP  F+ +A+S  T+R+V+VC+MYFL++YCDMFDYVISR
Sbjct: 66  SNMDIDEVSQPDMDVSNSPKKLPPKFYERATSNKTQRVVSVCKMYFLEHYCDMFDYVISR 125

Query: 126 RERTRQVMKYLEQQRTQGIVGE-ELSKEWQAYLTKETGILRKRRLKPKNKDFEMITXXXX 184
           R+RT+QV++YL+QQ       + +L++EW +YL +E  +LRKRRLKPKN+DFEMIT    
Sbjct: 126 RQRTKQVLEYLQQQSQLPNSDQIKLNEEWSSYLQREHQVLRKRRLKPKNRDFEMITQVGQ 185

Query: 185 XXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQ 244
                  LARK+DT+E+CA             ET HVLTERDILTTTRSEWLVKLLYAFQ
Sbjct: 186 GGYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSEWLVKLLYAFQ 245

Query: 245 DPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPEN 304
           D  SLYLAMEFVPGGD+RTLLINTR L++ HARFYISEMFCAV+ALH LGYTHRDLKPEN
Sbjct: 246 DLQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLGYTHRDLKPEN 305

Query: 305 FLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLR 364
           FLID++GHIKLTDFGLAAGT+S ERIESMKIRLE++K+L+FP F EKS+ DRR+MY  LR
Sbjct: 306 FLIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIEDRRKMYNQLR 365

Query: 365 ENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYE 424
           E ++NYA+S VGSPDYMALEVLE K YDFTVDYWSLGC+LFESLVGYTPFSGSSTNETY+
Sbjct: 366 EKEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYD 425

Query: 425 NLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEISFENL 484
           NLR WKQ LRRPR  +GR AFSDRTWDLI RLIADPI+RLRSFEHVK+M YFA+I+F  L
Sbjct: 426 NLRRWKQTLRRPRQSDGRAAFSDRTWDLITRLIADPINRLRSFEHVKRMSYFADINFSTL 485

Query: 485 RNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLVGFTY 544
           R++ PPF PQLD+ETDAGYFDDFTSEADMAKYADVFKRQDKL+AMVDDS   SKLVGFT+
Sbjct: 486 RSMIPPFTPQLDSETDAGYFDDFTSEADMAKYADVFKRQDKLTAMVDDSAVSSKLVGFTF 545

Query: 545 RHKKGKNGSSGVIYGGPEH 563
           RH+ GK GSSG+++ G EH
Sbjct: 546 RHRNGKQGSSGILFNGLEH 564

>CAGL0G03047g 282299..283918 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase or sp|P32328 Saccharomyces cerevisiae YPR111w
           DBF20, hypothetical start
          Length = 539

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/524 (69%), Positives = 422/524 (80%), Gaps = 5/524 (0%)

Query: 44  FRGDVDNPSPSK-SVNGADVSRTSMMDIDDTSN-VDID-YTQSPKKLPLDFHRKASSTNT 100
            R     PSP K  VN  +    S MDIDD++N  +ID    SPKKLP  F  KAS+  T
Sbjct: 9   LRDHTPTPSPKKDGVNNLE-QELSAMDIDDSANDTNIDELLHSPKKLPAGFRSKASNNKT 67

Query: 101 KRLVNVCQMYFLDYYCDMFDYVISRRERTRQVMKYLEQQRTQGIVGEELS-KEWQAYLTK 159
           +RLV VC+MYFL+YYCDMFDYVISRR+RT+Q+M+YL Q+   G + E  +  EW+ YL K
Sbjct: 68  QRLVGVCKMYFLEYYCDMFDYVISRRQRTKQIMEYLRQENENGRLDEHTADTEWRGYLAK 127

Query: 160 ETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETN 219
           E  ILRKRRLKPKN DFEM+T           LARKRDT+E+CA             ETN
Sbjct: 128 ENNILRKRRLKPKNNDFEMLTQVGQGGYGQVYLARKRDTKEVCALKILNKKLLHRLNETN 187

Query: 220 HVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFY 279
           HVLTERDILTTTRSEWLVKLLYAFQD SSLYLAMEFVPGGD+RTLLINT++L++ HARFY
Sbjct: 188 HVLTERDILTTTRSEWLVKLLYAFQDSSSLYLAMEFVPGGDFRTLLINTKYLKSTHARFY 247

Query: 280 ISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEE 339
           ISEMFCAV+ALH+LGYTHRDLKPENFLID++GHIKLTDFGLAAGTVS ERIESMKIRLEE
Sbjct: 248 ISEMFCAVNALHELGYTHRDLKPENFLIDAKGHIKLTDFGLAAGTVSNERIESMKIRLEE 307

Query: 340 VKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWS 399
           VKNL+FP F E+ + DRR+MY +LR+ D+NYA+S VGSPDYMALEVLE K YDFTVDYWS
Sbjct: 308 VKNLEFPAFTERPIEDRRKMYHDLRDTDINYANSMVGSPDYMALEVLEGKKYDFTVDYWS 367

Query: 400 LGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIAD 459
           LGC+LFESLV +TPFSG++TNETYENLR W++ LRRPR  NGRYA SDRTW  I  LIAD
Sbjct: 368 LGCMLFESLVSFTPFSGATTNETYENLRHWRKTLRRPRLGNGRYAVSDRTWAFITSLIAD 427

Query: 460 PISRLRSFEHVKKMKYFAEISFENLRNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADV 519
           PI+RL+SFEHVK+M YF+EI F  LR +SPPFIPQLD+E DAGYFDDFT+EADMAKYADV
Sbjct: 428 PINRLKSFEHVKRMPYFSEIDFSKLREMSPPFIPQLDSEVDAGYFDDFTNEADMAKYADV 487

Query: 520 FKRQDKLSAMVDDSDAVSKLVGFTYRHKKGKNGSSGVIYGGPEH 563
           FKRQ+KL+AM+DDS   SKLVGFT+RH+ GK+GSSG++Y G EH
Sbjct: 488 FKRQNKLNAMIDDSAVDSKLVGFTFRHRNGKHGSSGILYNGAEH 531

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score =  213 bits (542), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 145/482 (30%), Positives = 234/482 (48%), Gaps = 42/482 (8%)

Query: 97  STNTKRLVNVCQMYFLDYYCDMFDYVISRRERTRQVMKYLEQQRTQGIVGEELSKEWQAY 156
           S +T+      ++   ++Y    ++ I R +R  ++   L    + G   E  +++  + 
Sbjct: 234 SKSTQEKAAAVKLKVENFYQSSVNHAIERNQRRVELESQL---LSHGWSEERKNRQLSSL 290

Query: 157 LTKETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXX 216
             KE+  LR RR +   +DF  +            L +K+DT +I A             
Sbjct: 291 GKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD 350

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHA 276
           +  HV  ERD+L  + S W+V L Y+FQD   LYL MEF+PGGD  T+LI  +       
Sbjct: 351 QLAHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQIFTEDVT 410

Query: 277 RFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIR 336
           RFY++E   A++A+H+LG+ HRD+KP+N LID RGHIKL+DFGL+ G          K  
Sbjct: 411 RFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKL 470

Query: 337 LEE------------------------VKNLDFPKFEEKSMNDRREMYTNLRENDVNYAS 372
           L+E                         +N         +M +R++M T  R++    A 
Sbjct: 471 LQEDEQQQNGGNMGKYPASGGGGNGGGNRNTMLVDAIHLTMTNRQQMQT-WRKSRRLMAY 529

Query: 373 STVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQV 432
           STVG+PDY+A E+   + Y    D+WSLG I++E L+G+ PF   +  ETY  +  ++Q 
Sbjct: 530 STVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQT 589

Query: 433 LRRPRCDNGRYAFSDRTWDLIIRLIADPISRL--RSFEHVKKMKYFAEISFENLRNVSPP 490
           L  P  D+   ++     DLI RL++    RL       +K   +F  + +E +R V  P
Sbjct: 590 LVFP--DDIHISYEAE--DLIRRLLSHADERLGRHGANEIKNHPFFRGVDWETIRQVGAP 645

Query: 491 FIPQLDNETDAGYF--DDFTSEADMAKYADVFKRQDKL----SAMVDDSDAVSKL--VGF 542
           +IP+L + TD  +F  D+  +  D    A   K+++++     +  + + A   L  +G+
Sbjct: 646 YIPKLSSVTDTRFFPTDELENVPDSPAMAQAAKQREQMLKQGGSAANTAQAKEDLPFIGY 705

Query: 543 TY 544
           TY
Sbjct: 706 TY 707

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score =  210 bits (534), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 145/476 (30%), Positives = 229/476 (48%), Gaps = 36/476 (7%)

Query: 97  STNTKRLVNVCQMYFLDYYCDMFDYVISRRERTRQVMKYLEQQRTQGIVGEELSKEWQAY 156
           S +T+      ++   +YY     Y I R ER  ++   L    +     E  +++  + 
Sbjct: 294 SKSTQDKAAAVKLKVENYYQQSVKYAIERNERRVELETELG---SHNWSEERNARQLASL 350

Query: 157 LTKETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXX 216
             KE+  LR RR +   +DF  +            L +K+DT +I A             
Sbjct: 351 GKKESQFLRLRRTRLSLEDFHTVQVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD 410

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHA 276
           +  HV  ERD+L  T S W+V L Y+FQD   LYL MEF+PGGD  T+LI  +       
Sbjct: 411 QLAHVKAERDVLAGTDSPWIVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVT 470

Query: 277 RFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIR 336
           RFY++E   A++ +H+LG+ HRD+KP+N LID RGHIKL+DFGL+ G          K  
Sbjct: 471 RFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKL 530

Query: 337 LEE----VKNLDFPKFEEKSMNDRREMYTN--------------LRENDVNYASSTVGSP 378
           L++     KN   P       N+R+ M  +               R++    A STVG+P
Sbjct: 531 LQQDEATTKN-GAPNDAGDGSNNRQTMIVDSINLTMSNRQQIQTWRKSRRLMAYSTVGTP 589

Query: 379 DYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRC 438
           DY+A E+   + Y    D+WSLG I++E L+G+ PF   +  ETY  +  ++Q L+ P  
Sbjct: 590 DYIAPEIFLYQGYGQDCDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPED 649

Query: 439 DNGRYAFSDRTWDLIIRLIADPISRL---RSFEHVKKMKYFAEISFENLRNVSPPFIPQL 495
            +  Y       DLI RL+     RL      + +K   +F  + +  +R V  P+IP+L
Sbjct: 650 VHISY----EAEDLIRRLLTHSNQRLGRQGGADEIKSHPFFRGVDWNTIRQVEAPYIPKL 705

Query: 496 DNETDAGYF--DDFTSEADMAKYADVFKRQDKL--SAMVDDSDAVSK---LVGFTY 544
            + TD  +F  D+  +  D    A   K+++++  + +  + + V +    +G+TY
Sbjct: 706 SSITDTRFFPTDELENVPDSPAMAQAAKQREQMMKNGVNPNQNQVKEDLPFIGYTY 761

>Kwal_33.14554
          Length = 714

 Score =  208 bits (530), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 147/484 (30%), Positives = 233/484 (48%), Gaps = 44/484 (9%)

Query: 97  STNTKRLVNVCQMYFLDYYCDMFDYVISRRERTRQVMKYLEQQRTQGIVGEELSKEWQAY 156
           S +T+      ++   ++Y    +Y I R +R  ++   L    +Q    E  S++    
Sbjct: 227 SKSTQDKAATVKLKIENFYQSSVNYAIERNQRRVELESQL---VSQDWSDERKSRQLSTL 283

Query: 157 LTKETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXX 216
             KE+  LR RR +   +DF+ +            L +K+DT +I A             
Sbjct: 284 GRKESQFLRLRRTRLSLEDFQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD 343

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHA 276
           +  HV  ERD+L  + S W+V L Y+FQD   LYL MEF+PGGD  T+LI  +       
Sbjct: 344 QLAHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIFTEDVT 403

Query: 277 RFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIR 336
           RFY++E   A++A+H+LG+ HRD+KP+N LID RGHIKL+DFGL+ G          K  
Sbjct: 404 RFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKL 463

Query: 337 LEE------VKNLDFPKFE----------------------EKSMNDRREMYTNLRENDV 368
           L++        +L  P+                          +M +R+++ T  R++  
Sbjct: 464 LQQDEVNAAAGSLQKPQMGIVAGNNGGGSGNNRNTMFVDAIHLTMTNRQQIQT-WRKSRR 522

Query: 369 NYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRC 428
             A STVG+PDY+A E+   + Y    D+WSLG I++E L+G+ PF   +  ETY  +  
Sbjct: 523 LMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMN 582

Query: 429 WKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRL---RSFEHVKKMKYFAEISFENLR 485
           ++Q L+ P  D+   ++     DLI RL+     RL      + +K   +F  + +  +R
Sbjct: 583 FEQTLQFP--DDIHISYEAE--DLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTIR 638

Query: 486 NVSPPFIPQLDNETDAGYF--DDFTSEAD---MAKYADVFKRQDKLSAMVDDSDAVSKLV 540
            V  P+IP+L + TD  +F  D+  +  D   MA+ A   ++  K  A    S      +
Sbjct: 639 QVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAARQREQMMKQGAANPSSKEDLPFI 698

Query: 541 GFTY 544
           G+TY
Sbjct: 699 GYTY 702

>YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine
           protein kinase required for sporulation and production
           of daughter specific proteins [2271 bp, 756 aa]
          Length = 756

 Score =  208 bits (530), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 142/461 (30%), Positives = 222/461 (48%), Gaps = 37/461 (8%)

Query: 113 DYYCDMFDYVISRRERTRQVMKYLEQQRTQGIVGEEL-SKEWQAYLTKETGILRKRRLKP 171
           ++Y     Y I R ER  +    LE + T     EE  S++  +   KE+  LR RR + 
Sbjct: 292 NFYQSSVKYAIERNERRVE----LETELTSHNWSEERKSRQLSSLGKKESQFLRLRRTRL 347

Query: 172 KNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTT 231
             +DF  +            L +K+DT +I A             +  HV  ERD+L  +
Sbjct: 348 SLEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGS 407

Query: 232 RSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALH 291
            S W+V L Y+FQD   LYL MEF+PGGD  T+LI  +       RFY++E   A++ +H
Sbjct: 408 DSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIH 467

Query: 292 QLGYTHRDLKPENFLIDSRGHIKLTDFGLAAG---TVSMERIESMKIRLEEVKNLDFPKF 348
           +LG+ HRD+KP+N LID RGHIKL+DFGL+ G   T      + +  + E    +  P  
Sbjct: 468 KLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEATNGISKPGT 527

Query: 349 EEKSMND------------------RREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN 390
              +  D                   R+     R++    A STVG+PDY+A E+   + 
Sbjct: 528 YNANTTDTANKRQTMVVDSISLTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQG 587

Query: 391 YDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTW 450
           Y    D+WSLG I++E L+G+ PF   +  ETY  +  ++Q L+ P  D+   ++     
Sbjct: 588 YGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFP--DDIHISYEAE-- 643

Query: 451 DLIIRLIADPISRL---RSFEHVKKMKYFAEISFENLRNVSPPFIPQLDNETDAGYF--D 505
           DLI RL+     RL      + +K   +F  + +  +R V  P+IP+L + TD  +F  D
Sbjct: 644 DLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTIRQVEAPYIPKLSSITDTRFFPTD 703

Query: 506 DFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKL--VGFTY 544
           +  +  D    A   K++++++     +     L  +G+TY
Sbjct: 704 ELENVPDSPAMAQAAKQREQMTKQGGSAPVKEDLPFIGYTY 744

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score =  205 bits (522), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 143/472 (30%), Positives = 227/472 (48%), Gaps = 48/472 (10%)

Query: 113 DYYCDMFDYVISRRERTRQVMKYLEQQRTQGIVGEELSKEWQAYLTKETGILRKRRLKPK 172
           ++Y     Y I R +R  ++   L    +Q    E  +++  +   KE+  LR RR +  
Sbjct: 243 NFYQSSVGYAIERNQRRLELESELA---SQDWSEERKNRQLASLGKKESQFLRLRRTRLS 299

Query: 173 NKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTR 232
             DF  +            L +K+DT +I A             +  HV  ERD+L  + 
Sbjct: 300 LDDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAERDVLAGSD 359

Query: 233 SEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQ 292
           S W+V L Y+FQD   LYL MEF+PGGD  T+LI  +       RFY++E   A++ +H+
Sbjct: 360 SPWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEVIHK 419

Query: 293 LGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEE------------- 339
           LG+ HRD+KP+N LID RGHIKL+DFGL+ G          K  L+E             
Sbjct: 420 LGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSSYYKKLLQEDEAKKQQQQQQQQ 479

Query: 340 -----------------VKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMA 382
                             +N         +M +R++M T  R++    A STVG+PDY+A
Sbjct: 480 QQLNLQKPQLPNETNNGNRNTMLVDAIHLTMTNRQQMQT-WRKSRRLMAYSTVGTPDYIA 538

Query: 383 LEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGR 442
            E+   + Y    D+WSLG I++E L+G+ PF   +  ETY  +  ++Q L+ P  D+  
Sbjct: 539 PEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFP--DDIH 596

Query: 443 YAFSDRTWDLIIRLIADPISRL---RSFEHVKKMKYFAEISFENLRNVSPPFIPQLDNET 499
            ++     DLI RL+    +RL      + +K   +F+ + +  +R V  P+IP+L + T
Sbjct: 597 ISYEAE--DLIRRLLTHSENRLGRHGGADEIKAHPFFSGVDWNTIRQVEAPYIPKLSSVT 654

Query: 500 DAGYF--DDFTSEADMAKYADVFKRQDKLSAM---VDDSDAVSKL--VGFTY 544
           D  +F  D+  +  D    A   ++++++      V  S+A   L  +G+TY
Sbjct: 655 DTRFFPTDELENVPDSPAMAQAARQREQMMTQQQGVPQSNAKEDLPFIGYTY 706

>Scas_654.12
          Length = 737

 Score =  203 bits (516), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 143/475 (30%), Positives = 228/475 (48%), Gaps = 51/475 (10%)

Query: 113 DYYCDMFDYVISRRERTRQVMKYLEQQRTQGIVGEELSKEWQAYLTKETGILRKRRLKPK 172
           ++Y     Y I R ER  ++   L    +     E  +++  +   KE+  LR RR +  
Sbjct: 259 NFYQSSVKYAIERNERRVELETELA---SHDWSEERRNRQLASLGKKESQFLRLRRTRLS 315

Query: 173 NKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTR 232
            +DF  +            L +K DT +I A             +  HV  ERD+L  + 
Sbjct: 316 LEDFHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSD 375

Query: 233 SEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQ 292
           S W+V L Y+FQD   LYL MEF+PGGD  T+LI  +       RFY++E   A++ +H+
Sbjct: 376 SPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHK 435

Query: 293 LGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEE------------- 339
           LG+ HRD+KP+N LID RGHIKL+DFGL+ G          K  L+E             
Sbjct: 436 LGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQEDEANTTGLSKPGQ 495

Query: 340 --------VKNLDFPKFEEK----------SMNDRREMYTNLRENDVNYASSTVGSPDYM 381
                     N D    E +          +M++R+++ T  R++    A STVG+PDY+
Sbjct: 496 PGNINNDGSSNADGSNKENRQSMMVDSINLTMSNRQQIQT-WRKSRRLMAYSTVGTPDYI 554

Query: 382 ALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNG 441
           A E+   + Y    D+WSLG I++E L+G+ PF   +  ETY  +  ++Q L+ P  D+ 
Sbjct: 555 APEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFP--DDI 612

Query: 442 RYAFSDRTWDLIIRLIADPISRL---RSFEHVKKMKYFAEISFENLRNVSPPFIPQLDNE 498
             ++     DLI RL+     RL      + +K   +F  + +  +R V  P+IP+L + 
Sbjct: 613 HISYEAE--DLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTIRQVEAPYIPKLSSI 670

Query: 499 TDAGYF--DDFTSEADMAKYADVFKRQDKL---SAMVDDSDAVSK----LVGFTY 544
           TD  +F  D+  +  D    A   K+++++      V+ ++  +K     +G+TY
Sbjct: 671 TDTRFFPTDELENVPDSPAMAQAAKQREQMMKQGGPVNGNNTPTKEDLPFIGYTY 725

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score =  155 bits (393), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/352 (28%), Positives = 163/352 (46%), Gaps = 54/352 (15%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DF+++              RK+DT++I A             E  H L ER +L      
Sbjct: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++V L ++FQ P  LYL + F+ GG+    L +        +RFYI+E+ CA+D+LH+L 
Sbjct: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 463 VIYRDLKPENILLDYQGHIALCDFGLCK-------------------------------- 490

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
                  N+++ND     +  G+P+Y+A E+L  + Y  TVD+W+LG +L+E + G  P+
Sbjct: 491 ------LNMKDND--KTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPY 542

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHVK 471
              +    Y      K++L++P        F     DL+I L++ DP  RL     + ++
Sbjct: 543 YDENVPVMY------KKILQQPLLFPD--GFDPAAKDLLIGLLSRDPSRRLGVNGTDEIR 594

Query: 472 KMKYFAEISFEN--LRNVSPPFIPQLDNETDAGYFD-DFTSEADMAKYADVF 520
              +F +IS++   L+   PP+ P + +E D   FD +FT E  +    D +
Sbjct: 595 NHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEY 646

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score =  155 bits (393), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 113/379 (29%), Positives = 170/379 (44%), Gaps = 72/379 (18%)

Query: 142 QGIVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREI 201
           QG+    L+ +++   +K  GI           DFE++T             RK+DT++I
Sbjct: 353 QGLGTINLTVDFKPSYSKPVGI----------DDFELLTVLGKGSYGKVMQVRKKDTQKI 402

Query: 202 CAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDY 261
            A             E  H L ER IL      ++V L + FQ P  LYL +  + GG+ 
Sbjct: 403 YALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGEL 462

Query: 262 RTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLA 321
              L          ARFY SE+  A+D+LH++   +RDLKPEN L+DS+GHI L DFGL 
Sbjct: 463 FHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLC 522

Query: 322 AGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYM 381
                                                   N+++N+    S+  G+P+Y+
Sbjct: 523 K--------------------------------------LNMKDNE--KTSTFCGTPEYL 542

Query: 382 ALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNG 441
           A EVL  K Y   VD+W+LG +L+E L G  P+   + +E Y      K++L+ P     
Sbjct: 543 APEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMY------KKILKSPLI--- 593

Query: 442 RYAFSDR----TWDLIIRLIA-DPISRL--RSFEHVKKMKYFAEISFENLRNVS--PPFI 492
              F D       DL+ RL+  DP  RL     + +K  K+F ++ ++++ N    PPF 
Sbjct: 594 ---FPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFR 650

Query: 493 PQLDNETDAGYFD-DFTSE 510
           P + N  D   FD +FT +
Sbjct: 651 PDVQNANDTSNFDNEFTKQ 669

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score =  151 bits (382), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 179/377 (47%), Gaps = 54/377 (14%)

Query: 165 RKRRLKPKN------------KDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXX 212
           R RRL+ K+            + FE I            L R++ T  + A         
Sbjct: 473 RSRRLRTKSFSNKFQDIMVGPQSFEKIRLLGQGDVGKVFLVREKKTNRVYALKVLSKDEM 532

Query: 213 XXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDY-RTLLI-NTRF 270
               +   VLTE++IL T+   ++V L ++FQ    LYL ME+  GG++ R L    T+ 
Sbjct: 533 IKRNKIKRVLTEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKC 592

Query: 271 LQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERI 330
           +    ARFY SE+  A++ LH LG+ +RDLKPEN L+   GHI L+DF L+        I
Sbjct: 593 ICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLS--------I 644

Query: 331 ESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN 390
           ++   ++  VK        + ++ D +      R N      S VG+ +Y+A EV+    
Sbjct: 645 QAKDSKVPVVKGS-----AQSTLVDTKICSDGFRTN------SFVGTEEYIAPEVIRGNG 693

Query: 391 YDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTW 450
           +   VD+W+LG +++E L G+TPF G +TNET+ N+   K  +  P  +      S    
Sbjct: 694 HTAAVDWWTLGILIYEMLFGFTPFKGDNTNETFTNI--LKNEVSFPNNN----EISRTCK 747

Query: 451 DLIIRLIADPISRLRSFE----HVKKMKYFAEISFENLRNVSPPFIPQLDNETDAGYFDD 506
           DLI +L+    S+    +     VKK  +F ++ +  LRN  PP IP L   ++ GY   
Sbjct: 748 DLIKKLLTKNESKRLGCKMGAADVKKHPFFKKVQWSLLRNQEPPLIPVL---SEDGY--- 801

Query: 507 FTSEADMAKYADVFKRQ 523
                D AK +   KRQ
Sbjct: 802 -----DFAKLSSNKKRQ 813

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score =  150 bits (378), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/306 (31%), Positives = 151/306 (49%), Gaps = 23/306 (7%)

Query: 192 LARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYL 251
           L R++ T  + A             +   +LTE++IL T+   ++V L ++FQ    LYL
Sbjct: 395 LVREKQTNRLYALKIFSKPEMIKRKKIKRILTEQEILATSNHPFIVTLYHSFQTEDYLYL 454

Query: 252 AMEFVPGGDY-RTLLI-NTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDS 309
            ME+  GG++ R L    T+ +    ARFY SE+  A++ LH +G+ +RDLKPEN L+  
Sbjct: 455 CMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLMGFIYRDLKPENILLHQ 514

Query: 310 RGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVN 369
            GHI L+DF L+             ++ ++ KN         S+ D +      R N   
Sbjct: 515 SGHIMLSDFDLS-------------VQAKDTKNPQVKGNASHSLVDTKICSDGFRTN--- 558

Query: 370 YASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCW 429
              S VG+ +Y+A EV+    +   VD+W+LG +++E L G+TPF G +TN+T+ N+   
Sbjct: 559 ---SFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKN 615

Query: 430 KQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEISFENLRNVSP 489
           + V+  P  +    A  D    L+I+     +        +KK  +F    +  LRN  P
Sbjct: 616 EVVI--PNNNETSRACKDLIRKLLIKNENKRLGSKLGASDIKKHPFFKNDQWSLLRNQEP 673

Query: 490 PFIPQL 495
           P IP L
Sbjct: 674 PLIPVL 679

>Scas_651.18
          Length = 371

 Score =  144 bits (363), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 103/354 (29%), Positives = 161/354 (45%), Gaps = 59/354 (16%)

Query: 165 RKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTE 224
           RK   K    DF+++            L R        A             +  H   E
Sbjct: 48  RKTSGKYTLNDFQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDE 107

Query: 225 RDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMF 284
           R +L+     +LV++   FQD   +++ M+++ GG+  +LL  ++    P A+FY +E+ 
Sbjct: 108 RLMLSVVSHPFLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVC 167

Query: 285 CAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLD 344
            A++ LH +   +RDLKPEN L+D  GHIK+TDFG A                       
Sbjct: 168 LALEYLHSMDIIYRDLKPENILLDKNGHIKITDFGFAKYV-------------------- 207

Query: 345 FPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCIL 404
                                 D+ Y  +  G+PDY+A EV+  K Y+ +VD+WS G ++
Sbjct: 208 ---------------------PDITY--TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILI 244

Query: 405 FESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPIS-R 463
           +E L GYTPF  S+T +TYEN+   K  L+ P        F D   DL+ +LI   ++ R
Sbjct: 245 YEMLAGYTPFYDSNTMKTYENILNCK--LKFPNF------FHDDVKDLLSKLITKNLTER 296

Query: 464 LRSF----EHVKKMKYFAEISFENL--RNVSPPFIPQL-DNETDAGYFDDFTSE 510
           L +     E VK+  +F+E+ +E L  RN+  P+ P +   + D   FD +  E
Sbjct: 297 LGNLQNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQGDTSQFDRYPEE 350

>Kwal_23.6458
          Length = 868

 Score =  149 bits (377), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 112/376 (29%), Positives = 177/376 (47%), Gaps = 48/376 (12%)

Query: 165 RKRRLKPKN------------KDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXX 212
           R RRL+ K+            + FE I            L +++ T  + A         
Sbjct: 441 RSRRLRNKSFSSKFKEVIVGPQSFEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEM 500

Query: 213 XXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDY-RTLLI-NTRF 270
               +   +L E++IL T+   ++V L ++FQ    LYL ME+  GG++ R L    T+ 
Sbjct: 501 IKRKKIKRILAEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKC 560

Query: 271 LQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERI 330
           +    ARFY SE+  A++ LH +G+ +RDLKPEN L+   GHI L+DF L+         
Sbjct: 561 IDEDDARFYSSEVVAAIEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLS--------- 611

Query: 331 ESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN 390
               ++ ++ KN       + S+ D +      R N      S VG+ +Y+A EV+    
Sbjct: 612 ----VQAKDTKNPVVKGSAQSSLLDTKICSDGFRTN------SFVGTEEYIAPEVIRGNG 661

Query: 391 YDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTW 450
           +   VD+W+LG +++E L G+TP+ G +TN+T+ N      VL+           S    
Sbjct: 662 HTAAVDWWTLGILIYEMLFGFTPYKGDNTNKTFSN------VLKNEVSFPNNNEVSRNCK 715

Query: 451 DLIIR-LIADPISRLRS---FEHVKKMKYFAEISFENLRNVSPPFIPQLDNETDAGYFDD 506
           DLI + LI     RL S      +KK  +F ++ +  LRN  PP IP L   T+ GY  D
Sbjct: 716 DLIRKLLIKSETRRLGSKFGASDIKKHPFFKKVQWSLLRNQEPPLIPVL---TENGY--D 770

Query: 507 FTSEADMAKYADVFKR 522
           FT  ++     ++ K+
Sbjct: 771 FTRLSNNVNKGNIRKQ 786

>Scas_689.25*
          Length = 409

 Score =  144 bits (364), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 98/302 (32%), Positives = 149/302 (49%), Gaps = 59/302 (19%)

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHA 276
           +  H   ER +L+ +   ++V+L   FQD   L++ M++V GG+  +LL  ++    P A
Sbjct: 140 QVEHTNDERRMLSVSVHAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVA 199

Query: 277 RFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIR 336
           +FY +E+  A+D LH L   +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 200 KFYAAEVCLALDYLHSLDIIYRDLKPENLLLDRNGHIKVTDFGFAKYVP----------- 248

Query: 337 LEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVD 396
                                         DV Y  +  G+PDY+A EV+ AK Y+ +VD
Sbjct: 249 ------------------------------DVTY--TLCGTPDYIAPEVISAKPYNKSVD 276

Query: 397 YWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRL 456
           +WS G +++E L G+TPF  SST +TYEN+      L+ P+       F+    DL+ RL
Sbjct: 277 WWSFGILIYEMLSGHTPFYDSSTMKTYENI--LNAPLKFPKY------FTPDAQDLLSRL 328

Query: 457 IA-DPISRLRSF----EHVKKMKYFAEISFENL--RNVSPPFIPQL-DNETDAGYFDDFT 508
           I  D   RL +     E +K   +F+E+ ++ L  R +  P+ P +   + D   FD + 
Sbjct: 329 ITRDLTERLGNLQNGTEDIKNHAWFSEVIWDKLLDRCIETPYEPPIQQGQGDTSQFDRYP 388

Query: 509 SE 510
            E
Sbjct: 389 EE 390

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score =  148 bits (374), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 105/351 (29%), Positives = 168/351 (47%), Gaps = 46/351 (13%)

Query: 165 RKRRLKPKN------------KDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXX 212
           R RRL+ K+            + FE I            L R+RDT +I A         
Sbjct: 301 RSRRLRTKSFGNKFQDITVEPQSFEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEM 360

Query: 213 XXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDY-RTLLI-NTRF 270
               +   VLTE++IL T+   ++V L ++FQ    LYL ME+  GG++ R L    ++ 
Sbjct: 361 IKRKKIKRVLTEQEILATSDHPFIVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKC 420

Query: 271 LQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERI 330
           +    A+FY SE+  A++ LH LG+ +RDLKPEN L+   GH+ L+DF L+      ++ 
Sbjct: 421 IAEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKK- 479

Query: 331 ESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN 390
                          P  ++ +  D +      R N      S VG+ +Y+A EV+    
Sbjct: 480 ---------------PTMKDSTYLDTKICSDGFRTN------SFVGTEEYLAPEVIRGNG 518

Query: 391 YDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTW 450
           +   VD+W+LG +++E L G TPF G ++NET+ N+    + ++ P         S    
Sbjct: 519 HTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNI--LTKDVKFPH----DKEVSKNCK 572

Query: 451 DLIIRLI-ADPISRLRS---FEHVKKMKYFAEISFENLRNVSPPFIPQLDN 497
           DLI +L+  +   RL S      +K+  +F ++ +  LRN  PP IP L++
Sbjct: 573 DLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWSFLRNQDPPLIPALND 623

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score =  149 bits (375), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 154/290 (53%), Gaps = 28/290 (9%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDY-RTLLI-NTRFLQAPHARF 278
           +L E++IL T+   ++V L ++FQ    LYL ME+  GG++ R L    ++ +    A+F
Sbjct: 542 ILAEQEILATSNHPFVVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKF 601

Query: 279 YISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLE 338
           Y SE+  A++ LH LG+ +RDLKPEN L+   GHI L+DF L+        I++   ++ 
Sbjct: 602 YASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLS--------IQAKDAKVP 653

Query: 339 EVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYW 398
            VK        + ++ D +      R N      S VG+ +Y+A EV+    +   VD+W
Sbjct: 654 VVKG-----NAQSTVVDTKICSDGFRTN------SFVGTEEYIAPEVIRGNGHTAAVDWW 702

Query: 399 SLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA 458
           +LG +++E L G+TPF G +TNET+ N+   K+ +  P  +       D    L+I+  +
Sbjct: 703 TLGILIYEMLFGFTPFKGENTNETFSNI--LKKDVTFPNNNEVSRNCKDLIKKLLIKNES 760

Query: 459 DPISRLRSFEHVKKMKYFAEISFENLRNVSPPFIPQLDNETDAGYFDDFT 508
             +        +KK  +F ++++  LRN  PP IP L   T+ GY  DFT
Sbjct: 761 KRLGSKMGAADIKKHPFFKKVNWTLLRNQEPPLIPVL---TENGY--DFT 805

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score =  144 bits (364), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 100/344 (29%), Positives = 156/344 (45%), Gaps = 59/344 (17%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DF+++            L R        A             +  H   ER++L+     
Sbjct: 144 DFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSHP 203

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           +++++   FQD   L++ M+++ GG+  +LL  ++    P A+FY +E+  A++ LH  G
Sbjct: 204 FIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKG 263

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             +RDLKPEN L+D  GHIKLTDFG A                                 
Sbjct: 264 IIYRDLKPENILLDKNGHIKLTDFGFAKYVP----------------------------- 294

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
                       DV Y  +  G+PDY+A EV+  K Y+ +VD+WS G +++E L GYTPF
Sbjct: 295 ------------DVTY--TLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPF 340

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPIS-RLRSF----EH 469
             S+T +TYEN+      +R P        F     DLI +LI   +S RL +     E 
Sbjct: 341 YDSNTIKTYENI--LNAPVRFPPF------FHSDAQDLISKLITRDLSQRLGNLQNGSED 392

Query: 470 VKKMKYFAEISFENL--RNVSPPFIPQLD-NETDAGYFDDFTSE 510
           VK   +F+E+ +E L  +N+  P+ P +   + D   +D +  E
Sbjct: 393 VKNHPWFSEVVWEKLLCKNIETPYEPPIQAGQGDTSQYDRYPEE 436

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 104/378 (27%), Positives = 168/378 (44%), Gaps = 68/378 (17%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DF+++              RK+DT+++ A             E  H L ER +L      
Sbjct: 346 DFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCP 405

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++V L ++FQ P  LY  + F+ GG+    L          ARFY +E+ CA+D LH+L 
Sbjct: 406 FIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLD 465

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 466 VVYRDLKPENILLDYQGHIALCDFGLCK-------------------------------- 493

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
                  N++++D     +  G+P+Y+A E+L    Y   VD+W+LG +L+E L G  P+
Sbjct: 494 ------LNMKDDD--KTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPY 545

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHVK 471
                 + Y      K++L+ P        F     DL+I L++ DP  RL     + ++
Sbjct: 546 YDEDVPKMY------KKILQEPLVFPD--GFDRDAKDLLIGLLSRDPTRRLGYNGADEIR 597

Query: 472 KMKYFAEISFENL--RNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAM 529
              +F+++S++ L  +   PP+ P + N  D   FD            + F R+  + ++
Sbjct: 598 NHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFD------------EEFTREKPIDSV 645

Query: 530 VDD--SDAVSK-LVGFTY 544
           VD+  S++V K   G+TY
Sbjct: 646 VDEYLSESVQKQFGGWTY 663

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score =  147 bits (372), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/298 (31%), Positives = 155/298 (52%), Gaps = 27/298 (9%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDY-RTLLI-NTRFLQAPHARF 278
           +L E++IL T+   ++V L ++FQ    LYL ME+  GG++ R L    T+ +    ARF
Sbjct: 506 ILAEQEILATSNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARF 565

Query: 279 YISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLE 338
           Y SE+  A++ LH +G+ +RDLKPEN L+   GH+ L+DF L+        +++   R  
Sbjct: 566 YASEVTAALEYLHLMGFIYRDLKPENILLHQSGHVMLSDFDLS--------VQAKGTRNP 617

Query: 339 EVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYW 398
           +VK        + S+ D +      R N      S VG+ +Y+A EV+    +  +VD+W
Sbjct: 618 QVKG-----NAQSSLVDTKVCSDGFRTN------SFVGTEEYIAPEVIRGNGHTASVDWW 666

Query: 399 SLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA 458
           +LG + +E L G+TPF G +TN+T+ N+   K  +  P  ++      D    L+++  +
Sbjct: 667 TLGILTYEMLFGFTPFKGDNTNQTFSNI--LKNDVYFPNNNDISRTCKDLIKKLLVKKES 724

Query: 459 DPISRLRSFEHVKKMKYFAEISFENLRNVSPPFIPQLDNETDAGY-FDDFTSEADMAK 515
             +        +KK  +F  + +  LRN  PP IP L   T+ GY F   + + D+ K
Sbjct: 725 KRLGSKFGASEIKKHPFFKTVQWALLRNQEPPLIPVL---TEDGYDFAKLSHKKDVKK 779

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score =  142 bits (358), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 103/362 (28%), Positives = 162/362 (44%), Gaps = 65/362 (17%)

Query: 174 KDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRS 233
           K+F+++            L R R      A             +  H   ER +L+    
Sbjct: 85  KNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTH 144

Query: 234 EWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQL 293
            +++++   FQD   +++ M+++ GG+  +LL  ++    P A+FY +E+  A++ LH  
Sbjct: 145 PFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSK 204

Query: 294 GYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSM 353
              +RDLKPEN L+D  GHIK+TDFG A                                
Sbjct: 205 DIIYRDLKPENILLDKNGHIKITDFGFAKYV----------------------------- 235

Query: 354 NDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTP 413
                        DV Y  +  G+PDY+A EV+  K Y+ ++D+WS G +++E L GYTP
Sbjct: 236 ------------PDVTY--TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTP 281

Query: 414 FSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPIS-RLRSF----E 468
           F  S+T +TYE  +     LR P        F++   DL+ RLI   +S RL +     E
Sbjct: 282 FYDSNTMKTYE--KILNAELRFPPF------FNEDVKDLLSRLITRDLSQRLGNLQNGTE 333

Query: 469 HVKKMKYFAEISFENL--RNVSPPFIPQL-DNETDAGYFDDFTSE------ADMAKYADV 519
            VK   +F E+ +E L  RN+  P+ P +   + D   FD +  E           YAD+
Sbjct: 334 DVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEEDINYGVQGEDPYADL 393

Query: 520 FK 521
           F+
Sbjct: 394 FR 395

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score =  147 bits (370), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 98/343 (28%), Positives = 155/343 (45%), Gaps = 56/343 (16%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DF+++              +K+DT +I A             E  H L ER +L    + 
Sbjct: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++V L ++FQ P  LYL + F+ GG+    L          ARFY +E+ CA++ LH L 
Sbjct: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 508 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 534

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
                   L   D +  ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 535 -------KLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 587

Query: 415 SGSSTNETYENLRCWKQVLRRP-RCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHV 470
                 + Y      K++L+ P R  +G   F     +L+I L+  DP  RL     + +
Sbjct: 588 YDEDVPKMY------KKILQEPLRFPDG---FDREAKNLLIELLCRDPKRRLGYNGADEI 638

Query: 471 KKMKYFAEISFENL--RNVSPPFIPQLDNETDAGYFD-DFTSE 510
           K+  +F+++S++ L  +   PP+ P + +  D   FD +FT E
Sbjct: 639 KRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTRE 681

>Scas_717.69
          Length = 674

 Score =  145 bits (367), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 100/350 (28%), Positives = 151/350 (43%), Gaps = 54/350 (15%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DF+++              RKRDT++I A             E  H L ER +L      
Sbjct: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++V L ++FQ P  LYL +  + GG+    L      +   ARFY +E+ CA++ LH L 
Sbjct: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 464 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 490

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
                   L   D +   +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 491 -------KLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPY 543

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHVK 471
                 + Y   +  +  LR P        F     DL+I L++ DP  RL       +K
Sbjct: 544 YDEDVPKMYR--KILQDPLRFPE------GFDRDAKDLLIGLLSRDPDRRLGCNGAHEIK 595

Query: 472 KMKYFAEISFENLRNVS--PPFIPQLDNETDAGYFD-DFTSEADMAKYAD 518
              +F+++S++ L N    PP+ P + +  D   FD +FT E  +    D
Sbjct: 596 NHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVD 645

>Scas_720.103
          Length = 804

 Score =  146 bits (369), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 149/284 (52%), Gaps = 25/284 (8%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDY-RTLLI-NTRFLQAPHARF 278
           V+TE++IL T+   ++V L ++FQ    LYL ME+  GG++ R L   +++ +    ARF
Sbjct: 450 VITEQEILATSNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRDSKCICEDDARF 509

Query: 279 YISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLE 338
           Y SE+  A++ LH LG+ +RDLKPEN L+   GHI L+DF L+      +    MK  + 
Sbjct: 510 YASEVLAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSVHAKDSKNPIFMKDGI- 568

Query: 339 EVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYW 398
                  P      + D +      R N      S VG+ +Y+A EV+    +   VD+W
Sbjct: 569 ------LPTTNSNLIVDTKICSEGFRTN------SFVGTEEYIAPEVIRGNGHTVAVDWW 616

Query: 399 SLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA 458
           +LG ++FE L G TPF G +TNET+ N+    +    P  ++     +    +LI +L+ 
Sbjct: 617 TLGILIFEMLFGKTPFKGDTTNETFANI--LSKDFEFPNSND----ITRNCKNLIKKLLT 670

Query: 459 -DPISRLRS---FEHVKKMKYFAEISFENLRNVSPPFIPQLDNE 498
            +   RL S      +KK  +F  +++  LRN  PP IP+L ++
Sbjct: 671 KNETKRLGSKMGAAEIKKHSFFKNVNWNMLRNEEPPLIPELSSD 714

>Scas_721.124
          Length = 684

 Score =  145 bits (366), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 100/353 (28%), Positives = 159/353 (45%), Gaps = 56/353 (15%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DF+++              RK+DT++I A             E  H L ER +L      
Sbjct: 350 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTVLARIDCP 409

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++V L ++FQ P  LYL +  + GG+    L          +RFY +E+ CA++ LH L 
Sbjct: 410 FIVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSRSRFYAAELLCALETLHNLN 469

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 470 VIYRDLKPENILLDYQGHIALCDFGLCK-------------------------------- 497

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
                  N++++D     +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 498 ------LNMKDDD--KTDTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 549

Query: 415 SGSSTNETYENLRCWKQVLRRP-RCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHV 470
                 + Y      K++L+ P R  +G   F     DL+I L++ DP  RL     + +
Sbjct: 550 YDEDVPKMY------KKILQDPLRFPDG---FDRDAKDLLIGLLSRDPTRRLGCNGADEI 600

Query: 471 KKMKYFAEISFENL--RNVSPPFIPQLDNETDAGYFD-DFTSEADMAKYADVF 520
           K   +F+++S++ L  +   PP+ P + +  D   FD +FT E  +    D F
Sbjct: 601 KNHPFFSQLSWKRLLMKGYIPPYKPPVTSAIDTSNFDQEFTREKPVDSVVDEF 653

>Kwal_26.7635
          Length = 691

 Score =  145 bits (366), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 99/343 (28%), Positives = 155/343 (45%), Gaps = 56/343 (16%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DFE++              RK+DT ++ A             E  H L ER +L    + 
Sbjct: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++V L + FQ P  LY+ + F+ GG+    L          AR Y +E+ CA++ LH L 
Sbjct: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             +RDLKPEN L+D +GHI L DFGL                                +N
Sbjct: 477 VIYRDLKPENILLDHQGHIALCDFGLC------------------------------KLN 506

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
            + +  TN          +  G+P+Y+A E+L  + Y   VD+W+LG +L+E + G  P+
Sbjct: 507 MKGQDKTN----------TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPY 556

Query: 415 SGSSTNETYENLRCWKQVLRRP-RCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHV 470
                 + Y      K++L+ P R  +G   F     DL+I L++ DP  RL     + +
Sbjct: 557 YDEDVPKMY------KKILQEPLRFPDG---FDKDAKDLLIGLLSRDPKRRLGFNGADEI 607

Query: 471 KKMKYFAEISFENL--RNVSPPFIPQLDNETDAGYFD-DFTSE 510
           K   +F+++S++ L  +   PP+ P + N  D   FD +FT E
Sbjct: 608 KSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKE 650

>Scas_629.16
          Length = 918

 Score =  145 bits (367), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 102/328 (31%), Positives = 160/328 (48%), Gaps = 31/328 (9%)

Query: 174 KDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRS 233
           + FE I            L R++ T  + A             +   +L E++IL T+  
Sbjct: 517 QSFEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNH 576

Query: 234 EWLVKLLYAFQDPSSLYLAMEFVPGGDY-RTLLIN-TRFLQAPHARFYISEMFCAVDALH 291
            ++V L ++FQ    LY  ME+  GG++ R L    T+ +    ARFY SE+  A++ LH
Sbjct: 577 PFVVTLYHSFQSEDYLYFCMEYCMGGEFFRALQTRRTKCISEDDARFYASEVTAALEYLH 636

Query: 292 QLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEK 351
            LG+ +RDLKPEN L+   GHI L+DF L+             ++ ++ K        E 
Sbjct: 637 LLGFIYRDLKPENILLHKSGHIMLSDFDLS-------------VQAKDAKVPVMKGSAES 683

Query: 352 SMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGY 411
           ++ D +      R N      S VG+ +Y+A EV+    +   VD+W+LG +++E L G+
Sbjct: 684 TVVDTKICSDGFRTN------SFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGF 737

Query: 412 TPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-DPISRLRS---F 467
           TPF GSS+NET+ N+   K  +  P  ++     S    DLI +L+  +   RL S    
Sbjct: 738 TPFKGSSSNETFSNI--LKNDVSFPNNND----ISRNCKDLIKKLLCKNEAKRLGSKMGA 791

Query: 468 EHVKKMKYFAEISFENLRNVSPPFIPQL 495
             VK+  +F ++ +  LRN  PP IP L
Sbjct: 792 ADVKRHPFFKKVQWSFLRNQEPPLIPIL 819

>Kwal_33.13846
          Length = 375

 Score =  140 bits (352), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 109/408 (26%), Positives = 182/408 (44%), Gaps = 79/408 (19%)

Query: 128 RTRQVMKYLEQQRTQGIVGEELSKEWQAYLTKETGILRKRRLKPKN-------------- 173
           ++ Q M+   Q+  +G++G + + E Q   T+++  L ++ ++ K+              
Sbjct: 3   QSEQQMRETLQELPRGVLGSDSTAETQ---TRQSNSLGQQAVEAKHVQSAALHSRQTSGK 59

Query: 174 ---KDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTT 230
               DF ++            L R        A             +  H   ER +L+ 
Sbjct: 60  YTLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSV 119

Query: 231 TRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDAL 290
               +++++   FQD   +++ M+++ GG+  +LL  ++    P A+FY +E+  A++ L
Sbjct: 120 VSHPFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYL 179

Query: 291 HQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEE 350
           H     +RDLKPEN L+D  GH+K+TDFG                         F KF  
Sbjct: 180 HAQDIIYRDLKPENVLLDKNGHVKITDFG-------------------------FAKFVP 214

Query: 351 KSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVG 410
                           DV Y  +  G+PDY+A EV+  K Y+ +VD+WS G ++FE L G
Sbjct: 215 ----------------DVTY--TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIFEMLAG 256

Query: 411 YTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPIS-RLRSF-- 467
           YTPF  S+T +TYEN+      L+ P        F     DL+ +LI   +S RL +   
Sbjct: 257 YTPFYDSNTMKTYENI--LNAELQFPPF------FHSDVQDLLSQLITRDLSKRLGNLKN 308

Query: 468 --EHVKKMKYFAEISFENL--RNVSPPFIPQLD-NETDAGYFDDFTSE 510
             E VK   +F+E+ +E L  RN+  P+ P +   + D   +D +  E
Sbjct: 309 GSEDVKNHAWFSEVVWEKLLCRNIETPYEPPVQAGQGDTSQYDRYPEE 356

>Kwal_47.16761
          Length = 744

 Score =  142 bits (357), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 108/382 (28%), Positives = 174/382 (45%), Gaps = 66/382 (17%)

Query: 174 KDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRS 233
           +DFE++              RK+DT+ I A             E  H + ER+IL  T S
Sbjct: 332 QDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTAS 391

Query: 234 E---WLVKLLYAFQDPSSLYLAMEFVPGGD-YRTLLINTRFLQAPHARFYISEMFCAVDA 289
           +   ++V L ++FQ P+ LYL  +F+ GG+ +  L    RF +   ARFYI+E+  A++ 
Sbjct: 392 KSCPFIVGLKFSFQTPADLYLVTDFMSGGELFWHLQKEGRFAED-RARFYIAELVLALEY 450

Query: 290 LHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFE 349
           LH+    +RDLKPEN L+D+ G+I L DFGL+                            
Sbjct: 451 LHENDIVYRDLKPENILLDANGNIALCDFGLS---------------------------- 482

Query: 350 EKSMNDRREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNYDFTVDYWSLGCILFESL 408
           +  + DR   +               G+ +Y+A E +L+   Y   VD+WSLG ++FE  
Sbjct: 483 KADLKDRTNTF--------------CGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMC 528

Query: 409 VGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-DPISRLRSF 467
            G++PF      + Y+ +   K  ++ PR        S      +  L+  +P  RL + 
Sbjct: 529 CGWSPFFAEDNQKMYQKIAFGK--VKFPRD-----VLSPEGRSFVKGLLNRNPRHRLGAI 581

Query: 468 EHVKKMK---YFAEISFENLRN--VSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKR 522
           +  ++++   +FAEI +E LR   + PPF P L  ETD   FD      +  + +  F  
Sbjct: 582 DDGRELRAHPFFAEIDWEALRQKKIPPPFKPHLTGETDTSNFD-----PEFTQTSTSFMN 636

Query: 523 QDKLSAMVDDSDAVSKLVGFTY 544
           +  ++A        +K VGFT+
Sbjct: 637 KQGIAATPLSPAMQAKFVGFTF 658

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 97/350 (27%), Positives = 154/350 (44%), Gaps = 54/350 (15%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DF+++              RK+DT++I A             E  H L ER +L      
Sbjct: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++V L ++FQ    LYL +  + GG+    L          +RFY +E+ CA+D LH++ 
Sbjct: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 489 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 515

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
                   L   D +   +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 516 -------KLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 568

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHVK 471
              +  + Y      K++L+ P        F     DL+I L++ DP  RL     + +K
Sbjct: 569 YDENVPKMY------KKILQDPLVFPD--GFDRDAKDLLIGLLSRDPQRRLGYNGADEIK 620

Query: 472 KMKYFAEISFENL--RNVSPPFIPQLDNETDAGYFD-DFTSEADMAKYAD 518
              +F+++S++ L  +   PP+ P + + TD   FD +FT E  +    D
Sbjct: 621 NHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVD 670

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score =  135 bits (339), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 164/365 (44%), Gaps = 63/365 (17%)

Query: 158 TKETGILRKRRLKPKNK----DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXX 213
           ++++ +L +R    K K    DF ++            L R        A          
Sbjct: 29  SQQSTLLAQRSTVSKGKYSLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVV 88

Query: 214 XXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQA 273
              +  H   ER +L      +L+++   FQD  +L++ M+++ GG+  TLL  ++    
Sbjct: 89  KMKQIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPN 148

Query: 274 PHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESM 333
           P A+FY +E+  A++ LH     +RDLKPEN L+D  GHIK+TDFG A            
Sbjct: 149 PVAKFYAAEVTLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFA------------ 196

Query: 334 KIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDF 393
               +EV+ + +                           +  G+PDY+A EV+  K Y+ 
Sbjct: 197 ----KEVETVTW---------------------------TLCGTPDYIAPEVIATKPYNK 225

Query: 394 TVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLI 453
           +VD+WSLG +++E L GYTPF  ++  +TYE +   K V  +         F+    DL+
Sbjct: 226 SVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQ--------FFNSDVIDLL 277

Query: 454 IRLIADPISR-----LRSFEHVKKMKYFAEISFENL--RNVSPPFIPQLDNET-DAGYFD 505
            +L+   ++R      +  + +K   +FAE+ +E L  +++  P+ P +     D   FD
Sbjct: 278 SKLLTADLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFD 337

Query: 506 DFTSE 510
            +  E
Sbjct: 338 QYPEE 342

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score =  134 bits (338), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 89/302 (29%), Positives = 147/302 (48%), Gaps = 59/302 (19%)

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHA 276
           +  H   ER +L      +L+++   FQD  +L++ M+++ GG+  +LL  ++    P A
Sbjct: 77  QIEHTNDERRMLKVVEHPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVA 136

Query: 277 RFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIR 336
           +FY +E+  A++ LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 137 KFYAAEVTLALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--------------- 181

Query: 337 LEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVD 396
            +EV  + +                           +  G+PDY+A EV+  K Y+ ++D
Sbjct: 182 -KEVDTVTW---------------------------TLCGTPDYIAPEVITTKPYNKSID 213

Query: 397 YWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRL 456
           +WSLG ++FE L GYTPF   +  +TYE +   K V            F     DL+ +L
Sbjct: 214 WWSLGILIFEMLAGYTPFYDVTPIKTYEKILAGKVVFPP--------FFHPDAIDLLGKL 265

Query: 457 IADPISR----LRSF-EHVKKMKYFAEISFENL--RNVSPPFIPQLDNET-DAGYFDDFT 508
           I D ++R    L+S  + +K   +F+E+ +E L  +++  P+ P +     D+  FD + 
Sbjct: 266 ITDDLTRRLGNLQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQYP 325

Query: 509 SE 510
            E
Sbjct: 326 EE 327

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score =  139 bits (351), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 115/415 (27%), Positives = 184/415 (44%), Gaps = 78/415 (18%)

Query: 145 VGEELSKE----WQAYLTKETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTRE 200
           VGE +S E    W+ + T+      KR   P+  DFE++              RK+DT+ 
Sbjct: 277 VGESVSGEILVRWEYWHTE------KRHYGPQ--DFEVLRLLGKGTFGQVYQVRKKDTKR 328

Query: 201 ICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE---WLVKLLYAFQDPSSLYLAMEFVP 257
           I A             E  H + ER+IL  T S+   ++V L ++FQ P+ LYL  +F+ 
Sbjct: 329 IYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPTDLYLVTDFLS 388

Query: 258 GGD-YRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLT 316
           GG+ +  L    RF +   A+FYI+E+  A++ LH     +RDLKPEN L+D+ G+I L 
Sbjct: 389 GGELFWHLQKEGRFTEE-RAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALC 447

Query: 317 DFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVG 376
           DFGL+                            +  + DR   +               G
Sbjct: 448 DFGLS----------------------------KADLKDRTNTF--------------CG 465

Query: 377 SPDYMALE-VLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRR 435
           + +Y+A E +L+   Y   VD+WSLG ++FE   G++PF      + Y+ +   K  ++ 
Sbjct: 466 TTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGK--VKF 523

Query: 436 PRCDNGRYAFSDRTWDLIIRLIA-DPISRLRSFE---HVKKMKYFAEISFENLRN--VSP 489
           PR        S      +  L+  +P  RL +      V+   + ++I +E LRN  + P
Sbjct: 524 PRD-----VLSPEGRSFVKGLLNRNPKHRLGAVNDGAEVRAHPFLSDIDWEALRNKQIPP 578

Query: 490 PFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLVGFTY 544
           PF P L +ETD   FD      +  + +  F  +  ++A        +K  GFT+
Sbjct: 579 PFKPHLTSETDTSNFD-----PEFTQTSTSFMNKQPIAATPLSPAMQAKFAGFTF 628

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score =  139 bits (351), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 116/413 (28%), Positives = 187/413 (45%), Gaps = 76/413 (18%)

Query: 144 IVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICA 203
           I GE L K W   LTK      KR   P+  DFE++              +K+DT+ I A
Sbjct: 317 ITGEILVK-WHYTLTK------KRHYGPQ--DFEVLRLLGKGTFGQVYQVKKKDTKRIYA 367

Query: 204 XXXXXXXXXXXXXETNHVLTERDILTTTRSE---WLVKLLYAFQDPSSLYLAMEFVPGGD 260
                        E  H + ER+IL TT S+   ++V L ++FQ P+ LYL  +++ GG+
Sbjct: 368 MKVLSKKVIVKKNEIAHTIGERNILVTTSSKASPFIVGLKFSFQTPTDLYLVTDYMSGGE 427

Query: 261 -YRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFG 319
            +  L    RF +   A+FYI+E+  A++ LH     +RDLKPEN L+D+ G+I L DFG
Sbjct: 428 LFWHLQREGRFTED-RAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFG 486

Query: 320 LAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPD 379
           L+                            +  + DR   +               G+ +
Sbjct: 487 LS----------------------------KADLKDRTNTF--------------CGTTE 504

Query: 380 YMALE-VLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRC 438
           Y+A E +L+   Y   VD+WSLG ++FE   G++PF      + Y+ +   K  ++ PR 
Sbjct: 505 YLAPELLLDESGYTKMVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGK--VKFPRD 562

Query: 439 DNGRYAFSDRTWDLIIRLIA-DPISRLRSFEHVKKMK---YFAEISFENLRN--VSPPFI 492
                  S      +  L+  +P  RL + +  ++++   +FA+I +E L+   + PPF 
Sbjct: 563 -----ILSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWELLKQKKIPPPFK 617

Query: 493 PQLDNETDAGYFD-DFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLVGFTY 544
           P L +ETD   FD +FT  +          +  +++A        +K  GFT+
Sbjct: 618 PHLVSETDTSNFDPEFTQTS-----TSYMNKHHQMAATPLSPGMQAKFAGFTF 665

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score =  135 bits (340), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 97/344 (28%), Positives = 152/344 (44%), Gaps = 59/344 (17%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DF+++            L R        A             +  H   ER +L+     
Sbjct: 87  DFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHP 146

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           +++++   FQD   +++ M+++ GG+  +LL  ++    P A+FY +E+  A++ LH   
Sbjct: 147 FIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKD 206

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             +RDLKPEN L+D  GHIK+TDFG A                                 
Sbjct: 207 IIYRDLKPENILLDKNGHIKITDFGFAKYV------------------------------ 236

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
                       DV Y  +  G+PDY+A EV+  K Y+ +VD+WS G +++E L GYTPF
Sbjct: 237 -----------PDVTY--TLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPF 283

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPIS-RLRSF----EH 469
             S+T +TYEN+      L+ P        F     DL+ +LI   +S RL +     E 
Sbjct: 284 YNSNTMKTYENI--LNAELKFPPF------FHPDAQDLLKKLITRDLSERLGNLQNGSED 335

Query: 470 VKKMKYFAEISFENL--RNVSPPFIPQL-DNETDAGYFDDFTSE 510
           VK   +F E+ +E L  R +  P+ P +   + D   FD +  E
Sbjct: 336 VKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEE 379

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score =  134 bits (337), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 89/302 (29%), Positives = 145/302 (48%), Gaps = 59/302 (19%)

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHA 276
           +  H   ER +L      +L+++   FQD  +L++ M+++ GG+  +LL  ++    P A
Sbjct: 103 QIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVA 162

Query: 277 RFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIR 336
           +FY +E+  A++ LH     +RDLKPEN L+D  GHIK+TDFG A   +++         
Sbjct: 163 KFYAAEVTLALEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAKEVITV--------- 213

Query: 337 LEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVD 396
                                               +  G+PDY+A EV+  K Y+ +VD
Sbjct: 214 ----------------------------------TWTLCGTPDYIAPEVITTKPYNKSVD 239

Query: 397 YWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRL 456
           +WSLG ++FE L GYTPF   +  +TYE +    +V+  P        F     DL+ +L
Sbjct: 240 WWSLGILIFEMLAGYTPFYDVTPMKTYEKILA-GEVVYPP-------FFHPDVVDLLGKL 291

Query: 457 I-ADPISRLRSFEH----VKKMKYFAEISFENL--RNVSPPFIPQLD-NETDAGYFDDFT 508
           I AD   RL + +     +K   +FAE+ +E L  +++  P+ P +     D+  FD + 
Sbjct: 292 ITADLTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPIAVGVGDSSLFDQYP 351

Query: 509 SE 510
            E
Sbjct: 352 EE 353

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score =  139 bits (349), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/344 (28%), Positives = 149/344 (43%), Gaps = 58/344 (16%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DF+++              RKRDT +I A             E  H L ER +L    + 
Sbjct: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++V L ++FQ    LYL + F+ GG+    L          +RFY +E+ CA++ALH   
Sbjct: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 501 IIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 527

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
                   L   D    ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 528 -------KLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 580

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYA--FSDRTWDLIIRLIA-DPISRL--RSFEH 469
                 + Y      K++L+ P     R+   F     DL+I L+  DP  RL     + 
Sbjct: 581 YDEDVPKMY------KKILQDPL----RFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDE 630

Query: 470 VKKMKYFAEISFENL--RNVSPPFIPQLDNETDAGYFD-DFTSE 510
           +K   +F ++S++ L  +   PP+ P +    D   FD +FT E
Sbjct: 631 IKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTRE 674

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score =  139 bits (349), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 108/391 (27%), Positives = 179/391 (45%), Gaps = 66/391 (16%)

Query: 165 RKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTE 224
           +KR   P+  DFE++              +K+DT+ I A             E  H + E
Sbjct: 403 KKRHYGPQ--DFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGE 460

Query: 225 RDILTTTRSE---WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYIS 281
           R+IL TT S+   ++V L ++FQ P+ LYL  +++ GG+    L          A+FYI+
Sbjct: 461 RNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIA 520

Query: 282 EMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVK 341
           E+  A++ LH     +RDLKPEN L+D+ G+I L DFGL+                    
Sbjct: 521 ELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLS-------------------- 560

Query: 342 NLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNYDFTVDYWSL 400
                   +  + DR   +               G+ +Y+A E +L+   Y   VD+WSL
Sbjct: 561 --------KADLKDRTNTF--------------CGTTEYLAPELLLDETGYTKMVDFWSL 598

Query: 401 GCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-D 459
           G ++FE   G++PF   +  + Y+ +   K  ++ PR        S      +  L+  +
Sbjct: 599 GVLIFEMCCGWSPFFAENNQKMYQKIAFGK--VKFPRD-----VLSQEGRSFVKGLLNRN 651

Query: 460 PISRLRSFEHVKKMK---YFAEISFENLRN--VSPPFIPQLDNETDAGYFD-DFTSEADM 513
           P  RL + +  ++++   +FA+I +E L+   + PPF P L +ETD   FD +FT+    
Sbjct: 652 PKHRLGAIDDGRELRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTT---- 707

Query: 514 AKYADVFKRQDKLSAMVDDSDAVSKLVGFTY 544
           A  + + K Q  ++A        +K  GFT+
Sbjct: 708 ASTSYMNKHQPMMTATPLSPAMQAKFAGFTF 738

>Kwal_56.24059
          Length = 353

 Score =  133 bits (334), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/302 (30%), Positives = 147/302 (48%), Gaps = 59/302 (19%)

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHA 276
           +  H   ER +L      +L+++   FQD  +L++ M+++ GG+  +LL  ++    P A
Sbjct: 84  QIEHTNDERRMLKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVA 143

Query: 277 RFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIR 336
           +FY +E+  A++ LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 144 KFYAAEVILALEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFA--------------- 188

Query: 337 LEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVD 396
            +EV  + +                           +  G+PDY+A EV+  K Y+ +VD
Sbjct: 189 -KEVDTVTW---------------------------TLCGTPDYIAPEVIATKPYNKSVD 220

Query: 397 YWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRL 456
           +WSLG ++FE L GYTPF  ++  +TYE +   K V   P        F     DL+ +L
Sbjct: 221 WWSLGILIFEMLAGYTPFYDATPMKTYEKILQGK-VAYPP-------FFHPDVVDLLCKL 272

Query: 457 IADPISR----LRSF-EHVKKMKYFAEISFENL--RNVSPPFIPQLDNET-DAGYFDDFT 508
           I   ++R    L+S  + VK   +F+E+ +E L  +++  P+ P +     D   FD + 
Sbjct: 273 ITSDLTRRLGNLQSGPQDVKSHPWFSEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQYP 332

Query: 509 SE 510
            E
Sbjct: 333 EE 334

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score =  133 bits (335), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 98/362 (27%), Positives = 164/362 (45%), Gaps = 63/362 (17%)

Query: 161 TGILRKRRLKPKNK----DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXX 216
           T  L ++ L  K K    DF+++            L R        A             
Sbjct: 51  TSQLPQKSLVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMK 110

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHA 276
           +  H   ER +L      +L+++   FQD  ++++ M+++ GG+  +LL  ++    P A
Sbjct: 111 QVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVA 170

Query: 277 RFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIR 336
           +FY +E+  A++ LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 171 KFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--------------- 215

Query: 337 LEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVD 396
            +EV+ + +                           +  G+PDY+A EV+  K Y+ +VD
Sbjct: 216 -KEVQTVTW---------------------------TLCGTPDYIAPEVITTKPYNKSVD 247

Query: 397 YWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRL 456
           +WSLG +++E L GYTPF  ++  +TYE +   K V+  P        F     DL+ +L
Sbjct: 248 WWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGK-VVYPP-------YFHPDVVDLLSKL 299

Query: 457 I-ADPISRLRSFEH----VKKMKYFAEISFENL--RNVSPPFIPQLDNET-DAGYFDDFT 508
           I AD   R+ + +     +K   +F+E+ +E L  +++  P+ P + +   D   FD + 
Sbjct: 300 ITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYP 359

Query: 509 SE 510
            E
Sbjct: 360 EE 361

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score =  135 bits (339), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 99/361 (27%), Positives = 159/361 (44%), Gaps = 65/361 (18%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DF+++            L R        A             +  H   ER +L+     
Sbjct: 151 DFQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVSHP 210

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           +++++   FQD   +++ M+++ GG+  +LL  ++    P A+FY +E+  A++ LH   
Sbjct: 211 FIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKE 270

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             +RDLKPEN L+D  GHIK+TDFG A                                 
Sbjct: 271 IIYRDLKPENILLDKNGHIKITDFGFAKYVP----------------------------- 301

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
                       DV Y  +  G+PDY+A EV+  K Y+ +VD+WS G +++E L GYTPF
Sbjct: 302 ------------DVTY--TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPF 347

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPIS-RLRSF----EH 469
             ++T +TYE++      L+ P        F     DL+ +LI   +S RL +     E 
Sbjct: 348 YDANTMKTYEHI--LNSELKFPSF------FHPDVQDLLSKLITRDLSKRLGNLQNGSED 399

Query: 470 VKKMKYFAEISFENL--RNVSPPFIPQL-DNETDAGYFDDFTSE------ADMAKYADVF 520
           VK   +F+E+ +E L  R +  P+ P +   + D   FD +  E           YAD+F
Sbjct: 400 VKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEINYGVQGEDPYADLF 459

Query: 521 K 521
           +
Sbjct: 460 R 460

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score =  133 bits (334), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 103/378 (27%), Positives = 169/378 (44%), Gaps = 71/378 (18%)

Query: 149 LSKEWQAYLTKETG-ILRKRRLKPKNK-------DFEMITXXXXXXXXXXXLARKRDTRE 200
           +  EW     +E+G  LR R+L+ +         DF+++            L R      
Sbjct: 45  MRAEW----AQESGRQLRGRKLEGRTTKGKYTLYDFQILRTLGTGSFGRVHLVRSNHNGR 100

Query: 201 ICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGD 260
             A             +  H   ER +L+     +++++   FQD   +++ M+++ GG+
Sbjct: 101 FYAMKVLKKHVVVKLKQVEHTNDERKMLSVVSHPFIIRMWGTFQDAHQVFMIMDYIEGGE 160

Query: 261 YRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGL 320
             +LL  ++    P A+FY +E+  A++ LH     +RDLKPEN L+D  GHIKLTDFG 
Sbjct: 161 LFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKLTDFGF 220

Query: 321 AAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDY 380
           A                                             DV Y  +  G+PDY
Sbjct: 221 AKYV-----------------------------------------PDVTY--TLCGTPDY 237

Query: 381 MALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDN 440
           +A EV+  K Y+ +VD+WS G +++E L GYTPF   +T  TYEN+    +V   P    
Sbjct: 238 IAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENILN-AEVKFPP---- 292

Query: 441 GRYAFSDRTWDLIIRLIADPIS-RLRSFEH----VKKMKYFAEISFENL--RNVSPPFIP 493
               F+ +  DL+ +LI   +S RL + ++    VK   +F+E+ ++ L  RN+  P+ P
Sbjct: 293 ---FFNAKVRDLLSQLITRDLSKRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNIETPYEP 349

Query: 494 QLD-NETDAGYFDDFTSE 510
            +   + D   +D +  E
Sbjct: 350 PIHAGQGDTSQYDRYPEE 367

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score =  136 bits (343), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 108/391 (27%), Positives = 178/391 (45%), Gaps = 68/391 (17%)

Query: 165 RKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTE 224
           +KR+  P+  DFE++              RK+DT  I A             E  H + E
Sbjct: 316 KKRQYGPQ--DFEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKKVIVKKNEIAHTIGE 373

Query: 225 RDILTTTRSE---WLVKLLYAFQDPSSLYLAMEFVPGGD-YRTLLINTRFLQAPHARFYI 280
           R+IL  T S+   ++V L ++FQ P+ LYL  +F+ GG+ +  L    RF +   A+FYI
Sbjct: 374 RNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTED-RAKFYI 432

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
           +E+  A++ LH     +RDLKPEN L+D+ G+I L DFGL+                   
Sbjct: 433 AELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLS------------------- 473

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVL-EAKNYDFTVDYWS 399
                    +  + DR   +               G+ +Y+A E+L +   Y   VD+WS
Sbjct: 474 ---------KADLKDRTNTF--------------CGTTEYLAPELLMDETGYTKMVDFWS 510

Query: 400 LGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA- 458
           LG ++FE   G++PF  S   + Y+ +   K  ++ PR        S      +  L+  
Sbjct: 511 LGVLIFEMCCGWSPFFASDNQKMYQKIAFGK--VKFPRD-----VLSPEGRSFVKGLLNR 563

Query: 459 DPISRLRSFEHVKKMK---YFAEISFENLRN--VSPPFIPQLDNETDAGYFDDFTSEADM 513
           +P  RL + +  ++++   +F +I +E +R   + PPF P L +ETD   FD      + 
Sbjct: 564 NPKHRLGAIDDGRELRAHPFFNDIDWEAVRQKKIPPPFKPHLISETDTSNFD-----PEF 618

Query: 514 AKYADVFKRQDKLSAMVDDSDAVSKLVGFTY 544
            + +  F  +  ++A        +K VGFT+
Sbjct: 619 TQTSTSFMNKQPIAATPLSPAMQAKFVGFTF 649

>Scas_703.5
          Length = 749

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 114/415 (27%), Positives = 185/415 (44%), Gaps = 76/415 (18%)

Query: 142 QGIVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREI 201
           + + G+ L K W+   TK      KR   P   DFE++              +K+DT+ I
Sbjct: 319 ENVTGDILIK-WEYSSTK------KRHYGPN--DFEVLRLLGKGTFGQVYQVKKKDTKRI 369

Query: 202 CAXXXXXXXXXXXXXETNHVLTERDILTTTR---SEWLVKLLYAFQDPSSLYLAMEFVPG 258
            A             E  H + ER+IL TT    S ++V L ++FQ P+ LYL  +F+ G
Sbjct: 370 YAMKVLSKKVIVKKNEVAHTIGERNILVTTATKASPFIVGLKFSFQTPTDLYLVTDFMSG 429

Query: 259 GD-YRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTD 317
           G+ +  L    RF +   A+FYI+E+  A++ LH     +RDLKPEN L+D+ G+I L D
Sbjct: 430 GELFWHLQKEGRFTEE-RAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCD 488

Query: 318 FGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGS 377
           FGL+                            +  + DR   +               G+
Sbjct: 489 FGLS----------------------------KADLKDRTNTF--------------CGT 506

Query: 378 PDYMALE-VLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRP 436
            +Y+A E +L+   Y   VD+WSLG ++FE   G++PF      + Y+ +   K  ++ P
Sbjct: 507 TEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGK--VKFP 564

Query: 437 RCDNGRYAFSDRTWDLIIRLIA-DPISRLRSFEHVKKMK---YFAEISFENLR--NVSPP 490
           R        S      +  L+  +P  RL + +  ++++   +FA+I ++ LR   + PP
Sbjct: 565 RD-----VLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWDALREKKIPPP 619

Query: 491 FIPQLDNETDAGYFD-DFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLVGFTY 544
           F P L +ETD   FD +FT  +          +   ++A        +K  GFT+
Sbjct: 620 FKPHLVSETDTSNFDPEFTQTS-----TSYMNKHQPIAATPLSPAMQAKFAGFTF 669

>Scas_690.13
          Length = 354

 Score =  129 bits (324), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 88/302 (29%), Positives = 143/302 (47%), Gaps = 59/302 (19%)

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHA 276
           +  H   ER +L      +L+++   FQD  +L++ M+++ GG+  +LL  ++    P A
Sbjct: 85  QIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVA 144

Query: 277 RFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIR 336
           +FY +E+   ++ LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 145 KFYAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--------------- 189

Query: 337 LEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVD 396
            +EV  + +                           +  G PDY+A EV+  K Y+ +VD
Sbjct: 190 -KEVDTVTW---------------------------TLCGPPDYIAPEVIATKPYNKSVD 221

Query: 397 YWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRL 456
           +WSLG ++FE L GYTPF  ++  +TYE +   K V            F     DL+ +L
Sbjct: 222 WWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVVYPT--------FFHPDVVDLLGKL 273

Query: 457 I-ADPISRLRSFEH----VKKMKYFAEISFENL--RNVSPPFIPQLDNET-DAGYFDDFT 508
           I AD   R+ + +     +K   +F+E+ +E L  +++  P+ P +     D   FD + 
Sbjct: 274 ITADLTRRIGNLQSGSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITTGIGDTSLFDQYP 333

Query: 509 SE 510
            E
Sbjct: 334 EE 335

>Scas_715.34
          Length = 1150

 Score =  129 bits (324), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 93/332 (28%), Positives = 150/332 (45%), Gaps = 66/332 (19%)

Query: 192  LARKRDTREICAXXXXXXXXXXXXXETNHVLTERDIL---TTTRSEWLVKLLYAFQDPSS 248
            L+R ++T  +CA             +      E+ +    T T+  +L  L  +FQ  + 
Sbjct: 839  LSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENR 898

Query: 249  LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
            +Y AMEF+ GGD    + N R L    A+FY +E+  A+   H  G  +RDLK EN L+ 
Sbjct: 899  IYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLT 957

Query: 309  SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
             +GHIK+ D+GL                                   + EM+ N      
Sbjct: 958  PQGHIKIADYGLC----------------------------------KDEMWYN------ 977

Query: 369  NYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRC 428
            N  S+  G+P++MA E+L+ + Y   VD+W+ G +L++ L+  +PFSG   +E +  +  
Sbjct: 978  NKTSTFCGTPEFMAPEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAI-- 1035

Query: 429  WKQVLRRPRCDNGRYAFSDRTWDLII----RLIADPISRL----RSFEHVKKMKYFAEIS 480
                      D   Y   D   D++      L  DP +RL    R    V +  +F  I+
Sbjct: 1036 --------LTDEPLYPI-DMAGDIVQIFQGLLTKDPENRLGAGQRDALEVMEEPFFRNIN 1086

Query: 481  FENLRN--VSPPFIPQLDNETDAGYFD-DFTS 509
            FE++ N  V PP++P++ +  D  YF+ +FTS
Sbjct: 1087 FEDILNLRVQPPYVPEIKSPEDTSYFEHEFTS 1118

>Kwal_56.22788
          Length = 515

 Score =  127 bits (318), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 103/197 (52%), Gaps = 25/197 (12%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
              ER IL+      +VKL Y+F D   LYL ++F+PGG+    L     L      FY 
Sbjct: 184 TFAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQGTLDEDTVAFYA 243

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
           +E+ CA+  LH+ G  +RDLKPEN L+D RGH+ LTDFGL+  + S +            
Sbjct: 244 AEISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDSA---------- 293

Query: 341 KNLDFPKFEEKSMNDRREMYTNLREND-VNYASSTVGSPDYMALEVLEAKNYDFTVDYWS 399
                         D  ++ TN  E + V    S +G+P+Y A E+LE K Y    D++S
Sbjct: 294 --------------DGGDVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYS 339

Query: 400 LGCILFESLVGYTPFSG 416
           LGC++F+ L+G  P++G
Sbjct: 340 LGCLIFDMLIGKPPYTG 356

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score =  127 bits (318), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 78/244 (31%), Positives = 118/244 (48%), Gaps = 33/244 (13%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
              ER IL+      +VKL Y+F D S LYL ++++PGG+    L     L+     FY 
Sbjct: 217 TFAERTILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHLKEHGTLEEDTVAFYA 276

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
           +E+ CA+  LH  G  +RDLKPEN L++  GH+ LTDFGL+  + S    E +    E  
Sbjct: 277 AEISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSASNASQEDLGAGNE-- 334

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSL 400
                                     DVN   S +G+P+Y A E+L  + Y    D++SL
Sbjct: 335 ------------------------GEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSL 370

Query: 401 GCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLI-AD 459
           GC+L++ L G  P++G++       ++  KQ  + P      Y  SD   D++  L+ +D
Sbjct: 371 GCLLYDMLTGKPPYTGANHKVIANKIKNDKQGPKIP------YYLSDGMKDVLGALLKSD 424

Query: 460 PISR 463
           P  R
Sbjct: 425 PKKR 428

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score =  125 bits (315), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/219 (34%), Positives = 110/219 (50%), Gaps = 36/219 (16%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
              ER IL+      +VKL Y+F D S LYL ++++PGG+    L     L      FY 
Sbjct: 199 TFAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGTLDETTVSFYA 258

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
           +E+ CA+  LH  G  +RDLKPEN L++ RGH+ LTDFGL+                   
Sbjct: 259 AEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLS------------------- 299

Query: 341 KNLDFPKFEEKSMNDRREMYTNLREND---VNYASSTVGSPDYMALEVLEAKNYDFTVDY 397
                    +KS ND     + + E D   VN   S +G+P+Y A E+L  K Y    D+
Sbjct: 300 ---------KKSAND-----SAVDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDW 345

Query: 398 WSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRP 436
           +SLGC+L++ LVG  P++GS+       ++  KQ  + P
Sbjct: 346 YSLGCLLYDMLVGKPPYTGSNHKVIINKIQQNKQGPKIP 384

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score =  124 bits (310), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 95/327 (29%), Positives = 146/327 (44%), Gaps = 42/327 (12%)

Query: 161 TGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNH 220
           TG L K  +K   KDF+              LA  RD+ +  A             +  +
Sbjct: 110 TGELTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKY 169

Query: 221 VLTERDILTTTR-SEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFY 279
           V  E+  L     ++ + KL + FQD +SLY  +E+ P GD+  L+     L    AR+Y
Sbjct: 170 VTVEKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYY 229

Query: 280 ISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEE 339
            S++  AVD+LH +G  HRD+KPEN L+D    +KLTDFG A            KI  EE
Sbjct: 230 ASQIIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTA------------KILPEE 277

Query: 340 VKNL--DFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDY 397
             N     P F         ++Y          + S VG+ +Y++ E+L     D   D 
Sbjct: 278 PSNTADGKPYF---------DLYAK--------SKSFVGTAEYVSPELLNDNYTDSRCDI 320

Query: 398 WSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLI 457
           W+ GCIL++ L G  PF  ++   T++ +   +              F     DL+ +L+
Sbjct: 321 WAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTA--------GFPQIVKDLVKKLL 372

Query: 458 A-DPISRLRSFEHVKKMKYFAEISFEN 483
             DP  RL + + +K   +F E++FE+
Sbjct: 373 VRDPNDRL-TIKQIKAHLFFHEVNFED 398

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score =  124 bits (311), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 90/332 (27%), Positives = 148/332 (44%), Gaps = 66/332 (19%)

Query: 192  LARKRDTREICAXXXXXXXXXXXXXETNHVLTERDIL---TTTRSEWLVKLLYAFQDPSS 248
            L++ ++T  +CA             +      E+ +    T T+  +L  L  +FQ  + 
Sbjct: 840  LSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENR 899

Query: 249  LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
            +Y AMEF+ GGD    + N R L    A+FY +E+  A+   H  G  +RDLK EN L+ 
Sbjct: 900  IYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLT 958

Query: 309  SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
              GHIK+ D+GL                                   + EM+        
Sbjct: 959  PEGHIKIADYGLC----------------------------------KDEMWYG------ 978

Query: 369  NYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRC 428
            N  S+  G+P++MA E+L+ + Y   VD+W+ G +L++ L+  +PFSG   +E +  +  
Sbjct: 979  NRTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAI-- 1036

Query: 429  WKQVLRRPRCDNGRYAFSDRTWDLII----RLIADPISRL----RSFEHVKKMKYFAEIS 480
                      D   Y   D   +++      L  DP  RL    R  + V +  +F  I+
Sbjct: 1037 --------LTDEPLYPI-DMAGEIVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNIN 1087

Query: 481  FENLRN--VSPPFIPQLDNETDAGYFD-DFTS 509
            F+++ N  V PP+IP++ +  D  YF+ +FTS
Sbjct: 1088 FDDILNLRVKPPYIPEIKSPEDTSYFEQEFTS 1119

>Scas_593.14d
          Length = 495

 Score =  121 bits (304), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 111/216 (51%), Gaps = 23/216 (10%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
              E+ IL       +VKL Y+F D S LYL ++++PGG+    L     L      FY 
Sbjct: 195 TFAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGTLDEDTVAFYA 254

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
           +E+ CA+  LH  G  +RDLKPEN L++ +GH+ LTDFGL+  +V+       ++     
Sbjct: 255 AEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVT---- 310

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSL 400
                      S+N+  E        D++   S +G+P+Y A E+L+   Y+   D++SL
Sbjct: 311 -----------SLNEPSE--------DLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSL 351

Query: 401 GCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRP 436
           GC++++ L G  P++G++       ++  KQ  + P
Sbjct: 352 GCLIYDMLSGKPPYTGANHKVILNKIQKDKQGPKIP 387

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score =  122 bits (306), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 107/215 (49%), Gaps = 30/215 (13%)

Query: 222 LTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYIS 281
             ER IL+      +VKL Y+F D   LYL ++++PGG+    L     L      FY +
Sbjct: 229 FAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTLDEGTVAFYAA 288

Query: 282 EMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVK 341
           E+ CA+  LH  G  +RDLKPEN L++ RGH+ LTDFGL+  +V                
Sbjct: 289 ELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSV---------------- 332

Query: 342 NLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLG 401
                 F++ +  +  E        +VN   S +G+P+Y A E+L  + Y    D++SLG
Sbjct: 333 ------FDDAATPEEGE--------NVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLG 378

Query: 402 CILFESLVGYTPFSGSSTNETYENLRCWKQVLRRP 436
           C++++ L+G  PF+G +       ++  K   R P
Sbjct: 379 CLVYDMLIGKPPFTGVNHKIILNKIKQEKTGARIP 413

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score =  122 bits (306), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 90/332 (27%), Positives = 146/332 (43%), Gaps = 66/332 (19%)

Query: 192  LARKRDTREICAXXXXXXXXXXXXXETNHVLTERDIL---TTTRSEWLVKLLYAFQDPSS 248
            L+R ++T  +CA             +      E+ +    T T+  +L  L  +FQ  + 
Sbjct: 833  LSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENR 892

Query: 249  LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
            +Y AMEF+ GGD    + N R L    A+FY +E+  A+   H  G  +RDLK EN L+ 
Sbjct: 893  IYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKFFHDNGVIYRDLKLENILLT 951

Query: 309  SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
              GHIK+ D+GL                                   +  M+        
Sbjct: 952  PEGHIKIADYGLC----------------------------------KDGMWYG------ 971

Query: 369  NYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRC 428
            N  S+  G+P++MA E+L  ++Y   VD+W+ G +L++ L+  +PFSG   +E +  +  
Sbjct: 972  NKTSTFCGTPEFMAPELLREQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAI-- 1029

Query: 429  WKQVLRRPRCDNGRYAFSDRTWDLII----RLIADPISRL----RSFEHVKKMKYFAEIS 480
                      D   Y   D   D++      L  DP  RL    R    + +  +F  I+
Sbjct: 1030 --------LTDEPLYPI-DMAGDIVQIFQGLLTKDPEKRLGAGPRDALEIMEEPFFRNIN 1080

Query: 481  FENLRN--VSPPFIPQLDNETDAGYFD-DFTS 509
            F++L N  + PP+IP++ +  D  YF+ +FTS
Sbjct: 1081 FDDLLNLRIKPPYIPEIKSAEDTSYFEQEFTS 1112

>Kwal_27.10581
          Length = 1154

 Score =  122 bits (306), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 101/394 (25%), Positives = 162/394 (41%), Gaps = 75/394 (19%)

Query: 135  YLEQQRTQGIVGEELSKEWQAYLTKETGILRKRRLKPKNK-----DFEMITXXXXXXXXX 189
            ++  Q++ G+  +      QA  T      R +R  PK +     DF ++          
Sbjct: 785  HVSPQKSTGVPTKSEQSSPQASHTS----TRHKRRTPKRRKISLDDFVLLKVLGKGNFGK 840

Query: 190  XXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDIL---TTTRSEWLVKLLYAFQDP 246
              LA  ++   +CA             +      E+ +    T  +  +L  L  +FQ  
Sbjct: 841  VLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKKVFLLATKAKHPFLTNLYCSFQTE 900

Query: 247  SSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFL 306
            + +Y AMEF+ GGD    + N R L    A+FY +E+  A+   H  G  +RDLK EN L
Sbjct: 901  NRIYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENIL 959

Query: 307  IDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLREN 366
            +   GHIK+ D+GL                                   + EM+      
Sbjct: 960  LTPEGHIKIADYGLC----------------------------------KDEMWYG---- 981

Query: 367  DVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENL 426
              N  S+  G+P++MA E+L+ + Y   VD+W+ G +L++ L+  +PFSG   +E +  +
Sbjct: 982  --NKTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAI 1039

Query: 427  RCWKQVLRRPRCDNGRYAFSDRTWDLII----RLIADPISRL----RSFEHVKKMKYFAE 478
                        D   Y   D   D++      L  DP  RL    R    V    +F  
Sbjct: 1040 ----------LTDEPLYPI-DMAGDIVQIFQGLLTKDPERRLGAGPRDAAEVMAEPFFRN 1088

Query: 479  ISFENLRN--VSPPFIPQLDNETDAGYFD-DFTS 509
            I F+++ N  V PP+IP++    D  YF+ +FTS
Sbjct: 1089 IVFDDILNLRVQPPYIPEIKAADDTSYFEKEFTS 1122

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score =  122 bits (305), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 97/364 (26%), Positives = 153/364 (42%), Gaps = 71/364 (19%)

Query: 165  RKRRLKPKNK-----DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETN 219
            R +R  PK +     DF ++            LAR ++T  +CA             +  
Sbjct: 806  RHKRKTPKRRKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIE 865

Query: 220  HVLTERDIL---TTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHA 276
                E+ +    T  +  +L  L  +FQ  + +Y AMEF+ GGD    + N R L    A
Sbjct: 866  SARAEKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQR-LSVRRA 924

Query: 277  RFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIR 336
            +FY +E+  A+   H  G  +RDLK EN L+   GHIK+ D+GL                
Sbjct: 925  KFYAAEVLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLC--------------- 969

Query: 337  LEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVD 396
                               + EM+        N  S+  G+P++MA E+L  + Y   VD
Sbjct: 970  -------------------KDEMWFG------NRTSTFCGTPEFMAPEILREQAYTKAVD 1004

Query: 397  YWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLII-- 454
            +W+ G +L++ L+  +PFSG   +E +  +            D   Y   D   D++   
Sbjct: 1005 WWAFGVLLYQMLLCQSPFSGDDEDEVFNAI----------LTDEPLYPI-DMAGDIVQIF 1053

Query: 455  --RLIADPISRL----RSFEHVKKMKYFAEISFENLRN--VSPPFIPQLDNETDAGYFD- 505
               L  DP  RL    R    V +  +F  I+F+++ N  V PP+IP +    D  YF+ 
Sbjct: 1054 QGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADDTSYFEK 1113

Query: 506  DFTS 509
            +FT+
Sbjct: 1114 EFTA 1117

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score =  121 bits (304), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 89/332 (26%), Positives = 145/332 (43%), Gaps = 66/332 (19%)

Query: 192  LARKRDTREICAXXXXXXXXXXXXXETNHVLTERDIL---TTTRSEWLVKLLYAFQDPSS 248
            LAR ++T  +CA             +      E+ +    T T+  +L  L  +FQ  + 
Sbjct: 850  LARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLLATETKHPFLTNLYCSFQTENR 909

Query: 249  LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
            +Y AMEF+ GGD    + N R L    A+FY +E+  ++   H  G  +RDLK EN L+ 
Sbjct: 910  IYFAMEFIGGGDLMWHVQNRR-LSVRRAKFYAAEVLLSLKYFHDNGVIYRDLKLENILLT 968

Query: 309  SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
              GHIK+ D+GL                                   +  M+        
Sbjct: 969  PEGHIKIADYGLC----------------------------------KDNMWYG------ 988

Query: 369  NYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRC 428
            N  S+  G+P++MA E+L+ + Y   VD+W+ G +L++ L+  +PFSG   +E +  +  
Sbjct: 989  NKTSTFCGTPEFMAPEILKGQAYTKAVDWWTFGVLLYQMLLCQSPFSGEDEDEVFNAI-- 1046

Query: 429  WKQVLRRPRCDNGRYAFSDRTWDLII----RLIADPISRL----RSFEHVKKMKYFAEIS 480
                      D   Y   D   D++      L  DP  RL    +    +    +F+ I+
Sbjct: 1047 --------LTDEPLYPI-DMAGDIVQIFQGLLTKDPEKRLGAGPKDALEIMAEPFFSNIN 1097

Query: 481  FENLRN--VSPPFIPQLDNETDAGYFD-DFTS 509
            F+++ N  V PPF+P++    D  YF+ +FTS
Sbjct: 1098 FDDILNLRVEPPFVPEIKAADDTSYFEKEFTS 1129

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score =  120 bits (301), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 169/365 (46%), Gaps = 50/365 (13%)

Query: 135 YLEQQRTQGIVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLAR 194
           ++E+ R +  V  E     Q  + KE+   +K  +K   KDF+  +           LA 
Sbjct: 140 HMEKNRNK--VKIEHDSSSQKPIAKESSKAQKNIIKKGIKDFKFGSVIGDGAYSTVMLAT 197

Query: 195 KRDTREICAXXXXXXXXXXXXXETNHVLTERDILTT-TRSEWLVKLLYAFQDPSSLYLAM 253
             DT++  A             +  +V  E+  L     S  +V+L   FQD SSLY  +
Sbjct: 198 SIDTKKRYAAKVLNKEYLIRQKKVKYVSIEKTALQKLNNSPSVVRLFSTFQDESSLYFLL 257

Query: 254 EFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHI 313
           E+ P GD+ +L+     L    AR+Y +++  A+D LH  G  HRD+KPEN L+D    I
Sbjct: 258 EYAPNGDFLSLMKKYGSLDETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKI 317

Query: 314 KLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASS 373
           KLTDFG A            K+      ++  P+++   ++ R + +             
Sbjct: 318 KLTDFGTA------------KLLNPTNNSVSKPEYD---LSTRSKSF------------- 349

Query: 374 TVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVL 433
            VG+ +Y++ E+L     D+  D W+ GCILF+ + G  PF   +TNE       +++V+
Sbjct: 350 -VGTAEYVSPELLNDSFTDYRCDIWAFGCILFQMIAGKPPF--KATNEYL----TFQKVM 402

Query: 434 RRPRCDNGRYAFSDR----TWDLIIRLIADPISRLRSFEHVKKMKYFAEISFEN--LRNV 487
           +       +YAF+        DL+ +++   + R  +   +K+  +F +++F++  + + 
Sbjct: 403 KV------QYAFTPGFPLIIRDLVKKILVKNLDRRLTISQIKEHHFFKDLNFKDGSVWSK 456

Query: 488 SPPFI 492
           +PP I
Sbjct: 457 TPPEI 461

>Kwal_56.22693
          Length = 984

 Score =  119 bits (299), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 152/334 (45%), Gaps = 53/334 (15%)

Query: 157 LTKETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXX 216
           L  ETG++ +  +K   KDF               LAR  D+ +  A             
Sbjct: 139 LNPETGVMARHVIKKGIKDFRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQK 198

Query: 217 ETNHVLTERDILTTTR-SEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPH 275
           +  +V  E++ L        ++KL + FQD +SLY  +E+ P GD+ +++     L    
Sbjct: 199 KVKYVNIEKNTLQRLNDGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGSLSQEC 258

Query: 276 ARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKI 335
           A +Y +++  A+D LH  G  HRD+KPEN L+D    +KLTDFG A       RI     
Sbjct: 259 AVYYSAQILDAIDYLHHKGIVHRDIKPENILLDKDMKVKLTDFGTA-------RI----- 306

Query: 336 RLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTV 395
            LE+               D      NL E     + S VG+ +Y++ E+L     D+  
Sbjct: 307 -LEK---------------DETTQTFNLLER----SKSFVGTAEYVSPELLNDNYVDYKC 346

Query: 396 DYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIR 455
           D W+ GCILF+ + G  PF   +TNE       +++V++       +YAF+   + L+IR
Sbjct: 347 DIWAFGCILFQMIAGKPPF--KATNEYL----TFQKVMKV------QYAFT-AGFPLVIR 393

Query: 456 ------LIADPISRLRSFEHVKKMKYFAEISFEN 483
                 L+  P  RL +   +KK  +F +++F +
Sbjct: 394 DLIKKILVKSPEQRLDA-SQIKKHHFFKDVNFND 426

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score =  114 bits (285), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/348 (27%), Positives = 158/348 (45%), Gaps = 53/348 (15%)

Query: 147 EELSKEWQAYLTKE-----TGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREI 201
           EE ++   A + KE     TG   K+ ++   KDF+              LA  +D+ + 
Sbjct: 148 EEWARRGAAQIVKESVNPKTGEREKKIIRKGIKDFKFGEMVGDGAYSTVMLATAKDSGKK 207

Query: 202 CAXXXXXXXXXXXXXETNHVLTERDILT-TTRSEWLVKLLYAFQDPSSLYLAMEFVPGGD 260
            A             +  +V  E++ L     S  +VKL + FQD SSLY  +E+ P GD
Sbjct: 208 YAVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFFTFQDESSLYFLLEYAPNGD 267

Query: 261 YRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGL 320
           + +++     L     R+Y +++   +  LH  G  HRD+KPEN L+D    +K+TDFG 
Sbjct: 268 FLSVMKKYGSLSEDCTRYYSAQIIDGIKYLHSKGIIHRDIKPENILLDKDMKVKITDFGT 327

Query: 321 AAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDY 380
           A            KI   + ++ D P+F                 N +  + S VG+ +Y
Sbjct: 328 A------------KILEPKNEDEDNPEF-----------------NLLTRSKSFVGTAEY 358

Query: 381 MALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDN 440
           ++ E+L     D   D W+ GC++F+ + G  PF   +TNE       +++V++      
Sbjct: 359 VSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPF--KATNEYL----TFQKVMKV----- 407

Query: 441 GRYAFSDR----TWDLIIR-LIADPISRLRSFEHVKKMKYFAEISFEN 483
            +YAF+        DL+ R L+  P  RL +   ++K  ++ +ISFE+
Sbjct: 408 -QYAFTAGFPVVVRDLVKRILLKVPEQRL-TIPQIEKHHFYKDISFED 453

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score =  113 bits (283), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 116/249 (46%), Gaps = 44/249 (17%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           ++KL Y F D  +LY  M+  PGG+   LL   R      AR Y+ ++   V+ +H +G 
Sbjct: 73  IIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVEYIHSMGV 132

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMND 355
            HRDLKPEN L+D  G + + DFG AA TV      S         + D P         
Sbjct: 133 IHRDLKPENVLLDKEGRLMIADFG-AAYTVGQSDAGS---------DGDKP--------- 173

Query: 356 RREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
                          A+S VG+ +Y++ E +LE K+Y ++ D W+LGC+L++ L G  PF
Sbjct: 174 ---------------ATSFVGTAEYVSPELLLENKSY-YSSDVWALGCMLYQFLQGTPPF 217

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMK 474
            G +  ET+E +       R P         S         L+ DP  R  + E +KK K
Sbjct: 218 RGQNEMETFEQIVNLDYTWRIPANPLAAGLVSK-------ILVLDPSQRY-TLEQIKKHK 269

Query: 475 YFAEISFEN 483
           +F+ + + N
Sbjct: 270 WFSGVDWNN 278

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score =  113 bits (282), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 92/342 (26%), Positives = 137/342 (40%), Gaps = 61/342 (17%)

Query: 195 KRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAME 254
           K D+ EI A                 +L+E  I  +     +V+ +  F+D S++Y+ +E
Sbjct: 100 KDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLE 159

Query: 255 FVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIK 314
             P G    LL   + L  P  RF+ +++  A+  +H     HRDLK  N   DS  ++K
Sbjct: 160 ICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLK 219

Query: 315 LTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASST 374
           + DFGLAA                               N+    YT             
Sbjct: 220 IGDFGLAAVLA----------------------------NESERKYT------------I 239

Query: 375 VGSPDYMALEVLEAKN--YDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQV 432
            G+P+Y+A EVL  K+  + F VD WSLG +L+  L+G  PF     N  YE ++C    
Sbjct: 240 CGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFS 299

Query: 433 LRR--PRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEISFENLRNVSPP 490
             R  P  D G+    D     I+ L  DPI R  S   +    +F        R   PP
Sbjct: 300 FPRDKPISDEGKILIRD-----ILSL--DPIER-PSLTEIMDYVWF--------RGTFPP 343

Query: 491 FIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDD 532
            IP     ++A  F+D   E  +  + D  ++   L +M  D
Sbjct: 344 SIPS-TVMSEAPNFEDIPEEQSLVNFKDCMEKSLLLESMSSD 384

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score =  112 bits (279), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 66/197 (33%), Positives = 98/197 (49%), Gaps = 31/197 (15%)

Query: 222 LTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYIS 281
             ER IL+      +VKL Y+F D   LYL ++++PGG+    L     L      FY +
Sbjct: 212 FAERTILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQGTLDEVTVSFYAA 271

Query: 282 EMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVK 341
           E+ CA+  LH  G  +RDLKPEN L+D +GH+ LTDFGL+                  V 
Sbjct: 272 EISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSK---------------RGVN 316

Query: 342 NLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLG 401
             D P   E+      E+Y            S +G+P+Y A E+L  + Y    D++SLG
Sbjct: 317 QADSPLGGEQV----EELY------------SIIGTPEYCAPEILCGQPYTQNCDWYSLG 360

Query: 402 CILFESLVGYTPFSGSS 418
            + ++ L+G  PF+G++
Sbjct: 361 SLTYDMLIGKPPFTGAN 377

>Scas_660.20
          Length = 957

 Score =  110 bits (274), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 135/301 (44%), Gaps = 50/301 (16%)

Query: 195 KRDTREICAXXXXXXXXXXXXXETNHVLTERD---ILTTTRSEWLVKLLYAFQDPSSLYL 251
           KR+T+ I A             +  +V  E++   +L       +VKL Y F D  +LY 
Sbjct: 31  KRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAKAHHPGIVKLYYTFHDEENLYY 90

Query: 252 AMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRG 311
            ++++PGG+  +LL   +      ++ +  ++   ++ +H  G  HRDLKPEN L+D  G
Sbjct: 91  VLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFIHSQGVIHRDLKPENVLLDRDG 150

Query: 312 HIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYA 371
            + +TDFG A  T +                                       ND N +
Sbjct: 151 KLMITDFGAAYTTTA-------------------------------------GNNDANKS 173

Query: 372 SST-VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWK 430
           SS+ VG+ +Y++ E+L      F+ D W+LGC++F+ + G  PF G +  +T+E +    
Sbjct: 174 SSSFVGTAEYVSPELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRGENELKTFEKIVALD 233

Query: 431 QVLRRPRCDNGRYAFSDRTWDLIIR-----LIADPISRLRSFEHVKKMKYFAEISFENLR 485
                    N +  F +    LII      L+ +P  RL S + +K+  +FA +++ N R
Sbjct: 234 YPWSSTNIHNNK--FLNNINPLIINLVRKILVLEPKDRL-SLKKIKQDPWFATVNW-NDR 289

Query: 486 N 486
           N
Sbjct: 290 N 290

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score =  110 bits (274), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 133/275 (48%), Gaps = 55/275 (20%)

Query: 228 LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAV 287
           L ++R   ++KL + FQD ++LY  +E+ P GD+ +++     L     ++Y +++  A+
Sbjct: 255 LNSSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAI 314

Query: 288 DALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPK 347
             LH+ G  HRD+KPEN L+D    IKLTDFG A           +  R +E K  D   
Sbjct: 315 HHLHKQGIIHRDVKPENILLDKTMKIKLTDFGTA----------KLIGREDENKPYD--- 361

Query: 348 FEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFES 407
                +N R              + S VG+ +Y++ E+L     D   D W+ GCILF+ 
Sbjct: 362 -----LNTR--------------SKSFVGTAEYVSPELLNDNYVDSRCDIWAFGCILFQM 402

Query: 408 LVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIR------LIADPI 461
           + G  PF   +TNE       +++V+R       +YAF+   + +I+R      L+  P 
Sbjct: 403 VAGKPPF--KATNEYL----TFQKVMRV------QYAFTA-GFPMILRDLIKQLLVKKPE 449

Query: 462 SRLRSFEHVKKMKYFAEISFEN---LRNVSPPFIP 493
            RL +   ++K  +F +I+F N     N +P   P
Sbjct: 450 QRL-TILQIEKHHFFNDINFRNGSVWSNPAPQIAP 483

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score =  109 bits (272), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 121/260 (46%), Gaps = 30/260 (11%)

Query: 226 DILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFC 285
           ++L       ++KL Y F D  +LY  ++F PGG+  +LL           R + +++  
Sbjct: 65  NLLAQKHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQLID 124

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDF 345
           A++ +H  G  HRDLKPEN L+D  G + +TDFG AA              ++   + D 
Sbjct: 125 ALEFIHSHGIIHRDLKPENVLLDRDGRLMITDFGAAA-------------TIDPSLSGDS 171

Query: 346 PKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILF 405
            KF   S   +          D    +S VG+ +Y++ E+L      +  D W+LGC+++
Sbjct: 172 AKFNSDSNGSK----------DNQNCASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIY 221

Query: 406 ESLVGYTPFSGSSTNETYENLRC----WKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPI 461
           + + G  PF G +  +T+E +      W       R +N     +    +L+ +++   +
Sbjct: 222 QFVQGQPPFRGENELKTFEKIVALDYPWGP---NNRINNSTSPINPLVINLVQKILVIEV 278

Query: 462 SRLRSFEHVKKMKYFAEISF 481
           +   S E +K+  YF+++ +
Sbjct: 279 NERISLEQIKRHPYFSKVDW 298

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 84/327 (25%), Positives = 149/327 (45%), Gaps = 42/327 (12%)

Query: 159 KETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXET 218
           K+TG + K+ +K    DF+              LA   ++ +  A             + 
Sbjct: 138 KQTGKITKQVIKKGINDFKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKV 197

Query: 219 NHVLTERDILTTTR-SEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHAR 277
            +V  E++ L   + ++ ++ L + FQD SSLY  +E+ P GD  +L+     +     +
Sbjct: 198 KYVNIEKNTLQRLKNTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQ 257

Query: 278 FYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRL 337
           +Y +++  A+  +H  G  HRDLKPEN L+D    +KLTDFG A              RL
Sbjct: 258 YYAAQIIDALGFMHDKGVIHRDLKPENILLDVDMKVKLTDFGTA--------------RL 303

Query: 338 EEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDY 397
            +  + D                 +L+ + +  ++S VG+ +Y++ E+L     DF  D 
Sbjct: 304 LDSTSED-----------------DLKYDLLTRSNSFVGTAEYVSPELLNDNYVDFRCDI 346

Query: 398 WSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIR-L 456
           W+ GCILF+ + G  PF  ++   T++      +V++        +  + R  DL+   L
Sbjct: 347 WAFGCILFQMIAGKPPFKANNEYLTFQ------KVMKVQFAFTAGFPMTVR--DLVKNIL 398

Query: 457 IADPISRLRSFEHVKKMKYFAEISFEN 483
           I +P  RL     +K  ++FA+++F N
Sbjct: 399 IKNPERRLL-INQIKAHQFFADVNFGN 424

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score =  103 bits (256), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 85/165 (51%), Gaps = 2/165 (1%)

Query: 167 RRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERD 226
           + L P  KD+++I            LARK+ T +  A             +  +V +ER 
Sbjct: 773 KPLTPSIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERA 832

Query: 227 ILTTTRSEWLVKLLYA-FQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFC 285
           I+     +  V  LYA FQ+  +L+L ME++PGGD  TLL     L     + Y+SE+  
Sbjct: 833 IMMVQSDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCLPDEWVKQYLSEIII 892

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLA-AGTVSMER 329
            V+ +H  G  H DLKPEN LID  GH+KLTDFGL+ AG V   R
Sbjct: 893 GVEDMHNNGIIHHDLKPENLLIDVSGHLKLTDFGLSRAGLVKRHR 937

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 84/167 (50%), Gaps = 13/167 (7%)

Query: 376  GSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRR 435
            G+PDY+A E +E    D   D+WS+GCILFE + GY PF   + ++ + N+   K  +  
Sbjct: 1105 GTPDYLAPETIEGTGEDNQCDWWSVGCILFEMVFGYPPFHAETPDQVFRNILEGK--IDW 1162

Query: 436  PRCDN---GRYAFSDRTWDLIIR-LIADPISRL--RSFEHVKKMKYFAEISFENLRNVSP 489
            P  D+    R   S    DLI++ LI DP  RL     E +K   YF ++ ++++ + + 
Sbjct: 1163 PIFDSIEEEREYISPEAKDLIMKFLITDPHKRLGYNGTEEIKNHPYFKDVKWDHVYDETA 1222

Query: 490  PFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAV 536
             ++P +++  D  YFD        A   D     D+ + +  D DA+
Sbjct: 1223 SYVPNIEDPEDTDYFD-----LRGATLQDFGDDNDEDAVLESDGDAI 1264

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score =  102 bits (253), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 134/282 (47%), Gaps = 52/282 (18%)

Query: 220 HVLTERDILTTTRS-EWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARF 278
           +V  E+  L   +S   ++ L + FQD ++LY  +E+ P GD+ +L+     L      +
Sbjct: 163 YVNIEKTALQNLKSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEECTIY 222

Query: 279 YISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLE 338
           Y +++  A+ ++H  G  HRD+KPEN L+D    IKLTDFG A                 
Sbjct: 223 YSAQIIDAIGSMHSHGIIHRDIKPENILLDGNMKIKLTDFGTA----------------- 265

Query: 339 EVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYW 398
                   K  +K  +   + + NL    +  +SS VG+ +Y++ E+L     D+  D W
Sbjct: 266 --------KLLQKKSDKNGKPHYNL----LTRSSSFVGTAEYVSPELLSDNYTDYKCDIW 313

Query: 399 SLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIR--- 455
           + GC++++ + G  PF   +TNE       +++V++       ++AF+   +  IIR   
Sbjct: 314 AFGCLVYQMIAGKPPF--KATNEYL----TFQKVMKV------QFAFT-AGFPTIIRDLV 360

Query: 456 ---LIADPISRLRSFEHVKKMKYFAEISFEN--LRNVSPPFI 492
              L+  P  RL +   +K+   F  I+F +  + N  PP I
Sbjct: 361 KNILVKQPEKRL-TIPQIKEHCLFENINFSDNSVWNRDPPKI 401

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score =  102 bits (253), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 121/260 (46%), Gaps = 25/260 (9%)

Query: 226 DILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFC 285
           ++L       +VKL Y F D  +LY  +++  GG+  +LL          A+ + +++  
Sbjct: 65  NLLARGNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTDSWAKHFAAQLVD 124

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDF 345
            ++ +H  G  HRDLKPEN L+   G + +TDFG AA   +    ++ +    E      
Sbjct: 125 TLEFMHARGVIHRDLKPENVLLSKEGILMITDFGAAATQNNFSDKDNTRSNANE----GI 180

Query: 346 PKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILF 405
           PK +  S  D+ E             SS VG+ +Y++ E+L      F  D W+LGC+++
Sbjct: 181 PKDDVPSSGDKTE------------CSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVY 228

Query: 406 ESLVGYTPFSGSSTNETYENLR----CWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPI 461
           + + G+ PF G +  +T+E +      W      P         + +  +L+ R++    
Sbjct: 229 QFIQGFPPFRGENELKTFEKIVSLDYSW-----NPERQTNFGTINIQVVNLVRRMLTIDT 283

Query: 462 SRLRSFEHVKKMKYFAEISF 481
           ++  + + +K+  +FA + +
Sbjct: 284 TQRATIDQIKRDPWFANVDW 303

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score =  102 bits (253), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 87/157 (55%), Gaps = 2/157 (1%)

Query: 171 PKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTT 230
           P  KD++++            LARK+ T +  A             +  +V +ER I+  
Sbjct: 789 PSIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMV 848

Query: 231 TRSE-WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDA 289
              + ++ +L  +FQ+  +L+L ME++PGGD  TL+    +L    A+ Y++E+   V+ 
Sbjct: 849 QSDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVND 908

Query: 290 LHQLGYTHRDLKPENFLIDSRGHIKLTDFGLA-AGTV 325
           +HQ G  H DLKPEN LID+ GH+KLTDFGL+ AG +
Sbjct: 909 MHQNGIIHHDLKPENLLIDNAGHVKLTDFGLSRAGLI 945

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 71/137 (51%), Gaps = 9/137 (6%)

Query: 376  GSPDYMALEVLEAKNYDF-TVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLR 434
            G+PDY+A E +E K  D    D+WS+GCI FE L+GY PF   + +  ++  +    V++
Sbjct: 1149 GTPDYLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPFHAETPDAVFK--KILSGVIQ 1206

Query: 435  RPRCDNGRYA---FSDRTWDLIIR-LIADPISRL--RSFEHVKKMKYFAEISFENLRNVS 488
             P   N        +    DLI + L+ DP  RL  +  + +K   YF  + ++++ +  
Sbjct: 1207 WPEFKNEEEEREFLTPEAKDLIEKLLVVDPAKRLGAKGIQEIKDHPYFKNVDWDHVYDEE 1266

Query: 489  PPFIPQLDNETDAGYFD 505
              F+P +DN  D  YFD
Sbjct: 1267 ASFVPTIDNPEDTDYFD 1283

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score =  100 bits (250), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 82/156 (52%), Gaps = 1/156 (0%)

Query: 167 RRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERD 226
           + + P  +D+++I            LA+KR T E  A             +  +V +ER 
Sbjct: 693 KSIIPSIRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERA 752

Query: 227 ILTTTRSEWLVKLLYA-FQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFC 285
           I+     +  V  LYA FQ+  +L+L M+++ GGD  TL+     L    A+ YI E+  
Sbjct: 753 IMMVQSDKPYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNLPEKWAKQYICEVIS 812

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLA 321
            VD +HQ G  H DLKP+N LIDS GHIKLTDFGL+
Sbjct: 813 GVDDMHQNGIIHHDLKPDNLLIDSLGHIKLTDFGLS 848

>Kwal_56.22476
          Length = 697

 Score =  100 bits (249), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 93/210 (44%), Gaps = 42/210 (20%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           +L+E  I  + R   +V+ +  F+D +++Y+ +E  P G    LL   + L  P  RF+ 
Sbjct: 123 LLSEIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFT 182

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
           +++  AV  +H     HRDLK  N   D   ++K+ DFGLAA                  
Sbjct: 183 TQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLA--------------- 227

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN--YDFTVDYW 398
                        NDR   YT              G+P+Y+A EVL  K+  + + VD W
Sbjct: 228 -------------NDRERKYT------------VCGTPNYIAPEVLTGKHTGHSYEVDIW 262

Query: 399 SLGCILFESLVGYTPFSGSSTNETYENLRC 428
           S G +++  L+G  PF     N  YE ++C
Sbjct: 263 SCGVMIYALLIGKPPFQAKEVNIIYERIKC 292

>Kwal_14.1159
          Length = 1521

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 88/169 (52%), Gaps = 2/169 (1%)

Query: 171 PKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTT 230
           P  KD+++I            LA++R T E  A             +  +V +ER I+  
Sbjct: 672 PSIKDYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMV 731

Query: 231 TRSEWLVKLLYA-FQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDA 289
             ++  V  LYA FQ+  +L+L ME++ GGD  TL+     L     + YISE+   V+ 
Sbjct: 732 QSNKPYVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGSLPDQWVKQYISEVIYGVED 791

Query: 290 LHQLGYTHRDLKPENFLIDSRGHIKLTDFGLA-AGTVSMERIESMKIRL 337
           +HQ G  H DLKP+N LID RGH+KLTDFGL+  G V+     + K RL
Sbjct: 792 MHQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRMGLVTRHTGATQKSRL 840

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 67/137 (48%), Gaps = 10/137 (7%)

Query: 376  GSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRC----WKQ 431
            G+PDY+A E +E      + D+WS+GC+LFE + GY PF  S+  E + N+      W  
Sbjct: 960  GTPDYLAPETIEGTGETDSSDWWSVGCMLFEFVFGYPPFHASTVEEVFSNILAGNIDWPA 1019

Query: 432  VLRRPRCDNGRYAFSDRTWDLIIR-LIADPISRL--RSFEHVKKMKYFAEISFENLRNVS 488
                P     R   S    DLI + L+ DP  RL     E + +  YF ++ +ENL   +
Sbjct: 1020 F---PDEATEREYISPEARDLIEKLLVVDPDKRLGANGAEEIFEHPYFQDVDWENLYKDT 1076

Query: 489  PPFIPQLDNETDAGYFD 505
              F+P + +     YFD
Sbjct: 1077 GSFVPDIAHPESTDYFD 1093

>Scas_707.3
          Length = 1598

 Score = 99.4 bits (246), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 97/185 (52%), Gaps = 6/185 (3%)

Query: 165 RKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTE 224
           + + L P  KD+ ++            LARK+ T +  A             +  +V +E
Sbjct: 688 QTKNLTPTIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSE 747

Query: 225 RDILTTTRSEWLVKLLYA-FQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEM 283
           R I+     +  V  L+A FQ+  +L+L ME++PGGD  TL+    +L     + Y++E+
Sbjct: 748 RAIMMVQSDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTEI 807

Query: 284 FCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLA-AGTVS----MERIESMKIRLE 338
              VD +H+    H DLKP+N LID+ GH+KLTDFGL+ AG +     ++R++S+    E
Sbjct: 808 IVGVDDMHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGLIHRHKFVDRVKSLSPSTE 867

Query: 339 EVKNL 343
            + N+
Sbjct: 868 ILSNI 872

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 82/155 (52%), Gaps = 10/155 (6%)

Query: 376  GSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRR 435
            G+PDY+A E +E        D+WS+GCI+FE L GY PF  ++    +  +   K  +  
Sbjct: 1007 GTPDYLAPETIEGTGEGDQCDWWSVGCIMFELLFGYPPFHTNTPEGVFRKILSGK--IEW 1064

Query: 436  PRCDN---GRYAFSDRTWDLIIR-LIADPISRL--RSFEHVKKMKYFAEISFENLRNVSP 489
            P+ D+    R   S    DLI++ L+ DP  RL     + +K+  YF +++++++ +   
Sbjct: 1065 PQFDSIEEEREILSPEAKDLIMKLLVVDPSKRLGANGADEIKQHPYFKDVNWDHVYDEEA 1124

Query: 490  PFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQD 524
             F+P ++N  D  YFD  T  A +  + D ++ ++
Sbjct: 1125 SFVPTVENPEDTDYFD--TRGAVLENFGDDYEDKE 1157

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 126/297 (42%), Gaps = 55/297 (18%)

Query: 193 ARKRDTREICAXXXXXXXXXXXXXETNHVLTERD---ILTTTRSEWLVKLLYAFQDPSSL 249
           A  R T ++ A             +  +V  E++   +L       ++KL Y F D  +L
Sbjct: 27  AVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHGNHPGIIKLYYTFHDSENL 86

Query: 250 YLAMEFVPGGDYRTLL-INTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
           Y  ++F PGG+   LL    RF +A   + ++ ++  A++ +H     HRDLKPEN L+ 
Sbjct: 87  YFVLDFAPGGELLQLLQTQGRFNEA-WTKHFMCQLIDALEYIHGCKVVHRDLKPENLLLS 145

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
           S G + +TDFG+A+   + + + S                                    
Sbjct: 146 SEGKLMITDFGVASNLAATDNLSS------------------------------------ 169

Query: 369 NYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRC 428
              SS VG+ +Y++ E+L     +F  D W++GC+L++   G  PF G +    +E +  
Sbjct: 170 --TSSFVGTAEYVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIV- 226

Query: 429 WKQVLRRPRCD-NGRYAFSDRTWDLIIR-LIADPISRLRSFEHVKKMKYFAEISFEN 483
                     D +  Y  S    DL+ + L+ DP SR  +   +K   +F  I + N
Sbjct: 227 --------NLDYHWIYMVSQHITDLVSKILVLDPDSRY-TLPQIKNHAWFQGIDWTN 274

>Kwal_47.18307
          Length = 621

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 123/273 (45%), Gaps = 53/273 (19%)

Query: 217 ETNHVLTERDILTTTRSEW---LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQA 273
           +  +V  E+D+L          +VKL   F D  +LY  +E+V GG+   L+     L  
Sbjct: 52  KVKYVTIEKDLLNMLAKGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTE 111

Query: 274 PHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESM 333
             +R   +++   VD +H  G  HRDLKPEN L+   G + +TDFG  A   + +R    
Sbjct: 112 DLSRHITAQLVDTVDYMHSKGVIHRDLKPENVLLSQEGRVVITDFG--AACTAADR---- 165

Query: 334 KIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDF 393
                        KFE    N +R              +S VG+ +Y++ E+L      F
Sbjct: 166 -------------KFE----NTKR-------------TASFVGTAEYVSPELLLHSQCGF 195

Query: 394 TVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLI 453
           + D W+LGCI+++   G  PF G +  +T+E +             + ++ FS+    + 
Sbjct: 196 SSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVAL----------DYKWLFSNSPQVVS 245

Query: 454 IR---LIADPISRLRSFEHVKKMKYFAEISFEN 483
           I    L+ DP+ R  S   +K+  +FA I ++N
Sbjct: 246 IVQSILVTDPLKR-PSAAQLKQNPWFASIDWDN 277

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 97.8 bits (242), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 79/152 (51%), Gaps = 1/152 (0%)

Query: 171 PKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTT 230
           P  KD+++I            LA KR T E  A             +  +V +ER I+  
Sbjct: 677 PSIKDYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMV 736

Query: 231 TRSEWLVKLLYA-FQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDA 289
              +  V  LYA FQ+  +L+L ME++ GGD  TL+     L    A+ YI+E+   VD 
Sbjct: 737 QSEKPYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDD 796

Query: 290 LHQLGYTHRDLKPENFLIDSRGHIKLTDFGLA 321
           +H  G  H DLKP+N LIDS GH+KLTDFGL+
Sbjct: 797 MHMSGIIHHDLKPDNLLIDSNGHVKLTDFGLS 828

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 10/137 (7%)

Query: 376  GSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRC----WKQ 431
            G+PDY++ E +         D+WS+GCILFE L+GY PF  S+  + ++N+      W  
Sbjct: 1003 GTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDVFKNILSGQIDWPS 1062

Query: 432  VLRRPRCDNGRYAFSDRTWDLIIRLI-ADPISRL--RSFEHVKKMKYFAEISFENLRNVS 488
                P  +      S    DLI++L+ ++P  RL     + +K+  YF  I++  + +  
Sbjct: 1063 F---PNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFKGINWSKVYDEE 1119

Query: 489  PPFIPQLDNETDAGYFD 505
              F+P +DN  D  YFD
Sbjct: 1120 ASFVPTVDNPEDTDYFD 1136

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 92/209 (44%), Gaps = 42/209 (20%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           +L+E  I  + +   +V+    F+D +++Y+ +E  P G    LL   + L  P  RF+ 
Sbjct: 117 LLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFT 176

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
           +++  A+  +H     HRDLK  N   D   ++K+ DFGLAA                  
Sbjct: 177 TQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA--------------- 221

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN--YDFTVDYW 398
                        NDR   YT              G+P+Y+A EVL  K+  + F VD W
Sbjct: 222 -------------NDRERKYT------------ICGTPNYIAPEVLTGKHTGHSFEVDIW 256

Query: 399 SLGCILFESLVGYTPFSGSSTNETYENLR 427
           S+G +++  L+G  PF     N  YE ++
Sbjct: 257 SIGVMIYALLIGKPPFQAKEVNTIYERIK 285

>Scas_502.2
          Length = 1116

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 88/340 (25%), Positives = 146/340 (42%), Gaps = 51/340 (15%)

Query: 150 SKEWQAYLTKETGILRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXX 209
           +K  Q  +  ETG   +  +K   KDF+              LA   D+ +  A      
Sbjct: 148 AKIIQESINPETGQKMRHVVKKGIKDFKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNK 207

Query: 210 XXXXXXXETNHVLTERDILT-TTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINT 268
                  +  +V  E+  L     S  +++L + FQD +SLY  +E+ P GD  +L+   
Sbjct: 208 EYLIRQKKVKYVNIEKLALQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKF 267

Query: 269 RFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSME 328
             L      +Y +++  A+  +H  G  HRD+KPEN L+D    +K+TDFG A       
Sbjct: 268 GSLNEECCCYYGAQIIDAIKFMHSKGIIHRDIKPENILLDKDMKVKITDFGTA------- 320

Query: 329 RIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEA 388
                KI             + K      ++ T         + S VG+ +Y++ E+L  
Sbjct: 321 -----KI------------LDNKPPGTSYDLLTR--------SKSFVGTAEYVSPELLND 355

Query: 389 KNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDR 448
              D   D W+ GCI+F+ + G  PF   +TNE       +++V++       +YAF+  
Sbjct: 356 NYTDARSDIWAFGCIVFQMIAGKPPF--KATNEYL----TFQKVMKV------QYAFTAG 403

Query: 449 ----TWDLIIR-LIADPISRLRSFEHVKKMKYFAEISFEN 483
                 DL+ R LI  P  RL + E ++K  +F   +F++
Sbjct: 404 FPTVVRDLVKRILIKAPEQRL-TIEAIEKHHFFRSKNFQD 442

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 121/305 (39%), Gaps = 51/305 (16%)

Query: 174 KDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRS 233
           +DFE+               + R+T  ICA                    E +I  + + 
Sbjct: 98  QDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFKH 157

Query: 234 EWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQL 293
           + L +L   F D   +YL ME+V  G+    L N   L    A +++ +M  A+D +H  
Sbjct: 158 KNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALDYMHSK 217

Query: 294 GYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSM 353
              HRD+KPEN LI     IKLTDFG +                  V N D  K      
Sbjct: 218 NILHRDIKPENILIGFNNTIKLTDFGWS------------------VYNEDGQK------ 253

Query: 354 NDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTP 413
                              +  G+ DY++ E+++++ Y+  VD W+LG + +E LVG  P
Sbjct: 254 -----------------RKTLCGTIDYLSPELIKSREYNNKVDVWALGVLTYELLVGSPP 296

Query: 414 FSGSSTNETYEN-LRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKK 472
           F   +   TY   LRC    L+ P         S +  DLI+RL+    S+      VK 
Sbjct: 297 FEEDTKEMTYRRILRC---DLKFP------LNVSPQARDLIVRLLQFEPSKRIPLSEVKS 347

Query: 473 MKYFA 477
             + A
Sbjct: 348 HAWIA 352

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 93/215 (43%), Gaps = 52/215 (24%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEM 283
           E D+L       +VKL   F+D  + Y+ MEFV GGD    +     +     R    ++
Sbjct: 238 ELDVLQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQV 297

Query: 284 FCAVDALHQLGYTHRDLKPENFLI--DSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVK 341
             AV  +H  G +HRDLKP+N +I  D    IK+TDFGLA                    
Sbjct: 298 LEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAK------------------- 338

Query: 342 NLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN---------YD 392
                                  +N   + ++  G+  Y+A EV++ KN         Y 
Sbjct: 339 ----------------------VQNQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNRDLYS 376

Query: 393 FTVDYWSLGCILFESLVGYTPFSGSSTNETYENLR 427
             VD WS+GC+++  L G+ PFSG S NE ++ ++
Sbjct: 377 SLVDMWSIGCLVYVILTGHLPFSGQSQNELFKQIK 411

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 90/210 (42%), Gaps = 42/210 (20%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           +L+E  I  + +   +V+    F+D +++Y+ +E  P G    LL   + L  P  RF +
Sbjct: 134 LLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCM 193

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
            ++  A+  +H     HRDLK  N   D   ++K+ DFGLAA                  
Sbjct: 194 IQIIGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLA--------------- 238

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN--YDFTVDYW 398
                        ND+   YT              G+P+Y+A EVL  K+  + + VD W
Sbjct: 239 -------------NDKERKYT------------ICGTPNYIAPEVLTGKHTGHSYEVDIW 273

Query: 399 SLGCILFESLVGYTPFSGSSTNETYENLRC 428
           S+G +L+  L G  PF        YE ++C
Sbjct: 274 SIGVMLYALLFGKPPFQAKEVETIYERIKC 303

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 116/296 (39%), Gaps = 58/296 (19%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DFE+               R R T  ICA                    E +I T+    
Sbjct: 103 DFELGKKLGKGKFGKVYCVRHRSTGYICALKVMEKEEIIKYNLQKQFRREVEIQTSLNHP 162

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPH----ARFYISEMFCAVDAL 290
            L K    F D   +YL ME++  G+   LL     L  P     A  YI ++  A+D +
Sbjct: 163 NLTKSYGYFHDEKRVYLLMEYLVNGEMYKLL----RLHGPFNDILASDYIYQIANALDYM 218

Query: 291 HQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEE 350
           H+    HRD+KPEN LI     IKLTDFG +                     ++ P+   
Sbjct: 219 HKKNIIHRDIKPENILIGFNNVIKLTDFGWSI--------------------INPPE--- 255

Query: 351 KSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVG 410
                             N   +  G+ DY++ E++E++ YD T+D W+LG + FE L G
Sbjct: 256 ------------------NRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTG 297

Query: 411 YTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-DPISRLR 465
             PF     + TY+ +      ++ P         S    DLI++L+  DP  R+R
Sbjct: 298 APPFEEEMKDTTYKRIAALD--IKMPS------NISQDAQDLILKLLKYDPKDRMR 345

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 97/235 (41%), Gaps = 42/235 (17%)

Query: 195 KRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAME 254
           K D+ +I A                 +L+E  I  +     +V+ +  F+D  ++Y+ +E
Sbjct: 99  KDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHTNIVQFIDCFEDNVNVYILLE 158

Query: 255 FVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIK 314
             P G    L+   + +  P  RF+++++   +  +H     HRDLK  N   D   ++K
Sbjct: 159 ICPNGSLMELIKKRKTITEPEVRFFMTQICGGIQYMHSNRVIHRDLKLGNIFFDEHYNLK 218

Query: 315 LTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASST 374
           + DFGLAA                               NDR   +T             
Sbjct: 219 IGDFGLAAVLA----------------------------NDRERKFT------------I 238

Query: 375 VGSPDYMALEVLEAKN--YDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLR 427
            G+P+Y+A EVL  K+  + + VD WS+G +L+  L+G  PF     N  YE ++
Sbjct: 239 CGTPNYIAPEVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIK 293

>Kwal_26.8796
          Length = 796

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 94/216 (43%), Gaps = 51/216 (23%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           V  E ++L       +V L   ++D  S YL MEFV GGD    +     +     R   
Sbjct: 231 VARELEVLQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREIT 290

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLI--DSRGHIKLTDFGLAAGTVSMERIESMKIRLE 338
            ++  AV  +H +G +HRDLKP+N LI  D    +K+TDFGLA            KI   
Sbjct: 291 RQILEAVKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLA------------KI--- 335

Query: 339 EVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN-------- 390
                                     + +  +  +  G+  Y+A EV+  KN        
Sbjct: 336 --------------------------QGNGTFMKTFCGTLAYVAPEVISGKNSGEKEGNT 369

Query: 391 YDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENL 426
           Y   VD WS+GC+++  L G+ PFSGS+ N+ Y+ +
Sbjct: 370 YSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQI 405

>KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 633

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 81/143 (56%), Gaps = 8/143 (5%)

Query: 369 NYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRC 428
           N + +  G+PDY+A E ++      T D+WS+GCI FE L GY PF G++ +E +EN+  
Sbjct: 58  NESKNFFGTPDYLAPETIKGTGESDTCDWWSVGCIFFEFLFGYPPFHGTTVDEVFENI-- 115

Query: 429 WKQVLRRPRCDNGRYA---FSDRTWDLIIRLIA-DPISRLRS--FEHVKKMKYFAEISFE 482
              V+R P   +        S    DL+I+L+  DP  RL +   + +K+  YF ++ ++
Sbjct: 116 IGGVIRWPEFPDAETEMEYISPDAKDLVIKLLVLDPNKRLGASGSQEIKEHPYFKDVDWD 175

Query: 483 NLRNVSPPFIPQLDNETDAGYFD 505
           ++ +  P F+P++++  D  YFD
Sbjct: 176 HVYDEQPSFVPRVEHPEDTEYFD 198

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 87.8 bits (216), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 112/265 (42%), Gaps = 61/265 (23%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           V  E ++L       +V L   ++D  S YL MEFV GGD    +     +     R   
Sbjct: 260 VTRELEVLRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREIT 319

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLI--DSRGHIKLTDFGLAAGTVSMERIESMKIRLE 338
            ++  AV  +H+ G +HRDLKP+N LI  D    +K+TDFGLA            KI   
Sbjct: 320 RQILEAVRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLA------------KI--- 364

Query: 339 EVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN-------- 390
                                     +++  +  +  G+  Y+A EV+  KN        
Sbjct: 365 --------------------------QDNTTFMKTFCGTLAYVAPEVIGGKNPEGNGANG 398

Query: 391 --YDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDR 448
             Y   VD WS+GC+++  L G+ PFSGS+  + Y+ +         P  D   Y  SD 
Sbjct: 399 NLYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQI-ANGSYHEGPLKD---YWISDE 454

Query: 449 TWDLIIRLIA-DPISRL---RSFEH 469
             D I  L+  +P+ RL   R+ +H
Sbjct: 455 ARDFIDSLLQINPVDRLTAERALQH 479

>Kwal_56.24091
          Length = 381

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 122/294 (41%), Gaps = 56/294 (19%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DFE+               + + T  ICA                    E +I ++ +  
Sbjct: 122 DFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQYNVQKQFRREVEIQSSLKHP 181

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGD-YRTLLINTRF--LQAPHARFYISEMFCAVDALH 291
            L +L   F D   +YL ME++  G+ Y+ L  +  F  + A H   ++ +M  A++ +H
Sbjct: 182 NLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASH---FVHQMADALNYMH 238

Query: 292 QLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEK 351
                HRD+KPEN L+  +  +KLTDFG +   V                          
Sbjct: 239 SKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVG------------------------- 273

Query: 352 SMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGY 411
             N +R+              +  G+ DY++ E+++++ YD  VD W+LG + +E LVG 
Sbjct: 274 --NSKRK--------------TLCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGS 317

Query: 412 TPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-DPISRL 464
            PF   +   TY+  R  K+ LR P         S    DLI RL+  DP +R+
Sbjct: 318 PPFEEDTKELTYK--RIIKRDLRFPD------QVSPHARDLISRLLEYDPQNRI 363

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 87.8 bits (216), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 99/238 (41%), Gaps = 47/238 (19%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           +++L   ++  S LYL +E+   G+   +L+    L    A     ++   +   H LG 
Sbjct: 91  VLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGV 150

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMND 355
            HRDLKPEN L+D++ +IK+ DFG+AA       +ES    LE                 
Sbjct: 151 VHRDLKPENLLLDNKLNIKIADFGMAA-------LESEDKLLE----------------- 186

Query: 356 RREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTPF 414
                            ++ GSP Y A E++    Y+ F+ D WS G ILF  L G  PF
Sbjct: 187 -----------------TSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPF 229

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLI-ADPISRLRSFEHVK 471
                N     L+  K     P  D      +    DL+ RL+  DP  R+   E +K
Sbjct: 230 DEEDGNIRNLLLKVQKGEFEMPDDDE----ITKEAQDLLARLLTVDPSKRITIREILK 283

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 100/236 (42%), Gaps = 60/236 (25%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           ++ LL  +++ S LYL +E+V GG+    L++   L  P A  Y +++   V   H    
Sbjct: 188 VMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNI 247

Query: 296 THRDLKPENFLIDSRGH-IKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
            HRDLKPEN L+D +   IK+ DFG+AA                    L+ P        
Sbjct: 248 CHRDLKPENLLLDKKNKVIKIADFGMAA--------------------LELPN------- 280

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTP 413
                             ++ GSP Y + E++  K Y     D WS G ILF  L G+ P
Sbjct: 281 --------------KLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLP 326

Query: 414 FSGSSTNETYENLRCWKQVLRRPRCDNGRYA----FSDRTWDLIIR-LIADPISRL 464
           F          N    K++L + +   GR+      ++   DLI R L+ +P  RL
Sbjct: 327 F----------NDDNIKKLLLKVQA--GRFQLPPYLTNDAKDLITRILVTNPEKRL 370

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 98/238 (41%), Gaps = 47/238 (19%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           +++L   ++    LY+ +E+V  G+   LL+    L    A  +  ++   +   H LG 
Sbjct: 88  VLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGI 147

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMND 355
            HRDLKPEN L+D + ++KL DFG+AA       +ES    LE                 
Sbjct: 148 VHRDLKPENLLLDHKFNVKLADFGMAA-------LESKDKLLE----------------- 183

Query: 356 RREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTPF 414
                            ++ GSP Y A E++    Y  F  D WS G IL+  L G  PF
Sbjct: 184 -----------------TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 226

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLI-ADPISRLRSFEHVK 471
                N     L+        P    G    S    DLI R++  DP  R+++ E +K
Sbjct: 227 DEEDGNIRNLLLKVQSGKFEMP----GDDEISSEAQDLIARILTVDPEQRIKTREILK 280

>Scas_644.15
          Length = 726

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 101/247 (40%), Gaps = 55/247 (22%)

Query: 223 TERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISE 282
           +E  I  + +   +V  +  F+D +++Y+ +E    G    L+   + L  P  RF+ ++
Sbjct: 138 SEIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQ 197

Query: 283 MFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKN 342
           +  AV  +H     HRDLK  N   D   ++K+ DFGLAA                    
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA----------------- 240

Query: 343 LDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN--YDFTVDYWSL 400
                      N+R   YT              G+P+Y+A EVL  K+  + F VD WS+
Sbjct: 241 -----------NNRERKYT------------VCGTPNYIAPEVLMGKHAGHSFEVDIWSI 277

Query: 401 GCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNG----RYAFSDRTWDLIIRL 456
           G +++  LVG  PF     N  Y+ ++          C  G    +Y  S+    +   L
Sbjct: 278 GVMIYALLVGKPPFQAKDVNVIYDRIKA---------CQYGYPKDKYVSSEAKTLIADIL 328

Query: 457 IADPISR 463
             DP+ R
Sbjct: 329 CVDPVER 335

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 93/212 (43%), Gaps = 47/212 (22%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEM 283
           E +I ++ R   L +L   F D   +YL ME++  G+    L          A +Y+ +M
Sbjct: 157 EVEIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQM 216

Query: 284 FCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNL 343
             A+D +H+    HRD+KPEN +I     IKLTDFG +  T                   
Sbjct: 217 ADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVIT------------------- 257

Query: 344 DFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCI 403
             PK  ++                     +  G+ DY++ E++ ++ Y+  VD W+LG +
Sbjct: 258 --PKGSKR--------------------KTLCGTVDYLSPELIRSREYNEKVDVWALGVL 295

Query: 404 LFESLVGYTPFSGSSTNETYENLRCWKQVLRR 435
            +E LVG  PF   S   TY      K++L+R
Sbjct: 296 TYELLVGSPPFEEESKELTY------KRILKR 321

>YPL153C (RAD53) [5294] chr16 complement(261726..264191)
           Serine/threonine/tyrosine protein kinase with a
           checkpoint function in S and G2 phases, contains
           forkhead associated (FHA) domain [2466 bp, 821 aa]
          Length = 821

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 94/221 (42%), Gaps = 56/221 (25%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           V  E ++L       +V+L   ++D  S Y+ MEFV GGD    +     +     R   
Sbjct: 241 VTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREIS 300

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLI--DSRGHIKLTDFGLAAGTVSMERIESMKIRLE 338
            ++  A+  +H +G +HRDLKP+N LI  D    +K+TDFGLA                 
Sbjct: 301 RQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAK---------------- 344

Query: 339 EVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN-------- 390
                                     + + ++  +  G+  Y+A EV+  K+        
Sbjct: 345 -------------------------VQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEY 379

Query: 391 -----YDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENL 426
                Y   VD WS+GC+++  L G+ PFSGS+ ++ Y+ +
Sbjct: 380 EERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQI 420

>Scas_493.2
          Length = 1117

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 101/247 (40%), Gaps = 47/247 (19%)

Query: 227 ILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCA 286
           I+   R   ++ L   ++  S+LY+ +E+   G+   LL+    L    A  +  ++   
Sbjct: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146

Query: 287 VDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFP 346
           +   H LG  HRDLKPEN L+D + +IK+ DFG+AA       +E+    LE        
Sbjct: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-------LETEDKLLE-------- 191

Query: 347 KFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILF 405
                                     ++ GSP Y A E++    Y  F  D WS G ILF
Sbjct: 192 --------------------------TSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILF 225

Query: 406 ESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLI-ADPISRL 464
             L G  PF     N     L+        P  D      S    DLI R++  DP  R+
Sbjct: 226 ALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDD----EMSRDAQDLISRILTVDPTKRI 281

Query: 465 RSFEHVK 471
           ++ E +K
Sbjct: 282 KTREILK 288

>Scas_616.10
          Length = 1461

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 100/246 (40%), Gaps = 55/246 (22%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           ++ L   +++ S LYL +E+V GG+    L++   L    A  Y  ++   V   H    
Sbjct: 198 VMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNI 257

Query: 296 THRDLKPENFLIDSRGH-IKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
            HRDLKPEN L+D +   IK+ DFG+AA                    L+ P        
Sbjct: 258 CHRDLKPENLLLDKKNKSIKIADFGMAA--------------------LELPN------- 290

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTP 413
                             ++ GSP Y + E++  K+Y     D WS G ILF  L G+ P
Sbjct: 291 --------------KLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLP 336

Query: 414 FSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIR-LIADPISRL---RSFEH 469
           F+  +  +    ++  K   R P         S    DLI R L+ DP  R+   R   H
Sbjct: 337 FNDDNIKKLLLKVQAGK--FRMPST------LSPEAQDLISRILVIDPSKRITTDRILNH 388

Query: 470 VKKMKY 475
              +KY
Sbjct: 389 PLILKY 394

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 84.7 bits (208), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 96/238 (40%), Gaps = 47/238 (19%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           +++L   ++  + LYL +E+   G+   LL+    L    A  +  ++   V   H LG 
Sbjct: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGI 152

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMND 355
            HRDLKPEN L+D + +IK+ DFG+AA                                 
Sbjct: 153 VHRDLKPENLLLDHKYNIKIADFGMAA--------------------------------- 179

Query: 356 RREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTPF 414
                    E +     ++ GSP Y A E++    Y  F  D WS G ILF  L G  PF
Sbjct: 180 --------LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLI-ADPISRLRSFEHVK 471
                N     L+  K     P  D      S    DLI +++  DP  R+++ + +K
Sbjct: 232 DEEDGNIRTLLLKVQKGEFEMPSDDE----ISREAQDLIRKILTVDPERRIKTRDILK 285

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 99/238 (41%), Gaps = 47/238 (19%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           +++L   ++    LY+ +E+V  G+   LL+    L    A  +  ++   +   H LG 
Sbjct: 90  VLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGI 149

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMND 355
            HRDLKPEN L+D + +IKL DFG+AA       +ES    LE                 
Sbjct: 150 VHRDLKPENLLLDHKFNIKLADFGMAA-------LESKDKLLE----------------- 185

Query: 356 RREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTPF 414
                            ++ GSP Y A E++    Y  F  D WS G IL+  L G  PF
Sbjct: 186 -----------------TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 228

Query: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLI-ADPISRLRSFEHVK 471
                N     L+        P    G    S    DLI++++  +P  R+++ E +K
Sbjct: 229 DEEDGNIRNLLLKVQSGKYEIP----GEDEISPEARDLIVQILTVEPEQRIKTREILK 282

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 78/181 (43%), Gaps = 42/181 (23%)

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++ KL       S +++ +E+  G +    L+  + L    ++   S++  AV   H+L 
Sbjct: 89  YITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHELK 148

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             HRDLK EN L+D  GH KLTDFG      +  ++E++                     
Sbjct: 149 CVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETI--------------------- 187

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTP 413
                                G+  YMA E++E K YD F VD WSLG IL+  + GY P
Sbjct: 188 --------------------CGTTVYMAPELIERKCYDGFKVDIWSLGIILYTMINGYMP 227

Query: 414 F 414
           F
Sbjct: 228 F 228

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 107/250 (42%), Gaps = 63/250 (25%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           ++ L   +++ S LYL +E+V GG+    LI    L    A  Y  ++   V   H    
Sbjct: 126 IMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFKQIVQGVSYCHNFNI 185

Query: 296 THRDLKPENFLIDSRGH-IKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
            HRDLKPEN L+D +   +K+ DFG+AA       +E+    LE                
Sbjct: 186 CHRDLKPENLLLDKKNKTVKIADFGMAA-------LETTNRLLE---------------- 222

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTP 413
                             ++ GSP Y + E++  + Y  +  D WS G ILF  L G+ P
Sbjct: 223 ------------------TSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLP 264

Query: 414 FSGSSTNETYENLRCWKQVLRRPRCDNGRYAF----SDRTWDLIIR-LIADPISRL---R 465
           F+        +N+R  K +L   +  +GRY      S    DLI + L+ DP  R+   +
Sbjct: 265 FND-------DNVR--KLLL---KVQHGRYQMPSNVSKEAKDLISKILVVDPEKRITVDK 312

Query: 466 SFEHVKKMKY 475
             EH   +KY
Sbjct: 313 ILEHPLLVKY 322

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 98/250 (39%), Gaps = 58/250 (23%)

Query: 247 SSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFL 306
           ++LYL +E+   G+   LL++   L    A     ++   +   H LG  HRDLKPEN L
Sbjct: 100 NNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLL 159

Query: 307 IDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLREN 366
           +DS  +IK+ DFG+AA                                          + 
Sbjct: 160 LDSFYNIKIADFGMAA-----------------------------------------LQT 178

Query: 367 DVNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTPFSGSSTNETYEN 425
           D +   ++ GSP Y A E++    Y+ F  D WS G ILF  L G  PF   + N     
Sbjct: 179 DADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLL 238

Query: 426 LRCWKQVLRRPRCDNGRYAFSDRTWDLIIR-LIADPISR-----------LRSFEHVKKM 473
           L+  K     P         S    DLI + L+ DP  R           L+ ++ +K  
Sbjct: 239 LKVQKGQFEMP----NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDS 294

Query: 474 KYFAEISFEN 483
           K   ++  EN
Sbjct: 295 KSIKDLPREN 304

>Scas_700.54
          Length = 698

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 90/213 (42%), Gaps = 51/213 (23%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEM 283
           E ++L       +V+L   ++D  S Y+ MEFV GGD    +     +     +    ++
Sbjct: 269 ELEVLQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQI 328

Query: 284 FCAVDALHQLGYTHRDLKPENFLI--DSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVK 341
             AV  +H  G +HRDLKP+N LI  D    +K+TDFGLA                    
Sbjct: 329 LEAVKYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAK------------------- 369

Query: 342 NLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN--------YDF 393
                                  + + ++  +  G+  Y+A EV+  K         Y  
Sbjct: 370 ----------------------VQGNGSFMKTFCGTLAYVAPEVIGGKGETNEERNEYSS 407

Query: 394 TVDYWSLGCILFESLVGYTPFSGSSTNETYENL 426
            VD WS+GC+++  L G+ PFSGS+  + Y+ +
Sbjct: 408 LVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQI 440

>Kwal_14.2497
          Length = 418

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 82/176 (46%), Gaps = 39/176 (22%)

Query: 253 MEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALH-QLGYTHRDLKPENFLIDSRG 311
           ME   GGD    +     + +  ARFY  ++  A+D LH + G  HRD+KPEN L+D RG
Sbjct: 1   MELASGGDLFDKIEPDVGVDSEVARFYFKQLINAIDHLHNRCGVAHRDIKPENLLLDERG 60

Query: 312 HIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYA 371
           ++KL DFGLA+                        +F+ K  + R               
Sbjct: 61  NLKLADFGLAS------------------------QFKRKDGSKR-------------IM 83

Query: 372 SSTVGSPDYMALEVLEAKN-YDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENL 426
           S T GS  YMA E++ +K+ Y  + D WS G ++F  L G TP+   S +  +++ 
Sbjct: 84  SDTRGSLPYMAPEIVYSKSYYADSTDIWSCGVLVFVLLTGETPWDSPSDDSRFDDF 139

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 78/168 (46%), Gaps = 38/168 (22%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
           L++ +E   GGD    +     +    A+FY  ++  A++ LH +G  HRD+KPEN L+D
Sbjct: 90  LWIMLEMADGGDLFDKIEPDVGVDPDVAQFYFQQLIRALNYLHDVGVAHRDIKPENILLD 149

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
            +G++KL DFGLA+                        +F  K             +  +
Sbjct: 150 KKGNLKLADFGLAS------------------------QFRRK-------------DGTL 172

Query: 369 NYASSTVGSPDYMALEVLEAKNYDFTV-DYWSLGCILFESLVGYTPFS 415
             ++   GSP YMA E+L ++ Y   + D WS G +LF  L G  P+S
Sbjct: 173 RVSTDQRGSPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWS 220

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 81.3 bits (199), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 90/223 (40%), Gaps = 57/223 (25%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           V  E ++L       +V L   ++D ++ Y+ MEF+ GGD    +     +     R   
Sbjct: 231 VSRELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREIS 290

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLI--DSRGHIKLTDFGLAAGTVSMERIESMKIRLE 338
            ++  A+  +H  G +HRDLKP+N LI  D    +K+TDFGLA                 
Sbjct: 291 RQILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAK---------------- 334

Query: 339 EVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEA---------- 388
                                     + + +   +  G+  Y+A EV+            
Sbjct: 335 -------------------------VQGNGSIMKTFCGTLAYVAPEVIGGFTGATGEEET 369

Query: 389 ----KNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLR 427
                 Y   VD WS+GC++F  L G+ PFSGS+  + YE +R
Sbjct: 370 EEERIEYSSLVDMWSMGCLVFVILTGHLPFSGSTQEQLYEQIR 412

>Scas_700.28
          Length = 896

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 95/225 (42%), Gaps = 49/225 (21%)

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++ KL       + +++A+E+ PG +    +++   +         +++   V   H L 
Sbjct: 90  YITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHSLN 149

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             HRDLK EN L+D  G  KLTDFG     ++   +E++                     
Sbjct: 150 CVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETI--------------------- 188

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTP 413
                                G+  YMA E++E K+YD F +D WSLG IL+  + G  P
Sbjct: 189 --------------------CGTTVYMAPELIERKSYDGFKIDIWSLGVILYTMINGSMP 228

Query: 414 FSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA 458
           F     +E  E    WK V + P+  N     +D   DLI+RL+A
Sbjct: 229 F-----DEDDETKTEWKIVHQTPQL-NENIVTAD-AKDLILRLLA 266

>Scas_627.7
          Length = 349

 Score = 79.0 bits (193), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 100/253 (39%), Gaps = 43/253 (16%)

Query: 175 DFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSE 234
           DFE+               R ++T  ICA                    E +I T+    
Sbjct: 90  DFEIGKKLGKGKFGKVYCVRHKETGFICALKVMDKAEIVQYNLQKQFRREVEIQTSLNHP 149

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGD-YRTLLINTRFLQAPHARFYISEMFCAVDALHQL 293
            L KL   F D   +YL ME++  G+ Y+ L  +  F     +RF + ++  A++ LH  
Sbjct: 150 NLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRF-VFQIADALNYLHDK 208

Query: 294 GYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSM 353
              HRDLKPEN LI     IKLTDFG +             I    VK            
Sbjct: 209 QIIHRDLKPENILIGFNNVIKLTDFGWSI------------INPRGVKR----------- 245

Query: 354 NDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTP 413
                              +  G+ DY++ E++ ++ YD  VD W+LG + +E +VG  P
Sbjct: 246 ------------------KTLCGTIDYLSPEMIRSREYDDKVDVWALGVLTYELIVGSPP 287

Query: 414 FSGSSTNETYENL 426
           F   +   TY+ +
Sbjct: 288 FEEDTKELTYKRI 300

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 100/236 (42%), Gaps = 60/236 (25%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           ++ L   +++ S LYL +E+V GG+    L++   L    A  Y  ++  AV   H    
Sbjct: 136 VMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIHYFKQIVQAVAYCHGFNI 195

Query: 296 THRDLKPENFLIDSRGH-IKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
            HRDLKPEN L+D +   IK+ DFG+AA   S + +E                       
Sbjct: 196 CHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLE----------------------- 232

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTP 413
                             ++ GSP Y + E++  + Y  +  D WS G ILF  L G+ P
Sbjct: 233 ------------------TSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLP 274

Query: 414 FSGSSTNETYENLRCWKQVLRRPRCDNGRYA----FSDRTWDLIIR-LIADPISRL 464
           F+  +           K++L   +  +G+Y      S    DLI R L+ DP  R+
Sbjct: 275 FNDDNV----------KKLLL--KVQSGKYQMPQWLSVEAKDLISRILVVDPNRRI 318

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 112/266 (42%), Gaps = 58/266 (21%)

Query: 228 LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINT--RFLQAPHARFYISEMFC 285
           L+  RS ++     AF    S+++ ME+  GG    LL  T    +      F +SE+  
Sbjct: 70  LSELRSPYITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLI 129

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDF 345
            +D LH     HRD+K  N L+   GH+KL DFG++                        
Sbjct: 130 GLDYLHSQRKIHRDIKSANILLTDNGHVKLGDFGVSG----------------------- 166

Query: 346 PKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLE--AKNYDFTVDYWSLGCI 403
                      + M T  R+       + VG+P +MA EV++   + Y+   D WSLG  
Sbjct: 167 -----------QMMVTRKRD-------TFVGTPFWMAPEVIDRNKQGYNEMADIWSLGIT 208

Query: 404 LFESLVGYTPFSGSSTNETYENLRCWKQVLRR--PRCDNGRYAFSDRTWDLIIR-LIADP 460
           + E L+G+ P       + Y+ ++    + +R  P+ D     FS    D + + LI DP
Sbjct: 209 VIELLMGHPPL------DKYDAMKALMAIPKRDPPKLDK---RFSSHARDFVAQCLIKDP 259

Query: 461 ISRLRSFEHVKKMKYFAEISFENLRN 486
             R  + E +K  ++   +   NLR+
Sbjct: 260 SQRPTAAELLKH-RFVKRVRLYNLRD 284

>YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine
           protein kinase with unknown role [2706 bp, 901 aa]
          Length = 901

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 94/225 (41%), Gaps = 49/225 (21%)

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++ KL       S +++A+E+ PG +    L++ R +         +++  AV   H + 
Sbjct: 93  YITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGELFAQISGAVYYAHSMH 152

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             HRDLK EN L+D  G+ KLTDFG     ++   +E++                     
Sbjct: 153 CVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETV--------------------- 191

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTP 413
                                G+  YMA E++E + YD F +D WSLG IL+  + GY P
Sbjct: 192 --------------------CGTTVYMAPELIERRTYDGFKIDIWSLGVILYTLITGYLP 231

Query: 414 FSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA 458
           F      +T      WK V   P+ D       D   DLI RL+A
Sbjct: 232 FDDDDEAKTK-----WKIVNEEPKYD--AKVIPDDARDLISRLLA 269

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 103/243 (42%), Gaps = 60/243 (24%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           ++ L   +++ S LYL +E+V GG+    L++   L    A  Y  ++   V   H    
Sbjct: 176 VMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNI 235

Query: 296 THRDLKPENFLIDSRG-HIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
            HRDLKPEN L+D +   IK+ DFG+AA                    L+ P        
Sbjct: 236 CHRDLKPENLLLDKKNRRIKIADFGMAA--------------------LELPN------- 268

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTP 413
                             ++ GSP Y + E++  + Y     D WS G +LF  L G+ P
Sbjct: 269 --------------KLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLP 314

Query: 414 FSGSSTNETYENLRCWKQVLRRPRCDNGRYA----FSDRTWDLIIR-LIADPISRLRSFE 468
           F+        +N++  K +L   +  +G+Y      S    DLI + L+ DP  R+ + E
Sbjct: 315 FND-------DNIK--KLLL---KVQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQE 362

Query: 469 HVK 471
            +K
Sbjct: 363 ILK 365

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 86/202 (42%), Gaps = 48/202 (23%)

Query: 221 VLTERDILTTTRSEWLVKLLYAF-QDPSSLYLAMEFVPGGDYRTLLINTRF-------LQ 272
           ++ E  ++  +R E +V  L A+ +    L++ ME++ GG    ++ N+         L 
Sbjct: 626 IVNEIMVMNDSRHENIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLS 685

Query: 273 APHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIES 332
            P   + + E    +  LH     HRD+K +N L+D++  +K+TDFG  A          
Sbjct: 686 EPQIAYIVRETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITDFGFCA---------- 735

Query: 333 MKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD 392
                               + D+R     +           VG+P +MA EV++ K YD
Sbjct: 736 -------------------KLTDQRSKRATM-----------VGTPYWMAPEVVKQKEYD 765

Query: 393 FTVDYWSLGCILFESLVGYTPF 414
             VD WSLG +  E L G  P+
Sbjct: 766 AKVDVWSLGIMAIEMLEGEPPY 787

>Kwal_55.21545
          Length = 865

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 99/231 (42%), Gaps = 52/231 (22%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
           L++ ME+  GG  RTLL   +  +  +    + E+  A+  +H+ G  HRD+K  N LI 
Sbjct: 91  LWVIMEYCAGGSLRTLLRPGKIGEQ-YIGVIMRELLTALMHIHKDGVIHRDIKAANVLIT 149

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
           + GHIKL DFG+AA      ++   KIR                   R+ M         
Sbjct: 150 NDGHIKLCDFGVAA------QLSQTKIR-------------------RQTM--------- 175

Query: 369 NYASSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLR 427
                  G+P +MA EV +E   YD  VD WSLG   +E   G  P+         E LR
Sbjct: 176 ------AGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYC------EVEALR 223

Query: 428 CWKQVLRR--PRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYF 476
             + + +   PR + GR   S     + + L  DP  R  S E + K K+ 
Sbjct: 224 AMQLITKSKPPRLE-GRQHSSALKEIIALCLDEDPKER-PSAEDLLKTKFI 272

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 80/182 (43%), Gaps = 44/182 (24%)

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGD-YRTLLINTRFLQAPHARFYISEMFCAVDALHQL 293
           ++ KL       + +++A+E+ PG + Y  LL  +R      A  + +++  AV   H L
Sbjct: 94  YITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELF-AQITGAVHYAHTL 152

Query: 294 GYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSM 353
              HRDLK EN L+D  G+ KLTDFG    +++   +E++                    
Sbjct: 153 NCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETV-------------------- 192

Query: 354 NDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYT 412
                                 G+  YMA E+++ K YD F VD WSLG IL+  L G  
Sbjct: 193 ---------------------CGTTVYMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCL 231

Query: 413 PF 414
           PF
Sbjct: 232 PF 233

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 98/226 (43%), Gaps = 35/226 (15%)

Query: 242 AFQDPSSLY-LAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDL 300
           AFQ+ ++ Y L  E V GG+    ++         AR  I+++  A+  +H +G  HRD+
Sbjct: 201 AFQESANYYYLVTELVTGGEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDV 260

Query: 301 KPENFLIDSRGHIKLTDFGLAAGTVSMERI--ESMKIRLEEVKNLDFPKFEEKSMNDRRE 358
           KPEN L +      +  +GL       +          +  VK +DF             
Sbjct: 261 KPENLLFE-----PIPFYGLDGDMQKEDEFTLGVGGGGIGLVKLMDFG------------ 303

Query: 359 MYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSS 418
           +   LR N    A +  G+ +Y+A EV  +K Y   VD WS+GC+LF  L GY PF    
Sbjct: 304 LAKKLRNNT---AKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVLFTLLCGYPPF---- 356

Query: 419 TNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRL 464
               YE  +  K +L+  +   G Y F    WD I     + ++ L
Sbjct: 357 ----YE--KNEKTLLK--KISRGDYEFLAPWWDNISSGAKNAVTHL 394

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 80/167 (47%), Gaps = 13/167 (7%)

Query: 253  MEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGH 312
            ME+  GG    LL + R       + Y  ++   +  LH+ G  HRD+KPEN L+D  G 
Sbjct: 1344 MEYCEGGSLAALLEHGRIEDEMVTQVYTLQLLEGLAYLHESGIVHRDVKPENILLDFNGV 1403

Query: 313  IKLTDFGLAAGTVSM-ERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYA 371
            IK  DFG A    +   R+ SM     +++N D    +   ++D + +     +N+ N  
Sbjct: 1404 IKYVDFGAAKKIANNGTRLASMN----KIENADGEHEDVTHVSDSKAV-----KNNENAL 1454

Query: 372  SSTVGSPDYMALEVLEAKNYDFTV---DYWSLGCILFESLVGYTPFS 415
               +G+P YMA E +        +   D WSLGC++ E + G  P++
Sbjct: 1455 LDMMGTPMYMAPESITGSTTKGKLGADDVWSLGCVVLEMITGRRPWA 1501

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 113/299 (37%), Gaps = 51/299 (17%)

Query: 174 KDFEMITXXXXXXXXXXXLARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRS 233
           KDFE+               R + +  ICA                 +  E DI      
Sbjct: 98  KDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKREVDIQLGMDH 157

Query: 234 EWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQL 293
             ++KL   F D   +YL ME    G+    L N        A  YI ++  A+  +H+ 
Sbjct: 158 PNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQIADALHYMHKK 217

Query: 294 GYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSM 353
              HRD+KPEN LI     +KL DFG      S+   E  K +                 
Sbjct: 218 RIIHRDVKPENVLIGFDNVVKLADFGW-----SILNPEGSKRK----------------- 255

Query: 354 NDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTP 413
                              +  G+ DY++ E++  + YD  VD W+LG + +E +VG  P
Sbjct: 256 -------------------TLCGTIDYLSPEMITPREYDEQVDVWALGVLAYELVVGVPP 296

Query: 414 FSGSSTNETYENLRCWKQVLRRPRCD-NGRYAFSDRTWDLIIRLIADPISRLRSFEHVK 471
           F  +S   TY      K++L   +CD N   + S    DLI +L+    ++  S   VK
Sbjct: 297 FEENSKELTY------KRIL---KCDLNFPESISKDAKDLISKLLVTDTTQRLSLTGVK 346

>Scas_675.2
          Length = 527

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 86/196 (43%), Gaps = 49/196 (25%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQ-LGYTHRDLKPENFLI 307
           +++ ME   GGD    +     + +  A+FY  ++  A+  LH+  G  HRD+KPEN L+
Sbjct: 91  MWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAISYLHEECGVAHRDIKPENILL 150

Query: 308 DSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLREND 367
           D  G++KL DFGL+    S  R +   +R+                 D+R          
Sbjct: 151 DKNGNLKLADFGLS----SQYRRKDGTLRIS---------------TDQR---------- 181

Query: 368 VNYASSTVGSPDYMALEVLEAKN-YDFTVDYWSLGCILFESLVGYTP----------FSG 416
                   GSP YMA E+L ++  Y  + D WS+G +LF  L G TP          F+ 
Sbjct: 182 --------GSPPYMAPEILHSRGYYAHSTDIWSIGILLFVLLTGETPWELPVIEELNFAS 233

Query: 417 SSTNETYENLRCWKQV 432
              N    NL  W ++
Sbjct: 234 FLQNNGNLNLGPWAKI 249

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 105/292 (35%), Gaps = 76/292 (26%)

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSS-----LYLAMEFVPGGDYRTLLINTRFL 271
           +T     E  IL     E +VKLL  F +P S      YL +E +  G+    ++    L
Sbjct: 196 KTRQFREETKILMGLNHENIVKLLERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKL 255

Query: 272 QAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGH------------------- 312
                R    ++   +  LH     HRD+KPEN L+  R                     
Sbjct: 256 HQDETRALFKQILAGLKYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDIT 315

Query: 313 IKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYAS 372
           +K+ DFGLA  T  M+                                         + +
Sbjct: 316 VKIADFGLAKFTGEMQ-----------------------------------------FTT 334

Query: 373 STVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQV 432
           +  G+P Y+A EVL    Y   VD WS G +L+  L G+ PFS      + +     +Q+
Sbjct: 335 TLCGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAPPSMK-----EQI 389

Query: 433 LRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEISFENL 484
           L+      G++AF    WD I   +   IS L   +  K+      I  E L
Sbjct: 390 LQ------GKFAFYSPYWDEIDDSVLHLISNLLVVDPAKRYSVRDAIGHEWL 435

>Kwal_26.7788
          Length = 1267

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 89/219 (40%), Gaps = 52/219 (23%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
           L+L +E+V GG+    L++   L    A  Y  ++       H     HRDLKPEN L+D
Sbjct: 132 LFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEGTAYCHGFNICHRDLKPENLLLD 191

Query: 309 SRG-HIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLREND 367
            +   IK+ DFG+AA   S + +E                                    
Sbjct: 192 KKNKRIKIADFGMAALQTSNKLLE------------------------------------ 215

Query: 368 VNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTPFSGSSTNETYENL 426
                ++ GSP Y + E++  KNY+    D WS G ILF  L G+ PF+  +       +
Sbjct: 216 -----TSCGSPHYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKV 270

Query: 427 RCWKQVLRRPRCDNGRYAFSDRTWDLIIR-LIADPISRL 464
           +  K  + +        + S    DLI R L+ DP  R+
Sbjct: 271 QAGKYQMPQ--------SVSSGAQDLISRILVVDPDKRI 301

>Scas_618.15
          Length = 620

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 99/252 (39%), Gaps = 42/252 (16%)

Query: 217 ETNHVLTERDIL--------TTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINT 268
           +T+HV +   +L         ++    +V  +   +  S  Y+  E++ GG+    ++  
Sbjct: 212 DTSHVSSREQVLKEACLHKVASSECSEVVGFIDFVETKSYYYIVQEYLHGGEIYDQIVRL 271

Query: 269 RFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSME 328
            +      R  I ++  AV  LH +G  HRD+KPEN L +   HI  T   L        
Sbjct: 272 TYFSEDLTRHVIRQLAHAVKHLHSMGIIHRDIKPENLLFEPIQHIPSTHVKLRKTDNPFT 331

Query: 329 RIESMKIR-------LEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYM 381
           +++    R       +  VK  DF   ++ S                   ++  G+  Y 
Sbjct: 332 KVDEGMFRPAIGGGGIGAVKLTDFGLSKQLSTET---------------TNTPCGTISYA 376

Query: 382 ALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNG 441
           A E++    YD  +D W +GC+L+  L G+ PF               K V R+ R  +G
Sbjct: 377 APELIRNHQYDNKIDLWGIGCVLYTLLCGFPPFYADQ----------HKSVTRKIR--HG 424

Query: 442 RYAFSDRTWDLI 453
            Y F    WD I
Sbjct: 425 EYHFLSPWWDEI 436

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 72/168 (42%), Gaps = 31/168 (18%)

Query: 253  MEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGH 312
            ME+  GG   +LL + R       + Y  E+   +  LHQ G  HRD+KPEN L+D  G 
Sbjct: 1112 MEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGI 1171

Query: 313  IKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKF--EEKSMNDRREMYTNLRENDVNY 370
            IK  DFG A   V          R   V+N     F  E KS+N+               
Sbjct: 1172 IKYVDFGTARTVVGS--------RTRTVRNAAVQDFGVETKSLNE--------------- 1208

Query: 371  ASSTVGSPDYMALEVLEAKNYDFTV---DYWSLGCILFESLVGYTPFS 415
                +G+P YMA E +        +   D W+LGC++ E   G  P+S
Sbjct: 1209 ---MMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWS 1253

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 103/237 (43%), Gaps = 60/237 (25%)

Query: 247 SSLYLAMEFVPGGDYRTLL----INTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKP 302
           +SL++ ME+  GG  R+LL    I+ +++        + E+  A+  +H+    HRD+K 
Sbjct: 86  TSLWIIMEYCAGGSLRSLLRPGKIDEKYI-----GVIMRELLVALKVIHKDNVIHRDIKA 140

Query: 303 ENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTN 362
            N LI + G +KL DFG+AA                        +  + S+  RR+    
Sbjct: 141 ANVLITNEGQVKLCDFGVAA------------------------QLNQTSL--RRQ---- 170

Query: 363 LRENDVNYASSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNE 421
                     +  G+P +MA EV +E   YD  VD WSLG   +E   G  P+       
Sbjct: 171 ----------TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCD----- 215

Query: 422 TYENLRCWKQVLRR--PRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYF 476
             E LR  + +++   PR +   Y    + + + + L  DP  RL S E + K K+ 
Sbjct: 216 -VEALRAMQLIIKSKPPRLEERNYTPQLKEF-IALCLDEDPQERL-SAEELLKTKFI 269

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 79/169 (46%), Gaps = 40/169 (23%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALH-QLGYTHRDLKPENFLI 307
           +++ +E   GGD    +     + +  A+FY  ++  A++ LH + G  HRD+KPEN L+
Sbjct: 91  MWIILEMADGGDLFDKIEPDVGVDSDVAQFYFQQLVSAINYLHVECGVAHRDIKPENILL 150

Query: 308 DSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLREND 367
           D  G++KL DFGLA    S  R +   +R+              SM+ R           
Sbjct: 151 DKNGNLKLADFGLA----SQFRRKDGTLRV--------------SMDQR----------- 181

Query: 368 VNYASSTVGSPDYMALEVL--EAKNYDFTVDYWSLGCILFESLVGYTPF 414
                   GSP YMA EVL  E   Y    D WS+G +LF  L G TP+
Sbjct: 182 --------GSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPW 222

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 87/204 (42%), Gaps = 43/204 (21%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           +VKL    Q+   + + +E+  GG++   +   R L+  HA    S++  AV  +H  G 
Sbjct: 129 IVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQRKRRLKENHACRLFSQLISAVHYIHSKGL 188

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMND 355
            HRDLK EN L+D+  ++ +TDFG                        +F          
Sbjct: 189 VHRDLKLENLLLDNEENLIITDFGFVN---------------------EF---------- 217

Query: 356 RREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYTP 413
                  LR+N +    ++ GSP Y A E V+  + YD    D WS G ILF  L GY P
Sbjct: 218 -------LRQNGM--MKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLP 268

Query: 414 FSGSSTNETYENL-RCWKQVLRRP 436
           +     N    ++ R +  +L  P
Sbjct: 269 WDDDPKNPDGHDISRLYNYILNTP 292

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 81/191 (42%), Gaps = 37/191 (19%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEM 283
           E +IL     E +V    + Q+  +L + +E+VPGG   ++L N      P  + +  ++
Sbjct: 518 EMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNNYGPFDEPLVKNFTRQI 577

Query: 284 FCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNL 343
              +  LH+    HRD+K  N LID +G +K+TDFG++     + + ++ +  L+     
Sbjct: 578 LIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGISKKLSPLNKQQNKRASLQ----- 632

Query: 344 DFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCI 403
                                           GS  +MA EV++        D WS+GC+
Sbjct: 633 --------------------------------GSVYWMAPEVVKQVVTTEKADIWSVGCV 660

Query: 404 LFESLVGYTPF 414
           + E   G  PF
Sbjct: 661 IVEMFTGKHPF 671

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 101/265 (38%), Gaps = 76/265 (28%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSL-----YLAMEFVPGGDYRTLLINTRFLQAPHARF 278
           E +IL   +   +V LL +F +P S      YL +E +  G+    ++    L+   ++ 
Sbjct: 248 ETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKA 307

Query: 279 YISEMFCAVDALHQLGYTHRDLKPENFLIDSRG-------------------HIKLTDFG 319
              ++   +  LH+    HRD+KPEN L++                       +K+ DFG
Sbjct: 308 LFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFG 367

Query: 320 LAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPD 379
           LA  T  M+                                         + ++  G+P 
Sbjct: 368 LAKFTGEMQ-----------------------------------------FTNTLCGTPS 386

Query: 380 YMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCD 439
           Y+A EVL  K Y   VD WS G IL+  L G+ PFS      + +     +Q+L+     
Sbjct: 387 YVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLK-----EQILQ----- 436

Query: 440 NGRYAFSDRTWDLIIRLIADPISRL 464
             +YAF    WD I   +   IS L
Sbjct: 437 -AKYAFYSPYWDKIDDSVLHLISNL 460

>Scas_477.5
          Length = 703

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 80/191 (41%), Gaps = 38/191 (19%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEM 283
           E ++L     E +V    + Q+  +L + +E+VPGG   ++L N    +      +I ++
Sbjct: 491 EMNLLKELHHENIVTYYGSSQEGPNLNIFLEYVPGGSVSSMLNNYGPFEESLIVNFIRQV 550

Query: 284 FCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNL 343
              V  LH     HRD+K  N LID++G +K+TDFG++                      
Sbjct: 551 LIGVAYLHNKNIIHRDIKGANILIDTKGCVKITDFGISK--------------------- 589

Query: 344 DFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCI 403
              K    S  D+R              +S  GS  +MA EV++        D WS GC+
Sbjct: 590 ---KLSPLSKQDKR--------------ASLQGSVYWMAPEVVKQTATTEKADIWSTGCV 632

Query: 404 LFESLVGYTPF 414
           + E   G  PF
Sbjct: 633 VIEMFTGKHPF 643

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 86/202 (42%), Gaps = 48/202 (23%)

Query: 221 VLTERDILTTTRSEWLVKLLYAF-QDPSSLYLAMEFVPGGDYRTLLINTRF-------LQ 272
           ++ E  ++  +R + +V  L A+ +    L++ MEF+ GG    ++ N+         L 
Sbjct: 607 IVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLT 666

Query: 273 APHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIES 332
            P   + + E    +  LH     HRD+K +N L+D+R  +K+TDFG  A          
Sbjct: 667 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCA---------- 716

Query: 333 MKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD 392
                               + D+R     +           VG+P +MA EV++ + YD
Sbjct: 717 -------------------RLTDKRSKRATM-----------VGTPYWMAPEVVKQREYD 746

Query: 393 FTVDYWSLGCILFESLVGYTPF 414
             +D WSLG +  E L G  P+
Sbjct: 747 EKIDVWSLGIMTIEMLEGEPPY 768

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 102/253 (40%), Gaps = 62/253 (24%)

Query: 224 ERDI--LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYIS 281
           ER+I  L   R   ++KL    +    + + +E+  G +    ++    +    AR +  
Sbjct: 85  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQ 143

Query: 282 EMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVK 341
           ++  AV+  H+    HRDLKPEN L+D   ++K+ DFGL                     
Sbjct: 144 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL--------------------- 182

Query: 342 NLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDF-TVDYWSL 400
                              +N+   D N+  ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 183 -------------------SNIM-TDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 222

Query: 401 GCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYA----FSDRTWDLIIR- 455
           G IL+  L    PF   S    ++N+             NG Y      S    DLI R 
Sbjct: 223 GVILYVMLCRRLPFDDESIPVLFKNI------------SNGVYTLPKFLSPGASDLIKRM 270

Query: 456 LIADPISRLRSFE 468
           LI +P++R+   E
Sbjct: 271 LIVNPLNRISIHE 283

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 96/225 (42%), Gaps = 51/225 (22%)

Query: 235 WLVKLLYAFQDPSSLYLAMEFVPGGD-YRTLLINTRFLQAPHARFYISEMFCAVDALHQL 293
           ++ KL       + +++A+E+ PG + Y  LL+  R +     R   +++  AV   H L
Sbjct: 89  FITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQR-IPLDETRRLFAQIVSAVFYAHSL 147

Query: 294 GYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSM 353
              HRDLK EN L+D  G+  LTDFG         R  + K +LE V             
Sbjct: 148 QCVHRDLKLENILLDKNGYAMLTDFGFT-------RECATKTQLETV------------- 187

Query: 354 NDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYT 412
                                 G+  YMA E+++ + YD + VD WSLG IL+  L GY 
Sbjct: 188 ---------------------CGTTVYMAPELIKREAYDGYKVDTWSLGIILYTMLHGYM 226

Query: 413 PFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLI 457
           PF    T      +R   +++         Y  S +  DLI+RL+
Sbjct: 227 PFDEDDT------VRTGLKIMHEEPAVLDEYT-SPQAKDLIVRLL 264

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 103/232 (44%), Gaps = 59/232 (25%)

Query: 247 SSLYLAMEFVPGGDYRTLL----INTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKP 302
           +SL++ ME   GG  R+LL    I+ +++        + E+  A+  +H+    HRD+K 
Sbjct: 93  TSLWIIMEHCAGGSLRSLLRPGKIDEKYIG-----VIMRELLVALKCIHKDNVIHRDIKA 147

Query: 303 ENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTN 362
            N LI + G++KL DFG+AA      ++    +R                   R+ M   
Sbjct: 148 ANVLITNEGNVKLCDFGVAA------QVNQTSLR-------------------RQTM--- 179

Query: 363 LRENDVNYASSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNE 421
                        G+P +MA EV +E   YD  VD WSLG   +E   G  P+       
Sbjct: 180 ------------AGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYC------ 221

Query: 422 TYENLRCWKQVLRR--PRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVK 471
             E LR  + +++   PR ++  Y+ S + + + + L  DP  RL + + +K
Sbjct: 222 DVEALRAMQLIIKSKPPRLEDRSYSTSLKEF-IALCLDEDPKERLSADDLLK 272

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 70/165 (42%), Gaps = 30/165 (18%)

Query: 253  MEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGH 312
            MEF  G    +LL + R       + Y  ++   +  LHQ G  HRD+KPEN L+D  G 
Sbjct: 1337 MEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRDIKPENILLDRNGV 1396

Query: 313  IKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYAS 372
            IK  DFG A                         K   K+ + R  +  N   N      
Sbjct: 1397 IKYVDFGAA-------------------------KLIAKNGSKRISLDAN---NKSTGGK 1428

Query: 373  STVGSPDYMALEVLEAKNYD--FTVDYWSLGCILFESLVGYTPFS 415
              +G+P YMA E +  + +    + D WSLGC++ E + G  P++
Sbjct: 1429 DMIGTPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWA 1473

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 75/176 (42%), Gaps = 34/176 (19%)

Query: 242 AFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLK 301
           ++QD  ++YL  E +     R +     FL   H +++  ++  A+ +LH     HRDLK
Sbjct: 83  SYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALKSLHSAQVIHRDLK 142

Query: 302 PENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYT 361
           P N L++S   +KL DFGL+    S +R                                
Sbjct: 143 PSNLLLNSSCDLKLCDFGLSRCLASSDRS------------------------------- 171

Query: 362 NLRENDVNYASSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSG 416
             REN V + +  V +  Y A E+ L  + Y   +D WS GCIL E + G   F G
Sbjct: 172 --RENMVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMISGKPLFPG 225

>Scas_660.28
          Length = 623

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 109/261 (41%), Gaps = 63/261 (24%)

Query: 224 ERDI--LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYIS 281
           ER+I  L   R   ++KL    +    + + ME+  G +    ++    +    AR +  
Sbjct: 92  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQ 150

Query: 282 EMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVK 341
           ++  AV+  H+    HRDLKPEN L+D   ++K+ DFGL                     
Sbjct: 151 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL--------------------- 189

Query: 342 NLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFT-VDYWSL 400
                              +N+   D N+  ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 190 -------------------SNIM-TDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 229

Query: 401 GCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYA---FSDRTWDLIIR-- 455
           G IL+  L    PF   S    ++N+            +NG Y    F  +    +I+  
Sbjct: 230 GVILYVMLCRRLPFDDESIPVLFKNI------------NNGVYTIPKFLSQGASTLIKKM 277

Query: 456 LIADPISRLRSFEHVKKMKYF 476
           LI +P++R+ S + + + ++F
Sbjct: 278 LIVNPLNRI-SIQEIMQDEWF 297

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 82/194 (42%), Gaps = 41/194 (21%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           +L E  ++  ++   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 662 ILNEILVMRESKHSNIVNFIDSYLAKGDLWIVMEYMEGGSL-TDVVTHCLLSEGQIGAVC 720

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
            E    +  LH  G  HRD+K +N L+  +G+IKLTDFG  A                  
Sbjct: 721 RETLKGLQFLHSKGVLHRDIKSDNILLSLKGNIKLTDFGFCA------------------ 762

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSL 400
                                 + EN++   ++ VG+P +MA EV+  K Y   VD WSL
Sbjct: 763 ---------------------QINENNLKR-TTMVGTPYWMAPEVVSRKEYGPKVDIWSL 800

Query: 401 GCILFESLVGYTPF 414
           G ++ E + G  P+
Sbjct: 801 GIMIIEMIEGEPPY 814

>Kwal_23.5290
          Length = 819

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 86/202 (42%), Gaps = 48/202 (23%)

Query: 221 VLTERDILTTTRSEWLVKLLYAF-QDPSSLYLAMEFVPGGDYRTLLINTRF-------LQ 272
           ++ E  ++  ++ + +V  L A+ +    L++ ME++ GG    L+ N+         L 
Sbjct: 584 IVNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLT 643

Query: 273 APHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIES 332
            P   + + E    +  LH     HRD+K +N L+D+R  +K+TDFG  A          
Sbjct: 644 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNRARVKITDFGFCA---------- 693

Query: 333 MKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD 392
                               + D+R     +           VG+P +MA EV++ + YD
Sbjct: 694 -------------------KLTDKRSKRATM-----------VGTPYWMAPEVVKQREYD 723

Query: 393 FTVDYWSLGCILFESLVGYTPF 414
             VD WSLG +  E L G  P+
Sbjct: 724 EKVDVWSLGIMTIEMLEGEPPY 745

>Kwal_55.20326
          Length = 750

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 82/191 (42%), Gaps = 37/191 (19%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEM 283
           E  +L   + E +V    + Q+  +L + +E+VPGG   ++L +    + P  R +  ++
Sbjct: 537 EMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLIRNFTRQI 596

Query: 284 FCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNL 343
              +  LH+    HRD+K  N LID +G +K+TDFG++     + + ++ +  L+     
Sbjct: 597 LIGLSYLHRKDIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQQQNKRASLQ----- 651

Query: 344 DFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCI 403
                                           GS  +MA EV++        D WS+GC+
Sbjct: 652 --------------------------------GSVYWMAPEVVKQVVTTKKADIWSVGCV 679

Query: 404 LFESLVGYTPF 414
           + E   G  PF
Sbjct: 680 IIEMFTGKHPF 690

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 86/222 (38%), Gaps = 47/222 (21%)

Query: 193 ARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLA 252
           A KR T + CA             E N  + E D+L   R + +V+     Q    LY+ 
Sbjct: 27  AVKRGTNKPCAIKQIEFEDES---ELNEHMLEIDLLKNLRHQNIVEYRGFIQKAHELYII 83

Query: 253 MEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGH 312
           +E+   G  R +L +   L+      Y+++    +  LH+ G  HRD+K  N L+   G 
Sbjct: 84  LEYCARGSLRDILKHGPLLEDDTVN-YVTQTLYGLQYLHEQGVIHRDIKAANLLLTEEGI 142

Query: 313 IKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYAS 372
           +KL DFG++       RI  M                                     A 
Sbjct: 143 VKLADFGVST------RINRM-------------------------------------AM 159

Query: 373 STVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
           +  GSP++MA EV+  +      D WSLG  + E L G  PF
Sbjct: 160 TYAGSPNWMAPEVMTGQGASTVSDIWSLGATVVELLTGNPPF 201

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 85/202 (42%), Gaps = 48/202 (23%)

Query: 221 VLTERDILTTTRSEWLVKLLYAF-QDPSSLYLAMEFVPGGDYRTLLINTRF-------LQ 272
           ++ E  ++  ++   +V  L A+ +    L++ ME++ GG    ++ N+         L 
Sbjct: 644 IVNEILVMKDSKHNNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLT 703

Query: 273 APHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIES 332
            P   + + E    +  LH     HRD+K +N L+D+RG +K+TDFG  A          
Sbjct: 704 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRGRVKITDFGFCA---------- 753

Query: 333 MKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD 392
                               + D+R     +           VG+P +MA EV++ + YD
Sbjct: 754 -------------------KLTDKRSKRATM-----------VGTPYWMAPEVVKQREYD 783

Query: 393 FTVDYWSLGCILFESLVGYTPF 414
             VD WSLG +  E L    P+
Sbjct: 784 EKVDVWSLGIMTIEMLESEPPY 805

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 72/165 (43%), Gaps = 33/165 (20%)

Query: 253  MEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGH 312
            ME+  GG   +LL + R       + Y  +M   +  LH+ G  HRD+KPEN L+D  G 
Sbjct: 1269 MEYCEGGSLASLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRDIKPENILLDFNGI 1328

Query: 313  IKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYAS 372
            IK  DFG A    S     S K+ LE+         E + M                   
Sbjct: 1329 IKYVDFGAAKVLASN---GSKKLNLEQ-------HMEGEKM------------------- 1359

Query: 373  STVGSPDYMALEVLEAKNYD--FTVDYWSLGCILFESLVGYTPFS 415
              +G+P YM+ E +    Y    + D WSLGC++ E + G  P++
Sbjct: 1360 --IGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWA 1402

>Kwal_26.8751
          Length = 848

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 71/167 (42%), Gaps = 42/167 (25%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
           +++A+E+ PG +    L+  + +         S++  AV   H +   HRDLK EN L+D
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENILLD 162

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
            +GH KLTDFG      +   +E++                                   
Sbjct: 163 KKGHAKLTDFGFTRECATKGILETI----------------------------------- 187

Query: 369 NYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTPF 414
                  G+  YMA E++E K Y+ + +D WSLG IL+  + G  PF
Sbjct: 188 ------CGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPF 228

>YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine
           protein kinase with similarity to Ste20p and Cla4p [1968
           bp, 655 aa]
          Length = 655

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 88/204 (43%), Gaps = 50/204 (24%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQ-DPSSLYLAMEFVPGGDYRTLL-----INTRFLQAP 274
           ++ E  ++  +R E +V  L A+  D   L++ ME++ GG    +L      NT    +P
Sbjct: 419 IMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSP 478

Query: 275 ----HARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERI 330
                  + + E    +  LH     HRD+K +N L++S+G +K+TDFG           
Sbjct: 479 LNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCV-------- 530

Query: 331 ESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN 390
                                 + ++R           +  ++ VG+P +MA E++  K 
Sbjct: 531 ---------------------ELTEKR-----------SKRATMVGTPYWMAPEIVNQKG 558

Query: 391 YDFTVDYWSLGCILFESLVGYTPF 414
           YD  VD WSLG +L E + G  P+
Sbjct: 559 YDEKVDVWSLGIMLIEMIEGEPPY 582

>Scas_580.6
          Length = 1015

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 103/237 (43%), Gaps = 60/237 (25%)

Query: 247 SSLYLAMEFVPGGDYRTLL----INTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKP 302
           +SL++ ME+  GG  R+LL    I+ +++        + E+  A+  +H+    HRD+K 
Sbjct: 107 TSLWIIMEYCAGGSLRSLLRPGKIDEKYIG-----VIMRELLVALKYIHKDNVIHRDIKA 161

Query: 303 ENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTN 362
            N LI + G +KL DFG+AA                        +  + ++  RR+    
Sbjct: 162 ANVLITNEGSVKLCDFGVAA------------------------QLNQSTL--RRQ---- 191

Query: 363 LRENDVNYASSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNE 421
                     +  G+P +MA EV +E   YD  VD WSLG   +E   G  P+       
Sbjct: 192 ----------TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYC------ 235

Query: 422 TYENLRCWKQVLRR--PRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYF 476
             E LR  + + +   PR ++  Y    + + + + L  DP  RL S E + K K+ 
Sbjct: 236 EVEALRAMQLITKSKPPRLESRSYTPLLKEF-IALCLDEDPKERL-SAEELSKTKFI 290

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 82/192 (42%), Gaps = 37/192 (19%)

Query: 223 TERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISE 282
           T+ ++L     E +V    + Q+  +L + +E+VPGG   ++L +    + P  + +  +
Sbjct: 486 TKMNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLVKNFTRQ 545

Query: 283 MFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKN 342
               +  LH+    HRD+K  N LID +G +K+TDFG++     + + ++ +  L+    
Sbjct: 546 TLVGLTYLHRKNIIHRDIKGANLLIDIKGSVKITDFGISKKLSPLNKKQNKRASLQ---- 601

Query: 343 LDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGC 402
                                            GS  +MA EV++        D WS+GC
Sbjct: 602 ---------------------------------GSVYWMAPEVVKQVVTTEKADIWSVGC 628

Query: 403 ILFESLVGYTPF 414
           ++ E   G  PF
Sbjct: 629 VVVEMFTGKHPF 640

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 88/202 (43%), Gaps = 42/202 (20%)

Query: 225 RDILTTTRSEW---LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYIS 281
           R+++  TR      +V++L        L++AME   GGD    +     + +  ARFY  
Sbjct: 64  REVVLQTRCAGHRHVVRVLDCNVSREYLWIAMELADGGDLFDKIEPDVGVDSEVARFYYQ 123

Query: 282 EMFCAVDALHQ-LGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
           ++  A+  LH+  G  HRD+KPEN L+D  G++K+ DFGLA      +    +       
Sbjct: 124 QLVRALTHLHEACGVAHRDIKPENMLLDRAGNLKVADFGLATRFRRRDGTRRLA------ 177

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDF-TVDYWS 399
                         DRR                  G+  Y+A EV+  + Y   T D WS
Sbjct: 178 -------------RDRR------------------GTLPYLAPEVVGERAYHADTADIWS 206

Query: 400 LGCILFESLVGYTPFSGSSTNE 421
            G ++F  L G TP+S  S ++
Sbjct: 207 AGVLVFVLLTGETPWSEPSVDD 228

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 80/182 (43%), Gaps = 42/182 (23%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQ-LGYTHRDLKPENFLI 307
           L++AME   GGD    +     + +  A+FY  ++  A+  LH   G  HRD+KPEN L+
Sbjct: 91  LWIAMELAEGGDLFDKIEPDIGVDSEVAQFYYKQLIKAISYLHDTCGVAHRDIKPENILL 150

Query: 308 DSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLREND 367
           D  G++KL DFGLA+                         F+ K  + R           
Sbjct: 151 DKDGNLKLADFGLAS------------------------LFKRKDGSKR----------- 175

Query: 368 VNYASSTVGSPDYMALEVLEAKNY--DFTVDYWSLGCILFESLVGYTPFS-GSSTNETYE 424
              +    GS  YMA E++    Y  D T D WS+G +LF  L G TP+      +ET+ 
Sbjct: 176 --ISRDQRGSLPYMAPEIIYCDGYYADMT-DIWSIGVLLFVLLTGETPWELPHEDDETFR 232

Query: 425 NL 426
           N 
Sbjct: 233 NF 234

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 81/191 (42%), Gaps = 36/191 (18%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEM 283
           E  +L   + E +V    + Q+  +L + +E+VPGG   ++L N    + P    +  ++
Sbjct: 462 EMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYGPFEEPLIVNFTRQI 521

Query: 284 FCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNL 343
              V  LH+    HRD+K  N LID +G +K+TDFG++                      
Sbjct: 522 LIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGIS---------------------- 559

Query: 344 DFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCI 403
                         +  + L + + +  +S  GS  +M+ EV++        D WS GC+
Sbjct: 560 --------------KKLSPLNQENQDKRTSLQGSVYWMSPEVVKQTATTSKADIWSTGCV 605

Query: 404 LFESLVGYTPF 414
           + E   G  P+
Sbjct: 606 VIEMFTGKHPY 616

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 101/253 (39%), Gaps = 62/253 (24%)

Query: 224 ERDI--LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYIS 281
           ER+I  L   R   ++KL    +    + + +E+  G +    ++    +    AR +  
Sbjct: 81  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQ 139

Query: 282 EMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVK 341
           ++  AVD  H+    HRDLKPEN L+D   ++K+ DFGL                     
Sbjct: 140 QIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL--------------------- 178

Query: 342 NLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFT-VDYWSL 400
                              +N+   D N+  ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 179 -------------------SNIM-TDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSS 218

Query: 401 GCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYA----FSDRTWDLIIR- 455
           G IL+  L    PF   S    ++N+             NG Y      S     LI + 
Sbjct: 219 GVILYVMLCRRLPFDDESIPVLFKNI------------SNGVYTIPNFLSQGAASLIKKM 266

Query: 456 LIADPISRLRSFE 468
           LI +P++R+   E
Sbjct: 267 LIVNPVNRITVHE 279

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 101/285 (35%), Gaps = 76/285 (26%)

Query: 193 ARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSL--- 249
           A+ + T E  A             +      E  IL       +V LL +F +P S    
Sbjct: 210 AKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHPNIVNLLDSFVEPISKTQI 269

Query: 250 --YLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLI 307
             YL +E +  G+    ++    L    ++    ++   +  LH     HRD+KPEN L+
Sbjct: 270 QKYLVLEKIDDGELFDRIVKKTSLPQEESKAIFKQILTGLKYLHSQNIIHRDIKPENILL 329

Query: 308 DSRG-------------------HIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKF 348
           + R                     +K+ DFGLA  T  M+                    
Sbjct: 330 NIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFTGEMQ-------------------- 369

Query: 349 EEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESL 408
                                + ++  G+P Y+A EVL  K Y   VD WS G IL+  L
Sbjct: 370 ---------------------FTNTLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCL 408

Query: 409 VGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLI 453
            G+ PFS      + +     +Q++      + +YAF    WD I
Sbjct: 409 CGFPPFSDQLGPPSLK-----EQIM------SAKYAFYSPYWDEI 442

>CAGL0L07810g complement(857656..859446) similar to sp|P25333
           Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, start by
           similarity
          Length = 596

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 93/224 (41%), Gaps = 48/224 (21%)

Query: 236 LVKLLYAFQDPSSLYL-AMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           +V  L  FQD +  Y   ME+  GGD  TL+I    L+   A  +  ++   V  +H +G
Sbjct: 360 IVDTLDLFQDANGDYCEVMEYCAGGDLFTLIIAAGKLEYMEADCFFKQLLRGVVYMHDMG 419

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             HRDLKPEN ++   G +K+TDFG +         E  K+  EE               
Sbjct: 420 VCHRDLKPENLILTHDGVLKITDFGNS---------ECFKMAWEE--------------- 455

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTP 413
                       D++ +    GS  Y+A E    + +D   VD W+ G I      G   
Sbjct: 456 ------------DIHLSGGVCGSSPYIAPEEYVLEEFDPRPVDIWACGVIYMAMRTGRQL 503

Query: 414 FSGSSTNETYEN--LRCWKQ--------VLRRPRCDNGRYAFSD 447
           ++ +  ++ + N  L+  +Q         L+R RC N  Y+  D
Sbjct: 504 WTAAKKDDPFYNKYLQGRRQKSGYEPIESLKRARCRNVIYSMLD 547

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 79/191 (41%), Gaps = 37/191 (19%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEM 283
           E ++L     E +V    A Q+  +L + +E+VPGG   ++L N    +      +  ++
Sbjct: 504 EMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQI 563

Query: 284 FCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNL 343
              V  LH+    HRD+K  N LID +G +K+TDFG++     + + ++ +  L+     
Sbjct: 564 LIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQ----- 618

Query: 344 DFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCI 403
                                           GS  +M+ EV++        D WS GC+
Sbjct: 619 --------------------------------GSVFWMSPEVVKQTATTAKADIWSTGCV 646

Query: 404 LFESLVGYTPF 414
           + E   G  PF
Sbjct: 647 VIEMFTGKHPF 657

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 103/253 (40%), Gaps = 62/253 (24%)

Query: 224 ERDI--LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYIS 281
           ER+I  L   R   ++KL    +    + + +E+  G +    ++    +    AR +  
Sbjct: 85  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQ 143

Query: 282 EMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVK 341
           ++  AV+  H+    HRDLKPEN L+D   ++K+ DFGL                     
Sbjct: 144 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL--------------------- 182

Query: 342 NLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFT-VDYWSL 400
                              +N+   D N+  ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 183 -------------------SNIM-TDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSS 222

Query: 401 GCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYA----FSDRTWDLIIR- 455
           G IL+  L    PF   S    ++N+             NG Y+     S    +LI R 
Sbjct: 223 GVILYVMLCRRLPFDDESIPVLFKNI------------SNGVYSIPKFLSQGAANLIKRM 270

Query: 456 LIADPISRLRSFE 468
           LI +P++R+   E
Sbjct: 271 LIVNPLNRITIHE 283

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 79/194 (40%), Gaps = 43/194 (22%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           +++E D+L       +VK     Q   +LY+ +E+   G  + L+   R +    A+ Y+
Sbjct: 64  IMSEIDLLKNLNHINIVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYV 123

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
            +    ++ LH+ G  HRD+K  N L+DS   +KL DFG+           S K+     
Sbjct: 124 RQTLNGLNYLHEQGVIHRDIKAANILLDSENVVKLADFGV-----------STKVN---- 168

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSL 400
                                       N A +  GS ++MA E++  +      D WSL
Sbjct: 169 ----------------------------NTAMTLAGSLNWMAPEIIGNRGASTLSDIWSL 200

Query: 401 GCILFESLVGYTPF 414
           G  + E L G  PF
Sbjct: 201 GATVVELLTGNPPF 214

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 83/199 (41%), Gaps = 50/199 (25%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
           L++ ME+  GG  RTLL     ++  +    + E+  A+ ++H+    HRD+K  N LI 
Sbjct: 88  LWVIMEYCAGGSLRTLL-RPGIIEEKYIGVIMREILVALISIHRDNVIHRDIKAANILIA 146

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
           + G +KL DFG+AA                            +SM  R+ M         
Sbjct: 147 NNGSVKLCDFGVAAQL-------------------------SQSMLKRQTM--------- 172

Query: 369 NYASSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLR 427
                  G+P +MA EV +E   YD  VD WSLG   +E   G  P+         E +R
Sbjct: 173 ------AGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCH------MEAIR 220

Query: 428 CWKQVLRR--PRCDNGRYA 444
             + + +   PR +   Y+
Sbjct: 221 AMQMITKSKPPRLEGREYS 239

>Scas_668.22
          Length = 893

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 80/195 (41%), Gaps = 43/195 (22%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           ++ E  ++  +R   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 653 IINEILVMKGSRHPNIVNFIDSYLLDGDLWVIMEYMEGGSL-TDVVTHCILTEGQIGAVC 711

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
            E    +  LH  G  HRD+K +N L+   G IKLTDFG  A                  
Sbjct: 712 RETLSGLQFLHSKGVLHRDIKSDNILLSISGDIKLTDFGFCA------------------ 753

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASST-VGSPDYMALEVLEAKNYDFTVDYWS 399
                                  + N++N   +T VG+P +MA EV+  K Y   VD WS
Sbjct: 754 -----------------------QINEINLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWS 790

Query: 400 LGCILFESLVGYTPF 414
           LG ++ E + G  P+
Sbjct: 791 LGIMIIEMIEGEPPY 805

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 101/253 (39%), Gaps = 62/253 (24%)

Query: 224 ERDI--LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYIS 281
           ER+I  L   R   ++KL    +    + + +E+  G +    ++    +    AR +  
Sbjct: 101 EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ 159

Query: 282 EMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVK 341
           ++  AV+  H+    HRDLKPEN L+D   ++K+ DFGL                     
Sbjct: 160 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL--------------------- 198

Query: 342 NLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFT-VDYWSL 400
                              +N+   D N+  ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 199 -------------------SNIM-TDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 238

Query: 401 GCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYA----FSDRTWDLIIR- 455
           G IL+  L    PF   S    ++N+             NG Y      S     LI R 
Sbjct: 239 GVILYVMLCRRLPFDDESIPVLFKNI------------SNGVYTLPKFLSPGAAGLIKRM 286

Query: 456 LIADPISRLRSFE 468
           LI +P++R+   E
Sbjct: 287 LIVNPLNRISIHE 299

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 105/296 (35%), Gaps = 76/296 (25%)

Query: 193 ARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSS---- 248
           AR ++T E  A              T     E  IL + +   +VKL+  F +P S    
Sbjct: 118 ARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILLSIQHPNIVKLIDRFVEPVSKTQI 177

Query: 249 -LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLI 307
             YL +E +  G+    ++    L+    +    ++   +  LH     HRD+KPEN L+
Sbjct: 178 QTYLVLEKINDGELFERIVRKNNLREDETKALFRQLLNGLKYLHSRNIIHRDIKPENILL 237

Query: 308 DSRG-------------------HIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKF 348
                                   +K+ DFGLA  T  M+                    
Sbjct: 238 SISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFTGEMK-------------------- 277

Query: 349 EEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESL 408
                                + ++  G+P Y+A EVL    Y   VD WS G +L+  L
Sbjct: 278 ---------------------FTNTLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCL 316

Query: 409 VGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRL 464
            G+ PFS     E        +Q+L+      G++AF    WD I   +   IS L
Sbjct: 317 CGFPPFS-----EQLAPPSMKEQILQ------GKFAFYSPYWDNIDDSVLHLISNL 361

>Scas_720.94
          Length = 1683

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 73/167 (43%), Gaps = 18/167 (10%)

Query: 253  MEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGH 312
            ME+  GG   +LL + R       + Y  E+   +  LHQ G  HRD+KPEN L+D  G 
Sbjct: 1439 MEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAGVVHRDIKPENILLDFNGI 1498

Query: 313  IKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYAS 372
            IK  DFG A       +I     ++  + +        KS  D  E      E   N   
Sbjct: 1499 IKYVDFGAA------RKIAKNGTKVTNINS--------KSK-DDDEPDEKDTEGGANSVH 1543

Query: 373  STVGSPDYMALEVLEA---KNYDFTVDYWSLGCILFESLVGYTPFSG 416
              +G+P YMA E +     K    + D WS GC++ E + G  P++ 
Sbjct: 1544 DMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWAN 1590

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 86/202 (42%), Gaps = 48/202 (23%)

Query: 221 VLTERDILTTTRSEWLVKLLYAF-QDPSSLYLAMEFVPGGDYRTLLINT-------RFLQ 272
           ++ E  ++  ++ + +V  L A+ +    L++ ME++ GG    ++ N+         + 
Sbjct: 558 IVNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMT 617

Query: 273 APHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIES 332
            P   + + E    +  LH     HRD+K +N L+D+ G +K+TDFG  A          
Sbjct: 618 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTHGRVKITDFGFCA---------- 667

Query: 333 MKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD 392
                               + D+R     +           VG+P +MA EV++ + YD
Sbjct: 668 -------------------KLTDKRSKRATM-----------VGTPYWMAPEVVKQREYD 697

Query: 393 FTVDYWSLGCILFESLVGYTPF 414
             VD WSLG +  E L G  P+
Sbjct: 698 EKVDVWSLGIMTIEMLEGEPPY 719

>Kwal_23.3590
          Length = 499

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 103/285 (36%), Gaps = 76/285 (26%)

Query: 193 ARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSS---- 248
           A  +D+ ++ A             +T     E  IL + + + +VKL+  F +P S    
Sbjct: 203 AIDKDSGDVVAVKIFHAQHNDDQKKTKQFREETKILMSIQHKNIVKLIDRFVEPVSKAQI 262

Query: 249 -LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLI 307
             +L +E V  G+    ++    L+         ++   +  LH     HRD+KPEN L+
Sbjct: 263 QTFLVLEKVSDGELFDRIVRKTRLREDETNAIFKQILNGLRYLHAKNIIHRDIKPENILL 322

Query: 308 DSRGH-------------------IKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKF 348
             R                     IK+ DFGLA     M+                    
Sbjct: 323 SIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKFIGEMQ-------------------- 362

Query: 349 EEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESL 408
                                + ++  G+P Y+A EVL    Y   VD WS G +L+  L
Sbjct: 363 ---------------------FTNTLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCL 401

Query: 409 VGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLI 453
            G+ PFS      + +     +Q+L      NG++AF    WD I
Sbjct: 402 CGFPPFSEQLAPPSMK-----EQIL------NGKFAFYSPYWDDI 435

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 93/223 (41%), Gaps = 44/223 (19%)

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSS--LYLAMEFV--------PGGDYRTLLI 266
           E   V  E +++     E +V+L     DP S  +YL +E+         P        +
Sbjct: 97  ENPRVNQEIEVMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAV 156

Query: 267 NTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVS 326
               L    +R  + ++   ++ LH  G THRD+KP N LI S G +K++DFG+A  T +
Sbjct: 157 GPSILTFQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTAT 216

Query: 327 MERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVL 386
                          + +     E+ +  R                  +G+P + A E+ 
Sbjct: 217 --------------GSTNIQSSHEQLLKSR-----------------ALGTPAFFAPELC 245

Query: 387 EA-KNYDFT--VDYWSLGCILFESLVGYTPFSGSSTNETYENL 426
              K Y  +  +D WSLG  ++  L G  PF+ +S  E ++++
Sbjct: 246 STEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNANSGLELFDSI 288

>Scas_628.9
          Length = 621

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 73/177 (41%), Gaps = 38/177 (21%)

Query: 236 LVKLLYAFQDPSSLYL-AMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           +V  L  FQD    Y   ME+  GGD  +L+++   L+   A  +  ++   V  +H +G
Sbjct: 400 IVTTLDLFQDAKGEYCEVMEYCSGGDLFSLIVSAGKLEYAEADCFFKQLMRGVVYMHDMG 459

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
            +HRDLKPEN L+ S G +K+TDFG                                   
Sbjct: 460 VSHRDLKPENLLLTSDGVLKITDFG----------------------------------- 484

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDF-TVDYWSLGCILFESLVG 410
              E +    E+D++ +    GS  Y+A E    + +D   VD W+ G I      G
Sbjct: 485 -NSECFKMAWEDDIHLSGGVCGSSPYIAPEEYIKEEFDPRCVDIWACGVIYMAMRTG 540

>Scas_598.6
          Length = 790

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 84/202 (41%), Gaps = 48/202 (23%)

Query: 221 VLTERDILTTTRSEWLVKLLYAF-QDPSSLYLAMEFVPGGDYRTLLINTRF-------LQ 272
           ++ E  ++  +R + +V  L A+ +    L++ MEF+ GG    ++ N+         L 
Sbjct: 555 IVNEILVMKDSRHKNIVNFLEAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLT 614

Query: 273 APHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIES 332
            P   + + E    +  LH     HRD+K +N L+D+   +K+TDFG  A          
Sbjct: 615 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNNARVKITDFGFCA---------- 664

Query: 333 MKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD 392
                               + D+R     +           VG+P +MA EV++ + YD
Sbjct: 665 -------------------KLTDQRSKRATM-----------VGTPYWMAPEVVKQREYD 694

Query: 393 FTVDYWSLGCILFESLVGYTPF 414
             VD WSLG +  E L    P+
Sbjct: 695 EKVDVWSLGIMTIEMLESEPPY 716

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 96/239 (40%), Gaps = 48/239 (20%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYL-AMEFVPGGDYRTLLINTRFLQAPHARFY 279
           + +E  I ++ +   +++ L  FQD    Y   ME+  GGD  TL+I    L+   A  +
Sbjct: 381 LTSEFCISSSLKHTNIIETLDLFQDAKGDYCEVMEYCSGGDLFTLIIAAGKLEYQEADCF 440

Query: 280 ISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEE 339
           + ++   V  +H +G  HRDLKPEN L+   G +K+TDFG                    
Sbjct: 441 LKQLITGVVYMHNMGVCHRDLKPENLLLTHDGTLKITDFG-------------------- 480

Query: 340 VKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYW 398
                             E +    E +++ +    GS  Y+A E    + +D   VD W
Sbjct: 481 ----------------NSECFRMAWEKEIHLSGGVCGSGPYIAPEEYTQEEFDPRAVDIW 524

Query: 399 SLGCILFESLVGYTPFSGSSTNETY--------ENLRCWKQV--LRRPRCDNGRYAFSD 447
           + G I      G   ++ +   + +        +N   +  +  L+R RC N  Y+  D
Sbjct: 525 ACGVIYMAMRTGRQLWATAQKEDEFYLKYLKGRKNAAGYDPIEKLKRARCRNVIYSILD 583

>Kwal_33.13222
          Length = 148

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/87 (35%), Positives = 51/87 (58%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           +++L   ++  S+LY+ +E+V  G+   LL+    L    A  +  ++   +   H LG 
Sbjct: 9   VLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGI 68

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAA 322
            HRDLKPEN L+D + +IK+ DFG+AA
Sbjct: 69  VHRDLKPENLLLDHKFNIKIADFGMAA 95

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 73/189 (38%), Gaps = 44/189 (23%)

Query: 226 DILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFC 285
           D+L   + E +VK     Q    LY+ +E+   G  R L I    L    A+ Y+ +   
Sbjct: 66  DLLKNLKHENIVKYHGFIQSSHELYILLEYCIRGSLRDL-IKKEALSEAKAKTYVRQTLR 124

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDF 345
            +  LH  G  HRD+K  N L+   G +KL DFG++                        
Sbjct: 125 GLQYLHDQGVIHRDIKAANLLLTENGVVKLADFGVST----------------------- 161

Query: 346 PKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILF 405
                             R N  N A +  GSP++MA EV+  K      D WSLG  + 
Sbjct: 162 ------------------RVN--NMAMTYAGSPNWMAPEVMLGKGASTVSDIWSLGATVV 201

Query: 406 ESLVGYTPF 414
           E L G  PF
Sbjct: 202 ELLTGNPPF 210

>Kwal_47.18233
          Length = 598

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 102/253 (40%), Gaps = 62/253 (24%)

Query: 224 ERDI--LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYIS 281
           ER+I  L   R   ++KL    +    + + +E+  G +    ++    +    AR +  
Sbjct: 77  EREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQ 135

Query: 282 EMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVK 341
           ++  AV+  H+    HRDLKPEN L+D   ++K+ DFGL                     
Sbjct: 136 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL--------------------- 174

Query: 342 NLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFT-VDYWSL 400
                              +N+   D N+  ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 175 -------------------SNIM-TDGNFLRTSCGSPNYAAPEVISGKLYAGPEVDVWSS 214

Query: 401 GCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYA----FSDRTWDLIIR- 455
           G IL+  L    PF   S    ++N+             NG Y      S    +LI R 
Sbjct: 215 GVILYVMLCRRLPFDDESIPVLFKNI------------SNGIYTLPKFLSPGAANLIKRM 262

Query: 456 LIADPISRLRSFE 468
           LI +P++R+   E
Sbjct: 263 LIVNPLNRITIHE 275

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 83/193 (43%), Gaps = 37/193 (19%)

Query: 265 LINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGT 324
           +IN + L   H ++++ ++  A+ +LH     HRDLKP N L++S   +K+ DFGLA   
Sbjct: 104 IINQQNLSEDHIQYFVYQILRALKSLHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCL 163

Query: 325 VSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALE 384
            S ++                                  REN V + +  V +  Y A E
Sbjct: 164 ASSDQS---------------------------------RENMVGFMTEYVATRWYRAPE 190

Query: 385 V-LEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRY 443
           + L  + Y   +D WS GCIL E ++G   F G    + +  L    +VL  P  ++   
Sbjct: 191 IMLSFQEYTTAMDIWSCGCILAEMIMGKPLFPG---KDYHHQLWIILEVLGSPTLEDFEQ 247

Query: 444 AFSDRTWDLIIRL 456
             S R  + I +L
Sbjct: 248 IKSKRAKEYISQL 260

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 112/276 (40%), Gaps = 56/276 (20%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDY-------RTL-----LINTRFL 271
           E  IL   +   +V LL   +  +  YL ME+   GD        R+L     L+ T F 
Sbjct: 67  EIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLFE 126

Query: 272 QAP-----HARF-------YISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFG 319
           + P     H          Y+ ++  A+  L      HRD+KP+N L+ +     L D+ 
Sbjct: 127 KYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLST----PLVDYN 182

Query: 320 LAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPD 379
             A   +   +    + + ++ +  F +F                  + + A +  GSP 
Sbjct: 183 DPAEFHARGFVGIYNLPILKIADFGFARFLP----------------NTSLAETLCGSPL 226

Query: 380 YMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCD 439
           YMA E+L  + Y+   D WS+G +L+E   G  PF  S+  E ++ ++    V++ P+  
Sbjct: 227 YMAPEILNYQKYNAKADLWSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQFPK-- 284

Query: 440 NGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKY 475
               A      DLI  L+        +FE  K+M +
Sbjct: 285 --HAALESAMVDLICGLL--------TFEPAKRMGF 310

>Kwal_33.13112
          Length = 505

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 99/240 (41%), Gaps = 52/240 (21%)

Query: 228 LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHAR--FYISEMFC 285
           L+  R+ ++      + +  S+++ MEF  GG    LL +    + P  +  + I E+  
Sbjct: 86  LSELRAPFVTTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLY 145

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDF 345
            ++ LH     HRD+K  N L+   G +KL DFG++                        
Sbjct: 146 GLEYLHSQRKIHRDVKAANILLTDEGEVKLGDFGVSG----------------------- 182

Query: 346 PKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN-YDFTVDYWSLGCIL 404
                       ++   L+ N      + VG+P +MA E++   N YD   D WSLG   
Sbjct: 183 ------------QIMATLKRN------TFVGTPYWMAPEIIARDNGYDEKADIWSLGITA 224

Query: 405 FESLVGYTPFSGSSTNETYENLRCWKQV-LRRPRCDNGRYAFSDRTWDLIIRLIADPISR 463
            E L G  P++       Y+ ++    + LR+P    GR+  S R + + + L  DP  R
Sbjct: 225 MELLTGQPPYA------KYDPMKVLMNIPLRKPPRLQGRFTSSARDF-IALCLTKDPALR 277

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 87/204 (42%), Gaps = 43/204 (21%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           ++ L    Q+   + + +EFV GG++   +   R L+   A    +++   V+ +H  G 
Sbjct: 112 IIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLISGVNYMHYKGL 171

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMND 355
            HRDLK EN L+D   ++ +TDFG                        +F  FE+  +  
Sbjct: 172 VHRDLKLENLLLDKHENLVITDFGFVN---------------------EF--FEDNEL-- 206

Query: 356 RREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYTP 413
                            ++ GSP Y A E V+  K Y+    D WS G IL+  L GY P
Sbjct: 207 ---------------MKTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLP 251

Query: 414 FSGSSTNETYENL-RCWKQVLRRP 436
           +     N T +++ R +K + + P
Sbjct: 252 WDDDHENPTGDDIARLYKYITQTP 275

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 84/194 (43%), Gaps = 41/194 (21%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           ++ E  ++++++ + +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 609 IVNEIMVMSSSKHQNIVNYIDSYLSGLDLWVVMEYMEGGCL-TDVVTYCVLTEGQIGAVC 667

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
            E+   ++ LH  G  HRD+K +N L+   G IKLTDFG  A                  
Sbjct: 668 REVLQGLEFLHSKGVLHRDIKSDNVLLSMNGDIKLTDFGFCA------------------ 709

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSL 400
                       +ND            V   ++ VG+P +MA E++  K Y   VD WSL
Sbjct: 710 -----------QVND-----------TVIKRTTMVGTPYWMAPEIVSRKEYGPKVDIWSL 747

Query: 401 GCILFESLVGYTPF 414
           G ++ E + G  P+
Sbjct: 748 GIMIIEMIEGEPPY 761

>Scas_613.5
          Length = 517

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 98/265 (36%), Gaps = 76/265 (28%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSL-----YLAMEFVPGGDYRTLLINTRFLQAPHARF 278
           E +IL       +V LL  F +P S      YL ++ +  G+    ++    L+    + 
Sbjct: 252 ETNILMRIHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETKA 311

Query: 279 YISEMFCAVDALHQLGYTHRDLKPENFLIDSRG-------------------HIKLTDFG 319
             +++   +  LHQ    HRD+KPEN L++                       +K+ DFG
Sbjct: 312 IFNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFG 371

Query: 320 LAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPD 379
           LA  T  M+                                         + ++  G+P 
Sbjct: 372 LAKFTGEMQ-----------------------------------------FTNTLCGTPS 390

Query: 380 YMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCD 439
           Y+A EVL  K Y   VD WS G IL+  L G+ PFS     E        +Q+L+     
Sbjct: 391 YVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFS-----EQLGPPSLKEQILQ----- 440

Query: 440 NGRYAFSDRTWDLIIRLIADPISRL 464
             ++AF    WD I   +   IS L
Sbjct: 441 -AKFAFYTPYWDNIDDNVLHLISHL 464

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 90/225 (40%), Gaps = 27/225 (12%)

Query: 250 YLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDS 309
           Y+  E + GG+    ++   +     +R  I ++  AV  +HQLG  HRD+KPEN L + 
Sbjct: 219 YIIQELLAGGEIFGEIVKYTYFSEDLSRHVIRQLANAVKYMHQLGIVHRDIKPENLLFEP 278

Query: 310 RGHIKLTDFGLAAGTVSMERIESMKIRLEE-------VKNLDFPKFEEKSMNDRREMYTN 362
              I      L +      +++    R          VK  DF             +   
Sbjct: 279 IDFIPNPKPKLRSSDDPSTKLDEGVFRPGIGGGGIGVVKLADF------------GLSKQ 326

Query: 363 LRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNET 422
           + + +      TVG   Y A EV++ + Y   VD W +GC+L+  L G+ PF     +  
Sbjct: 327 IYQTNTKTPCGTVG---YTAPEVVKDERYSMQVDMWGVGCVLYTVLCGFPPFFDEKIDVL 383

Query: 423 YENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLI-ADPISRLRS 466
            E +   +    RP  D      SD   + + +L+  DP  R  S
Sbjct: 384 TEKISRGEYTFLRPWWDQ----ISDGAKNCVRKLLEVDPAKRYTS 424

>Kwal_33.14167
          Length = 838

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 80/199 (40%), Gaps = 61/199 (30%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDY---RTLLINTRF-LQAPHARFYISEMFCAVDALH 291
           +VKL+    D   LY+ ME    GD+   +TL   +   L     R++  EM   V  +H
Sbjct: 575 VVKLIDHEMDHGVLYVVMEC---GDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVH 631

Query: 292 QLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEK 351
             G  H DLKP NF+   +G +K+ DFG+A                              
Sbjct: 632 DAGIVHSDLKPANFVF-VKGILKIIDFGIANA---------------------------- 662

Query: 352 SMNDRREMYTNLRENDVN-YASSTVGSPDYMALEVLEAKNYDFT-------------VDY 397
                      + E+ VN Y  + +G+P+YMA E L A NY                 D 
Sbjct: 663 -----------VPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDI 711

Query: 398 WSLGCILFESLVGYTPFSG 416
           WS GCI+++ + G  P+ G
Sbjct: 712 WSCGCIIYQMIYGRPPYGG 730

>Kwal_23.6325
          Length = 1542

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 71/166 (42%), Gaps = 30/166 (18%)

Query: 251  LAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSR 310
            L ME+  GG    LL + R       + Y  +M   +  LHQ    HRD+KPEN L+D  
Sbjct: 1325 LFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHRDIKPENILLDFN 1384

Query: 311  GHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNY 370
            G IK  DFG A          S+     +  N+                     E   + 
Sbjct: 1385 GVIKYVDFGAA---------RSLAANGTKAPNVG-------------------AEGKADG 1416

Query: 371  ASSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYTPF 414
             +S +G+P YM+ E +  AK   F + D WSLGC++ E + G  P+
Sbjct: 1417 VNSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMVTGRRPW 1462

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 106/280 (37%), Gaps = 43/280 (15%)

Query: 193 ARKRDTREICAXXXXXXXXXXXXXETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLY-L 251
            R+RD RE                    VL E  I     S   +     FQ+  S Y +
Sbjct: 144 GRRRDKREEAGENKATSR--------EQVLKEITIHKAVSSGENIVTFIDFQETESYYFI 195

Query: 252 AMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPEN------- 304
             E + GG+    ++   +     +R  I ++  AV  +H LG  HRD+KPEN       
Sbjct: 196 VQELLAGGEIFGEIVRLTYFSEDLSRHVIRQLALAVKHMHSLGIVHRDIKPENLLFSPID 255

Query: 305 FLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLR 364
           F+   R  ++ +D         + R       +  +K  DF           +++Y    
Sbjct: 256 FIPSKRQQLRQSDDPKTKQDEGLFRPGIGGGGIGVIKLADF--------GLSKQIYAT-- 305

Query: 365 ENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYE 424
             +      TVG   Y A EV++ + Y   VD W +GC+L+  L G+ PF         E
Sbjct: 306 --NTTTPCGTVG---YTAPEVVKDERYSMKVDMWGIGCVLYTVLCGFPPFYD-------E 353

Query: 425 NLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRL 464
            +    +++ +     G+Y F    WD I     + + RL
Sbjct: 354 KIDVLTELISK-----GQYTFLRPWWDEISPGAKNAVRRL 388

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 81/195 (41%), Gaps = 43/195 (22%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           ++ E  ++  ++   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 662 IINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSL-TDVVTHCILTEGQIGAVC 720

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
            E    ++ LH  G  HRD+K +N L+   G IKLTDFG  A                  
Sbjct: 721 RETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCA------------------ 762

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASST-VGSPDYMALEVLEAKNYDFTVDYWS 399
                                  + N++N   +T VG+P +MA EV+  K Y   VD WS
Sbjct: 763 -----------------------QINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWS 799

Query: 400 LGCILFESLVGYTPF 414
           LG ++ E + G  P+
Sbjct: 800 LGIMIIEMIEGEPPY 814

>Kwal_55.21709
          Length = 340

 Score = 68.2 bits (165), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 111/275 (40%), Gaps = 68/275 (24%)

Query: 224 ERDILTT-TRSEWLVKLLYAFQDPSSLYLAMEF--VPGGDYRTLLINTRFLQAPHARFYI 280
           E  ILT  T    ++ LL   QD  S   A+ F  V   D+RTL +       P  ++Y 
Sbjct: 92  ELKILTNLTGGPNVIALLDIVQDSGSKIPALIFEEVKNVDFRTLYLK---FTLPDIQYYF 148

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDS-RGHIKLTDFGLAAGTVSMERIESMKIRLEE 339
           S++  A+D  H +G  HRD+KP+N +ID     ++L D+GLA                  
Sbjct: 149 SQLLIALDYCHSMGIMHRDVKPQNVMIDPVERKLRLIDWGLA------------------ 190

Query: 340 VKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWS 399
                             E Y    + +V  AS     P+ +    +    YD+++D WS
Sbjct: 191 ------------------EFYHPGVDYNVRVASRYHKGPELL----VNLNQYDYSLDLWS 228

Query: 400 LGCILFESLVGYTPFSGSSTNE-----------TYENLRCW-KQVLRRPR-CDNGRYAFS 446
           +GC+L   +    PF   STN            T E L    K  L+ PR  DN    F 
Sbjct: 229 VGCMLAAIVFKKEPFFKGSTNPDQLVKIARVLGTTELLAYLNKYGLKLPREYDNIMKDFP 288

Query: 447 DRTWD--------LIIRLIADPISRLRSFEHVKKM 473
            +TW         L++  + D I  L  ++H +++
Sbjct: 289 RKTWSEFTTPDTPLVVPEVVDLIENLLRYDHQERL 323

>Kwal_27.9763
          Length = 868

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 79/195 (40%), Gaps = 45/195 (23%)

Query: 220 HVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFY 279
           H+L E D+L   + E +VK     Q    L++ +E+   G  R L I    ++    + Y
Sbjct: 65  HML-EIDLLKNLKHENIVKYHGFIQKSHQLFILLEYCSQGSLRDL-IKRGPVEEQQCKTY 122

Query: 280 ISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEE 339
           I +    +  LH  G  HRD+K  N L+D++  +KL DFG++                  
Sbjct: 123 IRQTLHGLKYLHDQGVIHRDIKAANLLLDAQNVVKLADFGVST----------------- 165

Query: 340 VKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWS 399
                                   R N  N A +  GSP++MA EV+  +      D WS
Sbjct: 166 ------------------------RVN--NLAMTYAGSPNWMAPEVMMGQGASTVSDIWS 199

Query: 400 LGCILFESLVGYTPF 414
           LG  + E L G  PF
Sbjct: 200 LGATVVEILTGNPPF 214

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 89/207 (42%), Gaps = 60/207 (28%)

Query: 220 HVLTERDILTTTRSEWLVKLLYAFQDP--SSLYLAMEFVPGGD----YRTLL-----INT 268
            +L E     + +SE++V+    F D   SS+Y+AME++ G      Y+ LL     I+ 
Sbjct: 223 QLLRELQFNKSFKSEYIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISE 282

Query: 269 RFLQAPHARFYISE-MFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSM 327
           + L        ISE +   +  LH+    HRD+KP+N L++  G +KL DFG     VS 
Sbjct: 283 KVLGK------ISEAVLRGLSYLHEKKVIHRDIKPQNILLNEDGQVKLCDFG-----VSG 331

Query: 328 ERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLE 387
           E + S+                                     A++  G+  YMA E ++
Sbjct: 332 EAVNSL-------------------------------------ATTFTGTSYYMAPERIQ 354

Query: 388 AKNYDFTVDYWSLGCILFESLVGYTPF 414
            + Y  T D WSLG  + E   G+ PF
Sbjct: 355 GQPYSVTCDVWSLGLTILEVAQGHFPF 381

>Kwal_26.7861
          Length = 955

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 80/195 (41%), Gaps = 43/195 (22%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           ++ E  ++  ++   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 709 IINEILVMKASKHANIVNFIDSYLLRGDLWVVMEYMEGGSL-TDVVTHCILTEGQIGAVS 767

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
            E    +  LH  G  HRD+K +N L+   G IKLTDFG  A                  
Sbjct: 768 RETLKGLQFLHSKGVIHRDIKSDNVLLSMSGEIKLTDFGFCA------------------ 809

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASST-VGSPDYMALEVLEAKNYDFTVDYWS 399
                                  + N++N   +T VG+P +MA EV+  K Y   VD WS
Sbjct: 810 -----------------------QINEINLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWS 846

Query: 400 LGCILFESLVGYTPF 414
           LG ++ E + G  P+
Sbjct: 847 LGIMIIEMIEGEPPY 861

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 84/194 (43%), Gaps = 41/194 (21%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           ++ E  ++  +R   +V  + ++     L++ ME++ GG    ++ +    +   A    
Sbjct: 725 IINEILVMKGSRHNNIVNFIDSYLLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIAAVS- 783

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
            E    +  LH  G  HRD+K +N L+   G+IKLTDFG  A                  
Sbjct: 784 RETLRGLHFLHSKGVIHRDIKSDNILLSMDGNIKLTDFGFCA------------------ 825

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSL 400
                       +N+     TNL+       ++ VG+P +MA EV+  K Y   VD WSL
Sbjct: 826 -----------QINE-----TNLKR------TTMVGTPYWMAPEVVSRKEYGPKVDIWSL 863

Query: 401 GCILFESLVGYTPF 414
           G ++ E + G  P+
Sbjct: 864 GIMIIEMIEGEPPY 877

>Kwal_0.155
          Length = 587

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 103/253 (40%), Gaps = 28/253 (11%)

Query: 220 HVLTERDILTTTRSEWLVKLLYAFQDPSSLY-LAMEFVPGGDYRTLLINTRFLQAPHARF 278
            VL E  I  T  +   V     FQ+  + Y +  E + GG+    ++   +     +R 
Sbjct: 218 QVLKEVAIHRTVSASENVVSFVDFQESHNYYFIVQELLAGGEIFGEIVRLTYFSEDLSRH 277

Query: 279 YISEMFCAVDALHQLGYTHRDLKPENFLIDSRGH-------IKLTDFGLAAGTVSMERIE 331
            I ++  AV  +H +G  HRD+KPEN L +   +       ++ +D   A     + R  
Sbjct: 278 VIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQDEGIFRPG 337

Query: 332 SMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNY 391
                +  VK  DF           +++Y+     +      TVG   Y A EV++ + Y
Sbjct: 338 IGGGGIGTVKLADF--------GLSKQIYST----NTKTPCGTVG---YTAPEVVKDERY 382

Query: 392 DFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWD 451
              VD W +GC+L+  L G+ PF     +   E +   +    RP  D      SD   +
Sbjct: 383 SMQVDMWGIGCVLYTVLCGFPPFYDEKIDVLTEKISRGEFTFLRPWWDE----ISDGAKN 438

Query: 452 LIIRLI-ADPISR 463
            + RL+  DP  R
Sbjct: 439 AVRRLLEVDPSKR 451

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 103/249 (41%), Gaps = 55/249 (22%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           +VKL    Q+   + + +E+  GG++   +   R L+  +A    S++   V  +H  G 
Sbjct: 112 IVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKEMNACRLFSQLISGVHYIHSKGL 171

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMND 355
            HRDLK EN L+D   ++ +TDFG      S  R E MK                     
Sbjct: 172 VHRDLKLENLLLDKNENLVITDFGFVNEFCS--RNELMK--------------------- 208

Query: 356 RREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYTP 413
                            ++ GSP Y A E V+ A+ Y+    D WS G IL+  L GY P
Sbjct: 209 -----------------TSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLP 251

Query: 414 FSGSSTNETYENL-RCWKQVLRRPRCDNGRYAFSDRTW----DLIIR-LIADPISRLRSF 467
           +     N    ++ R +  +   P        F D       DL+ R L++DP  R+ + 
Sbjct: 252 WDDDPNNPEGSDIGRLYNYINSTP------LKFPDYILPIPRDLLRRMLVSDPKKRI-NL 304

Query: 468 EHVKKMKYF 476
           + +KK ++ 
Sbjct: 305 KQIKKHEWL 313

>Scas_640.14*
          Length = 728

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 127/328 (38%), Gaps = 76/328 (23%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           +V+L    Q+   + + +E+  GG++   +   R L+   A    +++   V  +H  G 
Sbjct: 108 IVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLISGVSYMHSKGI 167

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMND 355
            HRDLK EN L+D   ++ +TDFG                                    
Sbjct: 168 VHRDLKLENLLLDKHENLIITDFGFV---------------------------------- 193

Query: 356 RREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYTP 413
             E Y      D     ++ GSP Y A E V+  + Y     D WS G IL+  L GY P
Sbjct: 194 -NEFYA-----DNELMKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLP 247

Query: 414 FSGSSTNETYENL-RCW----KQVLRRPRCDNGRYAFSDRTWDLIIR--LIADPISRLRS 466
           +     N   E++ R +    K  L+ PR     +        + +R  L+++P+ R+ S
Sbjct: 248 WDDDKQNPNGEDIVRLYHYITKTPLKFPRIHYTTF------LGICLRHILVSNPVRRMSS 301

Query: 467 FEHVKKMKYFAEISFENLRNVSPPFIPQLDNETDAGYFDD------FTSEADMAKYADVF 520
             H+KK ++ +  S          F+     E D  Y          T EA   ++ ++ 
Sbjct: 302 -RHIKKHEWLSPHSH---------FLSITSEEWDNIYASKEKQKLASTEEAQQPQHHNIS 351

Query: 521 KR----QDKL-SAMVDDSDAVSKLVGFT 543
            R    Q  L S M+  +D  +K +  T
Sbjct: 352 ARASYTQGTLPSRMISTTDQFTKQIAVT 379

>Scas_573.10
          Length = 569

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 93/216 (43%), Gaps = 15/216 (6%)

Query: 250 YLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDS 309
           Y+  E + GG+    ++   +     +R  I ++  AV  LH LG  HRD+KPEN L + 
Sbjct: 223 YIVQELIHGGEIFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIKPENLLFEP 282

Query: 310 RGHIKLTDFGL-AAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
              I   +  L  +   S +  E + +       +   K  +  ++ ++   TN +    
Sbjct: 283 IEFIPSKEPKLRKSDDPSTKSDEGLFVPGVGGGGIGVVKLADFGLS-KQIFATNTK---- 337

Query: 369 NYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRC 428
               +  G+  Y A EV++ ++Y   VD W +GC+L+  L G+ PF     +   E +  
Sbjct: 338 ----TPCGTVGYTAPEVVKDEHYSMKVDMWGVGCVLYTMLCGFPPFYDEKIDVLTEKISR 393

Query: 429 WKQVLRRPRCDNGRYAFSDRTWDLIIRLI-ADPISR 463
            +    RP  D      S    + +IRL+  DP  R
Sbjct: 394 GEYTFLRPWWDE----ISAGAKNAVIRLLEVDPNKR 425

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 82/211 (38%), Gaps = 34/211 (16%)

Query: 250 YLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDS 309
           YL  E + GG+    ++   +L    +R  I ++  AV  +H LG  HRD+KPEN L  S
Sbjct: 257 YLIQELLDGGEIFNEIVRLTYLSEDLSRHVIKQVALAVRHMHSLGIVHRDIKPENLLFKS 316

Query: 310 RGHI-------KLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTN 362
             +I       + +D         +         +  VK  DF             +   
Sbjct: 317 IEYIPSKKRTFRKSDDPATKADEGVFIPTIGGGGIGIVKLADF------------GLSKQ 364

Query: 363 LRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNET 422
           + + +      T+G   Y A EV++ + Y   VD W +GC+L+  L G+ PF     +  
Sbjct: 365 IFQKNTKTPCGTIG---YTAPEVVKDEKYSMQVDMWGIGCVLYTMLCGFPPFYDEKIDVL 421

Query: 423 YENLRCWKQVLRRPRCDNGRYAFSDRTWDLI 453
            E            +   G Y F +  WD I
Sbjct: 422 TE------------KISRGEYTFLEPWWDEI 440

>Kwal_0.307
          Length = 490

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 83/205 (40%), Gaps = 38/205 (18%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYL-AMEFVPGGDYRTLLINTRFLQAPHARFY 279
           + +E  I ++ +   ++  L  FQD    Y   ME+  GGD  TL+I    L+   A  +
Sbjct: 318 LTSEFCISSSLKHTNIIMTLDLFQDAKGDYCQVMEYCFGGDLFTLIIAAGKLEYMEADCF 377

Query: 280 ISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEE 339
             ++   V  +H +G  HRDLKPEN L+ S G +K+TDFG                    
Sbjct: 378 FKQLIRGVVYMHDMGVCHRDLKPENLLLSSNGTLKITDFG-------------------- 417

Query: 340 VKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYW 398
                             E +    E D++ +    GS  Y+A E    + +D   VD W
Sbjct: 418 ----------------NSECFRMAWEKDIHLSGGVCGSSPYIAPEEYVHEEFDPRPVDIW 461

Query: 399 SLGCILFESLVGYTPFSGSSTNETY 423
           + G I      G   +S +  ++ +
Sbjct: 462 ACGVIYMAMRTGRQLWSSAQRDDEF 486

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 79/195 (40%), Gaps = 35/195 (17%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYI 280
           +L E   L+T    ++      F    +LY+ ME+   G    LL     L      F I
Sbjct: 61  LLKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLLRYYSRLTEQTTCFII 120

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
            ++  A++ LH+    HRDLK  N L++  G ++L D G+                    
Sbjct: 121 LQVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGVTG------------------ 162

Query: 341 KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSL 400
             L F        N  R    NL        ++ VG+P +MA E+++ ++YD   D WSL
Sbjct: 163 -QLKF--------NSTRHGGKNL--------NTFVGTPFWMAPEIIKNQSYDGKCDIWSL 205

Query: 401 GCILFESLVGYTPFS 415
           G    E L G  P S
Sbjct: 206 GITTLELLNGKPPMS 220

>YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine protein
           kinase involved in sensitivity to salt [1812 bp, 603 aa]
          Length = 603

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 88/228 (38%), Gaps = 56/228 (24%)

Query: 236 LVKLLYAFQDPSSLYL-AMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           +V  L  FQD    Y   ME+  GGD  TL++    L+   A  +  ++   V  +H++G
Sbjct: 385 IVTTLDLFQDAKGEYCEVMEYCAGGDLFTLVVAAGKLEYMEADCFFKQLIRGVVYMHEMG 444

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             HRDLKPEN L+   G +K+TDFG                                   
Sbjct: 445 VCHRDLKPENLLLTHDGVLKITDFG----------------------------------- 469

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCI---------L 404
              E +    E +++ +    GS  Y+A E    + +D   VD W+ G I         L
Sbjct: 470 -NSECFKMAWEKNIHLSGGVCGSSPYIAPEEYIKEEFDPRPVDIWACGVIYMAMRTGRQL 528

Query: 405 FESLVGYTPF-----SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSD 447
           + S     PF      G      YE +    + L+R RC N  Y+  D
Sbjct: 529 WSSAEKDDPFYMNYLKGRKEKGGYEPI----ESLKRARCRNVIYSMLD 572

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 78/189 (41%), Gaps = 48/189 (25%)

Query: 232 RSEWLVKLLYAFQD--PSSLYLAMEFVPG----GDYRTLLINTRFLQAPHARFYISEMFC 285
           +S+++V+    F D   SS+Y+AME++ G      Y+ LL     +           +  
Sbjct: 269 KSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLR 328

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDF 345
            +  LH+    HRD+KP+N L++ +G IKL DFG     VS E + S+            
Sbjct: 329 GLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFG-----VSGEAVNSL------------ 371

Query: 346 PKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILF 405
                                    A +  G+  YMA E ++ + Y  T D WSLG  L 
Sbjct: 372 -------------------------AMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLL 406

Query: 406 ESLVGYTPF 414
           E   G  PF
Sbjct: 407 EVAGGRFPF 415

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 68/167 (40%), Gaps = 43/167 (25%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
           L++ ME++ GG   T ++    L          E    +  LH  G  HRD+K +N L+ 
Sbjct: 768 LWVVMEYMEGGSL-TDVVTHCILTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNILLS 826

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
             G IKLTDFG  A                                         + N+V
Sbjct: 827 MNGDIKLTDFGFCA-----------------------------------------QINEV 845

Query: 369 NYASST-VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414
           N   +T VG+P +MA EV+  K Y   VD WSLG ++ E + G  P+
Sbjct: 846 NLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 892

>YLR248W (RCK2) [3644] chr12 (634254..636086)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) [1833 bp, 610 aa]
          Length = 610

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 95/240 (39%), Gaps = 39/240 (16%)

Query: 243 FQDPSSLY-LAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLK 301
           FQ+  S Y +  E + GG+    ++   +     +R  I ++  AV  +H LG  HRD+K
Sbjct: 256 FQETDSYYYIIQELLTGGEIFGEIVRLTYFSEDLSRHVIKQLALAVKHMHSLGVVHRDIK 315

Query: 302 PENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV--------KNLDFPKFEEKSM 353
           PEN L +                  +E   S+K +L +         + +  P      +
Sbjct: 316 PENLLFEP-----------------IEFTRSIKPKLRKSDDPQTKADEGIFTPGVGGGGI 358

Query: 354 NDRREMYTNLRENDVNYASST-VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYT 412
              +     L +   +  + T  G+  Y A EV++ ++Y   VD W +GC+L+  L G+ 
Sbjct: 359 GIVKLADFGLSKQIFSKNTKTPCGTVGYTAPEVVKDEHYSMKVDMWGIGCVLYTMLCGFP 418

Query: 413 PFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKK 472
           PF     +   E            +   G Y F    WD I     + +++L   E  K+
Sbjct: 419 PFYDEKIDTLTE------------KISRGEYTFLKPWWDEISAGAKNAVAKLLELEPSKR 466

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 85/203 (41%), Gaps = 58/203 (28%)

Query: 249 LYLAMEFVPGGDYRTLL----INTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPEN 304
           L++ ME+  GG  RTLL    I+ ++L        + ++  A+  +H+    HRD+K  N
Sbjct: 97  LWVIMEYCAGGSLRTLLRPGKIDEKYLG-----VIVRKLLIALVYIHKDNVIHRDIKAAN 151

Query: 305 FLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLR 364
            LI + GH+KL DFG+AA                          +  + N +R+      
Sbjct: 152 VLITNEGHVKLCDFGVAA--------------------------QLTAANHKRQ------ 179

Query: 365 ENDVNYASSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETY 423
                   +  G+P +MA EV +E   Y+   D WSLG   +E   G  P+         
Sbjct: 180 --------TMAGTPYWMAPEVIMEGVYYNTKADIWSLGITAYEIATGNPPYC------DV 225

Query: 424 ENLRCWKQVLRR--PRCDNGRYA 444
           E LR  + + +   PR +   Y+
Sbjct: 226 EALRAMQLITKSKPPRLEGRNYS 248

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 111/268 (41%), Gaps = 78/268 (29%)

Query: 218 TNHV----LTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGD-YRTLLINTRFLQ 272
           +NH+    L E DI +       +  LY + D    Y+ ME+  GGD Y  +  +T   +
Sbjct: 97  SNHICFEALYEVDIQSKIGKHKNITELYDYFDS---YIIMEYCSGGDLYEAIKADTIPRK 153

Query: 273 APHARFYISEMFCAVDALHQLGYTHRDLKPENFLI-DSRGHIKLTDFGLAAG-TVSMERI 330
                  IS++  AV+ +H  G  HRD+KPEN LI DS   +KLTD+GLA     SM+R 
Sbjct: 154 TRQLTHIISQILDAVEFVHSKGIYHRDIKPENILIADSNWTVKLTDWGLATTDQTSMDR- 212

Query: 331 ESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKN 390
                                                       VGS  YMA E+ E+ N
Sbjct: 213 -------------------------------------------NVGSERYMAPELFES-N 228

Query: 391 YDF----------TVDYWSLGCILFESLVGYTPFS-GSSTNETYENLRCWKQVLRRPRCD 439
            D+           VD W++G +L   +    PFS  + T++++    C+    R    D
Sbjct: 229 LDYDERNEPYECSKVDIWAIGIVLLNIVFHKNPFSVANQTDKSF----CYFAANREALFD 284

Query: 440 NGRYAFSDRTWDL--IIR--LIADPISR 463
                FS  ++DL  ++R  L  DP +R
Sbjct: 285 ----VFSTMSYDLYQLLRHSLTIDPTNR 308

>YDL028C (MPS1) [834] chr4 complement(400994..403288)
           Multi-functional serine/threonine/tyrosine protein
           kinase involved in mitotic checkpoint, spindle pole body
           duplication in meiosis and mitosis, and proper
           chromosome segregation in meiosis [2295 bp, 764 aa]
          Length = 764

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 75/186 (40%), Gaps = 63/186 (33%)

Query: 249 LYLAMEFVPGGDYR-TLLINTRF---LQAPHARFYISEMFCAVDALHQLGYTHRDLKPEN 304
           LYL ME    GD+  + ++N R    L     RFY  EM   +  +H  G  H DLKP N
Sbjct: 512 LYLIMEC---GDHDLSQILNQRSGMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPAN 568

Query: 305 FLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLR 364
           F++  +G +K+ DFG+A                                         + 
Sbjct: 569 FVL-VKGILKIIDFGIANA---------------------------------------VP 588

Query: 365 ENDVN-YASSTVGSPDYMALEVLEAKNYDFT---------------VDYWSLGCILFESL 408
           E+ VN Y  + +G+P+YMA E L A NY                   D WS GCI+++ +
Sbjct: 589 EHTVNIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMI 648

Query: 409 VGYTPF 414
            G  P+
Sbjct: 649 YGKPPY 654

>Scas_678.24
          Length = 1610

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 79/167 (47%), Gaps = 34/167 (20%)

Query: 247 SSLYLAMEFVPGGDYRTL--LINTRFLQAPHARFY--ISEMFCAVDALHQLGYTHRDLKP 302
           S+L++ ME+    + RTL  LI+T  L      ++    ++  A+  +H  G  HRDLKP
Sbjct: 734 STLFIQMEYC---ENRTLYDLIHTENLSNQRDEYWRLFRQILEALSYIHSQGIIHRDLKP 790

Query: 303 ENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTN 362
            N  ID   ++K+ DFGLA                   ++LD  K + +S+    E  T 
Sbjct: 791 MNIFIDESRNVKIGDFGLAKNV---------------HRSLDILKLDSQSVVGSTENLT- 834

Query: 363 LRENDVNYASSTVGSPDYMALEVLEAK-NYDFTVDYWSLGCILFESL 408
                     S +G+  Y+A EVL  K NY+  +D +SLG I FE +
Sbjct: 835 ----------SAIGTALYVATEVLNGKGNYNEKIDMYSLGIIFFEMI 871

>AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH]
           (1005431..1006945) [1515 bp, 504 aa]
          Length = 504

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 88/224 (39%), Gaps = 48/224 (21%)

Query: 236 LVKLLYAFQDPSSLYL-AMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           ++  L  FQD    Y   ME+  GGD  +L++    L+   A  +  +M   V  +H +G
Sbjct: 286 IINTLDLFQDAKGDYCEVMEYCSGGDLFSLIVTAGKLEYMEADCFFKQMIRGVVYMHDMG 345

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             HRDLKPEN ++ + G +K+TDFG                                   
Sbjct: 346 VCHRDLKPENLILTANGVLKITDFGNG--------------------------------- 372

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTP 413
              E +    E D++ +    GS  Y+A E    + +D   VD W+ G I      G   
Sbjct: 373 ---ECFRMAWEKDIHLSGGVCGSSPYIAPEEYSMEEFDPRPVDIWACGTIYMAMRTGRQL 429

Query: 414 F-SGSSTNETYEN-LRCWK--------QVLRRPRCDNGRYAFSD 447
           + +    +E Y   LR  K        + L+R RC N  Y+  D
Sbjct: 430 WRTAQKEDEFYARYLRGRKDEAGYEPIEQLKRARCRNVIYSILD 473

>Scas_673.20*
          Length = 758

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 83/197 (42%), Gaps = 47/197 (23%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGG---DYRTLLINTRFLQAPHAR 277
           + TE  +L   +   ++  + ++    +L++ ME++ GG   D  +    T    A   R
Sbjct: 523 IWTEMLVLKEYQHPNIINFINSYLLHDTLWIVMEYMDGGSLADIVSFFTPTEEQMATICR 582

Query: 278 FYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRL 337
               E    ++ LH  G  HRD+K +N L+   G IK+TDFG                +L
Sbjct: 583 ----ETLFGLNFLHSRGIVHRDIKSDNILLSMNGDIKITDFGFCG-------------QL 625

Query: 338 EEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDY 397
            E              N +R              ++ VG+P +MA EV+ +K Y   VD 
Sbjct: 626 TE-------------SNTKR--------------TTMVGTPYWMAPEVIASKEYGPKVDV 658

Query: 398 WSLGCILFESLVGYTPF 414
           WSLG ++ E + G  P+
Sbjct: 659 WSLGIMIIEMIEGEPPY 675

>Scas_640.16
          Length = 505

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 85/203 (41%), Gaps = 60/203 (29%)

Query: 232 RSEWLVKLLYAFQD--PSSLYLAMEFVPGGD----YRTLL-----INTRFLQAPHARFYI 280
           +S+++V+    F D   SS+Y+AME++ G      Y+ LL     I+ + L        I
Sbjct: 265 KSDYIVRYYGMFNDVNSSSIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGK------I 318

Query: 281 SE-MFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEE 339
           SE +   +  LH+    HRD+KP+N L + +G +KL DFG     VS E + S+      
Sbjct: 319 SESVLRGLSYLHEQKVIHRDIKPQNILFNEKGQVKLCDFG-----VSGEAVNSL------ 367

Query: 340 VKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWS 399
                                          A++  G+  YMA E ++ + Y  T D WS
Sbjct: 368 -------------------------------ATTFTGTSFYMAPERIQGQPYSVTCDIWS 396

Query: 400 LGCILFESLVGYTPFSGSSTNET 422
           LG  + E   G  PF       T
Sbjct: 397 LGLTILEVAQGRFPFGSDKITAT 419

>Scas_685.24
          Length = 515

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 76/191 (39%), Gaps = 45/191 (23%)

Query: 228 LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLL--INTRFLQAPHARFYISEMFC 285
           L   +S +++  +    + +S+++ ME+  GG    LL       L      +   E+  
Sbjct: 72  LAELKSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILK 131

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDF 345
            +  LH+    HRD+K  N L+   GH+KL DFG++                        
Sbjct: 132 GLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSG----------------------- 168

Query: 346 PKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEA--KNYDFTVDYWSLGCI 403
                       ++ + LR   +      VG+P +MA EV     + YD  +D WSLG  
Sbjct: 169 ------------QLKSTLRRGTI------VGTPYWMAPEVASQNIEGYDEKIDIWSLGIT 210

Query: 404 LFESLVGYTPF 414
           +FE L G  P 
Sbjct: 211 VFELLKGVPPL 221

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/347 (22%), Positives = 131/347 (37%), Gaps = 78/347 (22%)

Query: 146 GEELSKEWQAYLTKETGILRKRRLKPKN-KDFEMITXXXXXXXXXXXLARKRDTREICAX 204
           G+E + + Q   ++  G +  R+   ++  D+E +            L + R T+EIC  
Sbjct: 68  GKEQAAQRQNDASRPNGAVELRQFHRRSLGDWEFLETVGAGSMGKVKLVKHRQTKEICVI 127

Query: 205 XXXXXXXXXXXXETNHVLT---ERDILT--------------TTRSEWLVKLLYAFQD-- 245
                       + + + +   E +IL               T R   L ++LY      
Sbjct: 128 KIVNRASKAYLHKQHSLPSPKNESEILERQKRLEKEIARDKRTVREASLGQILYHPHICR 187

Query: 246 -------PSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHR 298
                   +  Y+  E+V GG     +I    L+  HAR +   +  A+  LH     HR
Sbjct: 188 LFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHR 247

Query: 299 DLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRRE 358
           DLK EN +I S G IK+ DFGL+                      D+          R++
Sbjct: 248 DLKIENIMISSSGEIKIIDFGLS-------------------NIFDY----------RKQ 278

Query: 359 MYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTPFSGS 417
           ++T              GS  + A E+L+A+ Y    VD WS G +L+  + G  PF   
Sbjct: 279 LHT------------FCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDD- 325

Query: 418 STNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLI-ADPISR 463
                 EN     + +++ + D   +  S     L+ R+I  DP+ R
Sbjct: 326 ------ENSSILHEKIKKGKVDYPSH-LSIEVISLLTRMIVVDPLRR 365

>Kwal_33.13831
          Length = 700

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 78/197 (39%), Gaps = 40/197 (20%)

Query: 219 NHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINT--RFLQAPHA 276
            H L+ER+  +      ++K+L   Q        +EF P GD  +LL  T    L    A
Sbjct: 453 GHSLSERETASQKPHPNILKMLDLMQTHDGFIEVLEFCPSGDLYSLLSRTSKNGLHPLEA 512

Query: 277 RFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIR 336
             ++ ++   V  +H  G  H DLKPEN L   +G +K+ DFG +               
Sbjct: 513 DCFMKQLLHGVKYMHDHGIAHCDLKPENILFGPQGVLKICDFGTSC-------------- 558

Query: 337 LEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMAL-EVLEAKNYD-FT 394
                                 ++    E  V++ +  VGS  Y+A  E +  + YD   
Sbjct: 559 ----------------------VFQTAWEKQVHFQTGAVGSEPYVAPEEFIAEREYDPRL 596

Query: 395 VDYWSLGCILFESLVGY 411
           VD WS G I    ++G+
Sbjct: 597 VDSWSCGVIYCTMVLGH 613

>Scas_713.7
          Length = 983

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 79/199 (39%), Gaps = 44/199 (22%)

Query: 217 ETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTR-FLQAPH 275
           E   ++TE D+L       +VK     Q  S+LY+ +EF   G  + LL   +  +    
Sbjct: 64  ELIEIMTEIDLLKNLNHVNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELD 123

Query: 276 ARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKI 335
           A+ YI +    +  LH+ G  HRD+K  N L+DS   +KL DFG+           S K+
Sbjct: 124 AKVYIRQTLNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGV-----------STKV 172

Query: 336 RLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTV 395
                                            N A +  GS  +M+ E++  +      
Sbjct: 173 S--------------------------------NTAMTLAGSLHWMSPEIIGNRGASTLS 200

Query: 396 DYWSLGCILFESLVGYTPF 414
           D WSLG  + E + G  PF
Sbjct: 201 DIWSLGATVVELVTGNPPF 219

>Kwal_14.1416
          Length = 365

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 72/170 (42%), Gaps = 34/170 (20%)

Query: 248 SLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLI 307
           ++YL  E +    ++ +      L   H +++  ++  A+ A+H     HRD+KP N L+
Sbjct: 89  AVYLVQELMETDLHKVISSGGASLSDDHIQYFTYQILRALKAIHSAQVIHRDIKPSNLLL 148

Query: 308 DSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLREND 367
           +S   +K+ DFGLA   +S                                  T+ R+N 
Sbjct: 149 NSNCDLKVCDFGLARCLIS---------------------------------STHSRQNL 175

Query: 368 VNYASSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSG 416
           V + +  V +  Y A E+ L  + Y   +D WS GCIL E + G   F G
Sbjct: 176 VGFMTEYVATRWYRAPEIMLTFQQYTVAMDIWSCGCILAEMITGKPLFPG 225

>Scas_648.17
          Length = 340

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 85/201 (42%), Gaps = 47/201 (23%)

Query: 224 ERDILTT-TRSEWLVKLLYAFQDPSSLYLAMEF--VPGGDYRTLLINTRFLQAPHARFYI 280
           E  ILT  T    +++LL   QDP S   A+ F  V   D+R L         P  +FY 
Sbjct: 92  ELKILTNLTGGPNVIELLDIVQDPGSKIPALIFEEVKNMDFRQLYPT---FTLPDIQFYF 148

Query: 281 SEMFCAVDALHQLGYTHRDLKPENFLIDSRGH-IKLTDFGLAAGTVSMERIESMKIRLEE 339
           +++  A++  H +G  HRD+KP+N +ID +   ++L D+GLA                  
Sbjct: 149 TQLLIALNYCHSMGIMHRDVKPQNVMIDPKERKLRLIDWGLA------------------ 190

Query: 340 VKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWS 399
                             E Y    + +V  AS     P+ +    +    YD+++D WS
Sbjct: 191 ------------------EFYHPGVDYNVRVASRYHKGPELL----VNLNQYDYSLDLWS 228

Query: 400 LGCILFESLVGYTPFSGSSTN 420
           +GC+L   +    PF   S+N
Sbjct: 229 VGCMLAAIVFKREPFFKGSSN 249

>YDR283C (GCN2) [1112] chr4 complement(1025062..1030041)
            Serine/threonine protein kinase that regulates initiation
            of translation by phosphorylation of eIF2alpha (Sui2p),
            involved in general amino acid control response and salt
            tolerance [4980 bp, 1659 aa]
          Length = 1659

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 122/281 (43%), Gaps = 49/281 (17%)

Query: 225  RDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTL--LINTRFLQAPHARFY--I 280
            + I    R    VK + A +  S+L++ ME+    + RTL  LI++  L      ++   
Sbjct: 760  KSIQNVPRRRNFVKPMTAVKKKSTLFIQMEYC---ENRTLYDLIHSENLNQQRDEYWRLF 816

Query: 281  SEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEV 340
             ++  A+  +H  G  HRDLKP N  ID   ++K+ DFGLA                   
Sbjct: 817  RQILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLAKNV---------------H 861

Query: 341  KNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAK-NYDFTVDYWS 399
            ++LD  K + +++    +  T           S +G+  Y+A EVL+   +Y+  +D +S
Sbjct: 862  RSLDILKLDSQNLPGSSDNLT-----------SAIGTAMYVATEVLDGTGHYNEKIDMYS 910

Query: 400  LGCILFESLVGYTPFS-GSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA 458
            LG I FE +    PFS G       + LR    +   P  D+ +     +    IIRL+ 
Sbjct: 911  LGIIFFEMIY---PFSTGMERVNILKKLRS-VSIEFPPDFDDNKMKVEKK----IIRLLI 962

Query: 459  D------PISRLRSFEHVKKMKYFAEISFENLRNVSPPFIP 493
            D      P +R         +K+  E+  E L+++S P  P
Sbjct: 963  DHDPNKRPGARTLLNSGWLPVKHQDEVIKEALKSLSNPSSP 1003

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 97/256 (37%), Gaps = 58/256 (22%)

Query: 228 LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHAR--FYISEMFC 285
           L   +S  +   +    +  S+++ ME+  GG    LL  +     P  +  F I E+  
Sbjct: 68  LAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTL 127

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDF 345
            +  LH+    HRD+K  N L++  G +KL DFG++    S  + ++             
Sbjct: 128 GLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTLKRDTF------------ 175

Query: 346 PKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVL--EAKNYDFTVDYWSLGCI 403
                                        VG+P +MA EV+  E   Y+   D WSLG  
Sbjct: 176 -----------------------------VGTPYWMAPEVVCCEVDGYNEKADIWSLGIT 206

Query: 404 LFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIR-LIADPIS 462
            +E L G  P S     +   NL       R+P    G   FSD   D +   L+  P  
Sbjct: 207 TYELLKGLPPLSKYDPMKVMTNLP-----KRKPPKLQG--PFSDAAKDFVAGCLVKTPAD 259

Query: 463 R-----LRSFEHVKKM 473
           R     L SFE VK +
Sbjct: 260 RPSAYNLLSFEFVKNI 275

>Scas_700.34
          Length = 864

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 107/250 (42%), Gaps = 57/250 (22%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGD-YRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           +VKL    Q+   + + +E+  GG+ Y+ +    R  + P  R + +++   V  +H  G
Sbjct: 119 IVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPACRLF-AQLINGVHYIHSKG 177

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             HRDLK EN L+D   ++ +TDFG  +                                
Sbjct: 178 LVHRDLKLENLLLDKHENLIITDFGFVS-------------------------------- 205

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYT 412
              E Y++          ++ GSP Y A E V+  K Y+    D WS G IL+  L GY 
Sbjct: 206 ---EFYSH-----GELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYL 257

Query: 413 PFSGSSTNETYENL-RCWKQVLRRPRCDNGRYAFSDR----TWDLIIR-LIADPISRLRS 466
           P+   + N   +++ R +  + + P        F D       DL+ R LI+DP  R+ +
Sbjct: 258 PWDDDAGNPDGDDISRLYHYITQTP------LKFPDYINPIPRDLLRRILISDPRRRI-T 310

Query: 467 FEHVKKMKYF 476
            ++++K ++ 
Sbjct: 311 IKYIEKHEWL 320

>Scas_693.17
          Length = 1049

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 74/183 (40%), Gaps = 42/183 (22%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
            Y+  E+V GG     +I    L+   AR +  ++  A+  LH     HRDLK EN +I 
Sbjct: 175 FYMLFEYVSGGQLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMIS 234

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
             G+IKL DFGL+                                     +Y     +  
Sbjct: 235 KDGNIKLIDFGLS------------------------------------NLY-----DKC 253

Query: 369 NYASSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLR 427
           N   +  GS  + A E+L+A  Y    +D WS G +L+  + G  PF   ++N  +E ++
Sbjct: 254 NKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSNVLHEKIK 313

Query: 428 CWK 430
             K
Sbjct: 314 QGK 316

>Kwal_26.8709
          Length = 829

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 89/205 (43%), Gaps = 45/205 (21%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGD-YRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           +V+L    Q+   + + +E+  GG+ Y+ +    R  + P  R + +++   V  +H  G
Sbjct: 107 IVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPACRLF-AQLISGVYYMHSKG 165

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             HRDLK EN L+D   ++ +TDFG                        +F         
Sbjct: 166 LVHRDLKLENLLLDKNENLLITDFGFVN---------------------EF--------- 195

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYT 412
                   L EN++    ++ GSP Y A E V+ A+ Y+    D WS G IL+  L GY 
Sbjct: 196 --------LPENEL--MKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYL 245

Query: 413 PFSGSSTNETYENL-RCWKQVLRRP 436
           P+     N   +++ + ++ + R P
Sbjct: 246 PWDDDPENPDGDDIGKLYRYITRTP 270

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 83/204 (40%), Gaps = 43/204 (21%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           +V+L    Q+   + + +E+  GG++   +   R L+   A    +++   V  +H    
Sbjct: 115 VVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLISGVTYMHSKNL 174

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMND 355
            HRDLK EN L+D   ++ +TDFG                      N   P         
Sbjct: 175 VHRDLKLENLLLDKNENLVITDFGFV--------------------NEFLP--------- 205

Query: 356 RREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNY-DFTVDYWSLGCILFESLVGYTP 413
                      D  Y  ++ GSP Y A E V+  + Y     D WS G IL+  L GY P
Sbjct: 206 -----------DNEYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLP 254

Query: 414 FSGSSTNETYENL-RCWKQVLRRP 436
           +   STN   +++ + ++ + R P
Sbjct: 255 WDDDSTNPEGDDIGKLYQYITRTP 278

>KLLA0D11990g join(complement(1023928..1023944),
           gi|2499590|sp|Q92241|PH85_KLULA Kluyveromyces lactis
           NEGATIVE REGULATOR OF THE PHO SYSTEM, hypothetical start
          Length = 304

 Score = 64.3 bits (155), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 87/205 (42%), Gaps = 48/205 (23%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLIN------TRFLQAPHAR 277
           E  ++   + + +V+L       + L L  EF+   D +  + N       + L+    +
Sbjct: 53  EISLMKELKHDNIVRLFDVIHTENKLTLVFEFM-DNDLKKFMDNRNKGNSHKGLEMDLVK 111

Query: 278 FYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRL 337
           ++  ++   V   H+    HRDLKP+N LI++RG +KL DFGLA                
Sbjct: 112 YFQWQLLQGVAFCHENRILHRDLKPQNLLINNRGQLKLGDFGLA---------------- 155

Query: 338 EEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVL-EAKNYDFTVD 396
              +    P                     VN  SS V +  Y A +VL  ++NY  ++D
Sbjct: 156 ---RAFGIP---------------------VNTFSSEVVTLWYRAPDVLMGSRNYCTSID 191

Query: 397 YWSLGCILFESLVGYTPFSGSSTNE 421
            WS GCIL E ++G   F GS+  E
Sbjct: 192 IWSCGCILAEMIMGKPLFPGSNDEE 216

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 78/193 (40%), Gaps = 43/193 (22%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGY 295
           +V+L    Q+   + + +++  GG++   +   R L+ P A    +++   V  +H  G 
Sbjct: 110 IVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQLISGVHYIHYKGL 169

Query: 296 THRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMND 355
            HRDLK EN L+D   ++ +TDFG                                    
Sbjct: 170 AHRDLKLENLLLDEHENLIITDFGFV---------------------------------- 195

Query: 356 RREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNYDFT-VDYWSLGCILFESLVGYTP 413
                    +ND+    ++ GSP Y A E V+ +K Y     D WS G IL+  L GY P
Sbjct: 196 -----NEFHKNDL--MRTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLP 248

Query: 414 FSGSSTNETYENL 426
           +     N   E++
Sbjct: 249 WDDDPENPEGEDI 261

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 103/259 (39%), Gaps = 71/259 (27%)

Query: 221 VLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGD-YRTLLINTRFLQAPHARFY 279
            L E DI T       +  LY F D    Y+ ME+  GGD Y  +  +    +  +    
Sbjct: 113 ALYEVDIQTKIGKHKNITELYDFFDS---YIIMEYCSGGDLYEAIKDDMVPRKTKNVTNI 169

Query: 280 ISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLA-AGTVSMERIESMKIRLE 338
           I+++  AV+ +H  G  HRD+KPEN LI    +IKLTD+GLA     SMER         
Sbjct: 170 INQILDAVEYVHSRGIYHRDIKPENILIAGNWNIKLTDWGLATTDKTSMER--------- 220

Query: 339 EVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAK--------N 390
                                               VGS  YMA E+ E+          
Sbjct: 221 -----------------------------------NVGSERYMAPELFESNLDREERTDA 245

Query: 391 YDFT-VDYWSLGCILFESLVGYTPFS-GSSTNETYENLRCWKQVLRRPRCDNGRYAFSDR 448
           YD   VD W++G ++   +    PF+  + T++ +    C+    R    D     FS  
Sbjct: 246 YDCAKVDIWAIGIVMLNIVFHKNPFTVANQTDKAF----CYFAANREALFD----VFSTM 297

Query: 449 TWDL--IIR--LIADPISR 463
           ++D   ++R  L  DP +R
Sbjct: 298 SYDFFQVLRHALTIDPTNR 316

>CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces
           cerevisiae YGR040w KSS1, start by similarity
          Length = 398

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 76/169 (44%), Gaps = 32/169 (18%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
           +YL  E +   D   +L ++  L   H ++++ ++  A+ A+H     HRDLKP N L++
Sbjct: 112 IYLVQELM-ETDLSRILASSNTLTVDHIQYFLYQILRALKAIHSAKVIHRDLKPSNILLN 170

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
           S   +K+ DFGLA                   +  D P  +  +MN           N+V
Sbjct: 171 SNCDLKICDFGLA-------------------RTYD-PDDDASTMNG----------NNV 200

Query: 369 NYASSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSG 416
            + +  V +  Y A E+ L  ++Y   +D WS GC+L E L     F G
Sbjct: 201 GFLTEYVATRWYRAPEIMLNFQDYSTAIDIWSCGCVLAEMLFRKPIFPG 249

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 83/191 (43%), Gaps = 48/191 (25%)

Query: 230 TTRSEWLVKL--LYAFQDPSSLYLAMEFVPGGD----YRTLLINTRFLQAPHARFYISEM 283
           + +S+++V+   ++A ++ S++++AME++ G      Y+ LL     +           +
Sbjct: 231 SCKSDFIVRYYGMFACEETSTIFIAMEYMGGRSLDSVYKHLLSKGGRIGEKVLGKIAESV 290

Query: 284 FCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNL 343
              +  LH+    HRD+KP+N L +  G IKL DFG     VS E + S+          
Sbjct: 291 LRGLFYLHERKIIHRDIKPQNILFNEIGQIKLCDFG-----VSGEAVNSL---------- 335

Query: 344 DFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCI 403
                                      A++  G+  YMA E ++ + Y  T D WSLG  
Sbjct: 336 ---------------------------ATTFTGTSYYMAPERIQGQPYSVTSDVWSLGLT 368

Query: 404 LFESLVGYTPF 414
           L E   G++PF
Sbjct: 369 LLEVAQGHSPF 379

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 84/223 (37%), Gaps = 64/223 (28%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSS-LYLAMEFVPGGDYRTLLINTRFLQA---PHARFY 279
           E  IL       ++K+     D S+ LY+  E +PGGD  + L     L       A  +
Sbjct: 205 EAKILMQLNHPNIIKVFKTHTDKSNNLYIFQELIPGGDLFSYLAKGDCLMPISQTEALVF 264

Query: 280 ISEMFCAVDALHQLGYTHRDLKPENFLI---DSRGHIKLTDFGLAAGTVSMERIESMKIR 336
           + ++  A+  LH  G  HRDLK +N L+   +    I L DFG+A    +M         
Sbjct: 265 VYQILHALKYLHTKGIVHRDLKLDNILLCTPEPFTKIVLADFGIARTVTTM--------- 315

Query: 337 LEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEV----------- 385
                              +  M+T             VG+P+Y A EV           
Sbjct: 316 -------------------KSRMFT------------VVGTPEYCAPEVGFKANRKAYHS 344

Query: 386 ------LEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNET 422
                 LE + YD   D WSLG I    L G +PF G  T ++
Sbjct: 345 FFRAATLEQQGYDSKCDLWSLGVITHIMLTGISPFYGDGTEQS 387

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 77/193 (39%), Gaps = 43/193 (22%)

Query: 240 LYAFQDPSS-LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHR 298
           LY  Q  S+  Y+  EF+ GG     +I    L+  HAR     +  A+  LH     HR
Sbjct: 156 LYEMQTLSNHYYMFFEFISGGQLLDYIIQHGSLKENHARKVSRGILSALQYLHANNIVHR 215

Query: 299 DLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRRE 358
           DLK EN ++   G IKL DFGL+                              +M D R+
Sbjct: 216 DLKIENIMLSKTGEIKLIDFGLS------------------------------NMYDPRK 245

Query: 359 MYTNLRENDVNYASSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTPFSGS 417
                            GS  + A E+L+A  Y    VD WS G +L+  + G  PF   
Sbjct: 246 SLQTF-----------CGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE 294

Query: 418 STNETYENLRCWK 430
           +++  +E ++  K
Sbjct: 295 NSSALHEKIKKGK 307

>CAGL0H01199g 110610..115556 highly similar to sp|P15442
           Saccharomyces cerevisiae YDR283c GCN2 ser/thr protein
           kinase, start by similarity
          Length = 1648

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 80/174 (45%), Gaps = 37/174 (21%)

Query: 247 SSLYLAMEFVPGGDYRTL--LINTRFLQAPHARFY--ISEMFCAVDALHQLGYTHRDLKP 302
           S+L++ ME+      RTL  LI+   L      ++    ++  A+  +H  G  HRDLKP
Sbjct: 772 STLFIQMEYCEN---RTLYDLIHNEGLNKERDEYWRLFRQILEALSYIHSQGIIHRDLKP 828

Query: 303 ENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTN 362
            N  ID   ++K+ DFGLA                   K+LD  K +           + 
Sbjct: 829 MNIFIDESRNVKIGDFGLAKNV---------------HKSLDALKLD-----------SQ 862

Query: 363 LRENDVNYASSTVGSPDYMALEVLEAK-NYDFTVDYWSLGCILFESLVGYTPFS 415
           +    V+  +S +G+  Y+A EVL  K NY+  +D +SLG I FE +    PFS
Sbjct: 863 MSTGSVDDLTSAIGTALYVATEVLTGKGNYNEKIDMYSLGIIFFEMIY---PFS 913

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query: 251 LAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSR 310
           +  E+ P      ++ +  F+    AR +I  +   +++LH+ G  HR +  E  L+   
Sbjct: 346 ILTEYSPAYSVGEIVQSVNFVNLATARVWIIRLLEGLESLHKAGIPHRCISLETVLL--- 402

Query: 311 GHIKLTDFG 319
             +K TD G
Sbjct: 403 --LKDTDLG 409

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 82/203 (40%), Gaps = 45/203 (22%)

Query: 228 LTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLIN--TRFLQAPHARFYISEMFC 285
           L   +S ++   +    +  S+++AME+  GG    LL    T  L     RF   E+  
Sbjct: 55  LAELKSPYVTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILK 114

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDF 345
            +  LH     HRD+K  N L+   G +KL+DFG++   +S                   
Sbjct: 115 GLSYLHSQRKIHRDIKAANILLTDEGKVKLSDFGVSGKLLS------------------- 155

Query: 346 PKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVL--EAKNYDFTVDYWSLGCI 403
                   + RR+ +              VG+P +MA E++  +++ YD   D WSLG  
Sbjct: 156 --------SFRRDTF--------------VGTPYWMAPEIVAHDSEGYDERADIWSLGIT 193

Query: 404 LFESLVGYTPFSGSSTNETYENL 426
           + E L G  P S     +   NL
Sbjct: 194 VIEMLRGSPPLSKYDPMKVIANL 216

>KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces
           cerevisiae YBL016w FUS3 mitogen-activated protein kinase
           (MAP kinase), start by similarity
          Length = 371

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 92/200 (46%), Gaps = 23/200 (11%)

Query: 222 LTERDILTTTRSEWLVKLLYAFQDPSS------LYLAMEFVPGGDYRTLLINTRFLQAPH 275
           L E  IL   + E ++ + +  Q PSS      +Y+  E +    +R ++  T+ L   H
Sbjct: 57  LREIKILKHFQHENIISI-FDVQKPSSFEQFNEVYIIQELMQTDLHRVIV--TQELSEDH 113

Query: 276 ARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKI 335
            ++++ +   A+  LH     HRDLKP N L++S   +K+ DFGLA            +I
Sbjct: 114 VQYFVYQTLRALKVLHGSNVIHRDLKPSNLLLNSNCDLKICDFGLA------------RI 161

Query: 336 RLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEV-LEAKNYDFT 394
             E   + D     + + ++      N  +  ++  +  V +  Y A EV L A  Y  +
Sbjct: 162 VSERATDGDAHVDADDTDDNSPSSAANDGDPAISGMTEYVATRWYRAPEVMLTAAQYSKS 221

Query: 395 VDYWSLGCILFESLVGYTPF 414
           +D WS GCIL E L+G  P 
Sbjct: 222 MDVWSCGCILAE-LLGKQPL 240

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 79/183 (43%), Gaps = 42/183 (22%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
            Y+  E+V GG     +I    L+  HAR ++  +  A+  LH     HRDLK EN +I 
Sbjct: 197 FYMLFEYVSGGQLLDYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMIS 256

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
           + G IK+ DFGL+                    NL          +++++++T       
Sbjct: 257 TSGEIKIIDFGLS--------------------NL---------YDNKKQLHT------- 280

Query: 369 NYASSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLR 427
                  GS  + A E+L+A  Y    VD WS G +++  + G  PF   + +  +E ++
Sbjct: 281 -----FCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASVLHEKIK 335

Query: 428 CWK 430
             K
Sbjct: 336 KGK 338

>CAGL0K01617g complement(142479..144803) similar to sp|P54199
           Saccharomyces cerevisiae YDL028c Serine/threonine
           protein kinase, start by similarity
          Length = 774

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 84/214 (39%), Gaps = 64/214 (29%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSS-LYLAMEFVPGGDYRTLLINTRFLQAPH----ARF 278
           E  +L   +++  V  LY F+  S  LYL ME    GDY    +  +    P      R+
Sbjct: 493 EISLLKQLQNQNRVVQLYDFEMGSGVLYLLMEC---GDYDLSQVLHQRANQPFDMEFIRY 549

Query: 279 YISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLE 338
           +  EM   V  +H  G  H DLKP NF+   +G +K+ DFG+A                 
Sbjct: 550 HAREMVTCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANAV-------------- 594

Query: 339 EVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDF----- 393
                      + ++N  R+M               +G+P+YMA E L A NY       
Sbjct: 595 ----------PDHTVNIYRDM--------------QIGTPNYMAPEALVANNYTADNDGK 630

Query: 394 ------------TVDYWSLGCILFESLVGYTPFS 415
                         D WS GCI+++ + G  P++
Sbjct: 631 YDQKTNKWKIGKPADIWSCGCIIYQMIYGKPPYA 664

>Kwal_23.5668
          Length = 1689

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 81/170 (47%), Gaps = 34/170 (20%)

Query: 247 SSLYLAMEFVPGGDYRTL--LINTRFLQAPHARFY--ISEMFCAVDALHQLGYTHRDLKP 302
           S+L++ ME+    + RTL  LI+T  L A    ++    E+  A+  +H  G  HRDLKP
Sbjct: 810 STLFIQMEYC---ENRTLFDLIHTENLCAQKEEYWRLFREILDALSYIHSQGIIHRDLKP 866

Query: 303 ENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTN 362
            N  ID   +IK+ DFGLA                   KN+       KS+ D   M ++
Sbjct: 867 MNIFIDESRNIKIGDFGLA-------------------KNV------HKSV-DLLRMDSH 900

Query: 363 LRENDVNYASSTVGSPDYMALEVLEAK-NYDFTVDYWSLGCILFESLVGY 411
           +        +S +G+  Y+A EVL    NY+  +D +SLG I FE +  +
Sbjct: 901 ISTASTEDLTSAIGTALYVATEVLTGSGNYNEKIDMYSLGIIFFEMVYSF 950

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 80/191 (41%), Gaps = 48/191 (25%)

Query: 230 TTRSEWLVKLLYAFQDP--SSLYLAMEFVPG----GDYRTLLINTRFLQAPHARFYISEM 283
           + +S+++V+    F D   SS+Y+AME++ G      Y+ LL +   +           +
Sbjct: 289 SCKSDYIVRYYGMFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGGRVGEKVLGKIAESV 348

Query: 284 FCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNL 343
              +  LHQ    HRD+KP+N L++  G +KL DFG     VS E + S+          
Sbjct: 349 LRGLSYLHQRKIIHRDIKPQNILLNEAGQVKLCDFG-----VSGEAVNSL---------- 393

Query: 344 DFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCI 403
                                      A++  G+  YMA E ++ + Y  T D WSLG  
Sbjct: 394 ---------------------------ATTFTGTSYYMAPERIQGQPYSVTSDVWSLGLT 426

Query: 404 LFESLVGYTPF 414
           L E    + PF
Sbjct: 427 LLEVAQAHFPF 437

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 76/183 (41%), Gaps = 42/183 (22%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
            Y+  E+V GG     +I    L+  HAR +   +  A+  LH     HRDLK EN +I 
Sbjct: 207 FYMLFEYVAGGQLLDYIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMIS 266

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
           + G IK+ DFGL+                                + R++++T       
Sbjct: 267 NSGEIKIIDFGLS-----------------------------NVYDTRKQLHT------- 290

Query: 369 NYASSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTPFSGSSTNETYENLR 427
                  GS  + A E+L+A  Y    VD WS G +L+  + G  PF   +++  +E ++
Sbjct: 291 -----FCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIK 345

Query: 428 CWK 430
             K
Sbjct: 346 RGK 348

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 79/191 (41%), Gaps = 52/191 (27%)

Query: 236 LVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARF----YISEMFCAVDALH 291
           + +LL  ++D  +    +E+   GD    +   R  + P  R     ++ ++  A+   H
Sbjct: 71  ICQLLDFYEDADTYVFVLEYCAYGDLYDFIKAIR--ERPTMRINFHSFLFQLCSAISYCH 128

Query: 292 QLGYTHRDLKPENFLIDSRGHIKLTDFGLAA-GTVSMERIESMKIRLEEVKNLDFPKFEE 350
               +HRD+KPEN L+D RG +KLTDFGL+  G+VS +                      
Sbjct: 129 SKDVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKDY--------------------- 167

Query: 351 KSMNDRREMYTNLRENDVNYASSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLV 409
                                   +G+  Y+A E  L   +  F  DYWSLG  +F  + 
Sbjct: 168 -----------------------CIGTEKYLAPETFLREYHNTFATDYWSLGITIFCLMF 204

Query: 410 GYTPFSGSSTN 420
           G  PF  +S++
Sbjct: 205 GSCPFESASSD 215

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 75/177 (42%), Gaps = 41/177 (23%)

Query: 242  AFQDPSSLY-LAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDL 300
             F++ +++Y L +E+V GG   +L+        P  +   +++   +  LH  G  HRD+
Sbjct: 1245 GFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDM 1304

Query: 301  KPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMY 360
            K +N L+D  G  K++DFG++  +  +     M +R                        
Sbjct: 1305 KADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMR------------------------ 1340

Query: 361  TNLRENDVNYASSTVGSPDYMALEVLEAKN-YDFTVDYWSLGCILFESLVGYTPFSG 416
                           G+  +MA E+++ K  Y   VD WSLGCI+ E   G  P+S 
Sbjct: 1341 ---------------GTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSN 1382

>Scas_564.7
          Length = 1210

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 77/183 (42%), Gaps = 42/183 (22%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
            Y+  E+V GG     +I    L+  HAR +   +  A++ +H     HRDLK EN +I 
Sbjct: 261 FYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMIS 320

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
           + G IK+ DFGL+                                + +++++T       
Sbjct: 321 TSGEIKIIDFGLS-----------------------------NVFDRKKQLHT------- 344

Query: 369 NYASSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTPFSGSSTNETYENLR 427
                  GS  + A E+L+A  Y    VD WS G +L+  + G  PF   +++  +E ++
Sbjct: 345 -----FCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIK 399

Query: 428 CWK 430
             K
Sbjct: 400 QGK 402

>KLLA0B11946g complement(1048033..1049352) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, start by similarity
          Length = 439

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/258 (27%), Positives = 103/258 (39%), Gaps = 65/258 (25%)

Query: 236 LVKLLYAFQDP-SSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294
           L+ L    ++P S LY   E V     R +  N  F +  H + ++ ++ C +  +H   
Sbjct: 139 LIDLEIVNEEPYSGLYCYQELVDYDLARVIHSNVLFSEF-HIKHFLYQILCGMKYIHSAD 197

Query: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354
             HRDLKP N L    G IK+ DFGLA G                      P F      
Sbjct: 198 VIHRDLKPGNILCSITGEIKICDFGLARGIS--------------------PSF------ 231

Query: 355 DRREMYTNLRENDVNYASSTVGSPDYMALE-VLEAKNYDFTVDYWSLGCILFESLVGYTP 413
                   +     N+ ++ V +  Y A E +L  K Y  +VD W++GCIL E   G  P
Sbjct: 232 -------TVAGGISNHITNYVATRWYRAPELILSHKRYSKSVDMWAVGCILAE-FYGRKP 283

Query: 414 -FSGSSTNE------------------TYENLRCW-------KQVLRRPRCDNGRYAFSD 447
            F G+ +                    TY + RC+        Q  + P C+   YA S+
Sbjct: 284 VFMGNDSLHQVMEIQKILGTPKQIVIRTYGSSRCYDIFSTSKPQYKKTPWCEIFPYASSE 343

Query: 448 RTWDLIIRLI-ADPISRL 464
              DL+ RLI  +P +RL
Sbjct: 344 AV-DLMERLIDWNPEARL 360

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 80/188 (42%), Gaps = 46/188 (24%)

Query: 236 LVKLLYAFQDPSSLYLAMEF--VPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQL 293
           ++ LL   QDP S   A+ F  V   D+RTL  +         +FY +++  A+D  H +
Sbjct: 106 IIGLLDIVQDPGSKIPALIFEEVKNVDFRTLYPS---FTLSDTQFYFTQLLTALDYCHSM 162

Query: 294 GYTHRDLKPENFLID-SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKS 352
           G  HRD+KP+N +ID +   ++L D+GLA                               
Sbjct: 163 GIMHRDVKPQNVMIDPNERKLRLIDWGLA------------------------------- 191

Query: 353 MNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYT 412
                E Y    + ++  AS     P+ +    +    YD+++D W++GC++   +    
Sbjct: 192 -----EFYHPGVDYNIRVASRYHKGPELL----VSLNQYDYSLDLWAVGCMIAAIVFKKE 242

Query: 413 PFSGSSTN 420
           PF   STN
Sbjct: 243 PFFKGSTN 250

>Scas_707.36
          Length = 915

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 107/265 (40%), Gaps = 41/265 (15%)

Query: 219 NHVLTERDILTTTRSEWLVKLLYAFQDPSS--LYLAMEFVPGGDY-----RTLLINTRF- 270
           N +  E  I+    ++ +VKL+    D SS  +YL +E+   G         L I++R  
Sbjct: 142 NKIKKEIAIMKKCNNKHVVKLIEILDDLSSRKIYLVLEYCEKGPILWCPRDQLEIDSRGP 201

Query: 271 --LQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSME 328
             L    AR    ++   ++ LH  G  HRD+KP N L+D  G +K++DFG++       
Sbjct: 202 PQLSFQRAREIFRDVILGLEYLHSQGIIHRDIKPANLLMDKNGVVKISDFGVSLAANG-- 259

Query: 329 RIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEA 388
            I++    LE  K +  P F                  ++   ++ +   +    E+   
Sbjct: 260 NIDTNDDELELTKTVGTPVFYAP---------------EICLGAAAMERFNLDKDELFNG 304

Query: 389 KNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDR 448
               F +D W+LG  L+  L G  PF      + +E  +   + LR P            
Sbjct: 305 SCISFKIDIWALGITLYCLLFGMLPFVSEFELKLFE--KIVNEKLRFP------------ 350

Query: 449 TWDLIIRLIADPISRLRSFEHVKKM 473
           T++ +       IS +R F H K +
Sbjct: 351 TFETLQDNHISEISHIREFVHAKDL 375

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 77/183 (42%), Gaps = 42/183 (22%)

Query: 249 LYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLID 308
            Y+  E+V GG     +I    L+  HAR +   +  A+  LH     HRDLK EN +I 
Sbjct: 155 FYMLFEYVSGGQLLDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMIS 214

Query: 309 SRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDV 368
           S G I++ DFGL+                    N+  PK         ++++T       
Sbjct: 215 SSGEIRIIDFGLS--------------------NMYDPK---------KQLHT------- 238

Query: 369 NYASSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTPFSGSSTNETYENLR 427
                  GS  + A E+L+A  Y    VD WS G +L+  + G  PF   + +  +E ++
Sbjct: 239 -----FCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASVLHEKIK 293

Query: 428 CWK 430
             K
Sbjct: 294 QGK 296

>Scas_711.25
          Length = 1515

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 74/176 (42%), Gaps = 41/176 (23%)

Query: 242  AFQDPSSLY-LAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDL 300
             F++  ++Y L +E+V GG   +L+        P  R   +++   +  LH  G  HRD+
Sbjct: 1284 GFENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIRHLNTQVLRGLAYLHSRGILHRDM 1343

Query: 301  KPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMY 360
            K +N L+D  G  K++DFG++  +  +     M +R                        
Sbjct: 1344 KADNLLLDQDGVCKISDFGISRKSKDIYSNSDMTMR------------------------ 1379

Query: 361  TNLRENDVNYASSTVGSPDYMALEVLEAK-NYDFTVDYWSLGCILFESLVGYTPFS 415
                           G+  +MA E+++ K  Y   VD WSLGCI+ E   G  P+S
Sbjct: 1380 ---------------GTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWS 1420

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 78/190 (41%), Gaps = 48/190 (25%)

Query: 232 RSEWLVKLLYAFQD--PSSLYLAMEFVPG----GDYRTLLINTRFLQAPHARFYISEMFC 285
           +SE++V+    F D   SS+Y+AME++ G      Y+ LL     +           +  
Sbjct: 276 QSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLR 335

Query: 286 AVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDF 345
            +  LH+    HRD+KP+N L++  G +KL DFG     VS E + S+            
Sbjct: 336 GLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFG-----VSGEAVNSL------------ 378

Query: 346 PKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILF 405
                                    A++  G+  YMA E ++ + Y  T D WSLG  + 
Sbjct: 379 -------------------------ATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTIL 413

Query: 406 ESLVGYTPFS 415
           E   G  P S
Sbjct: 414 EVANGKFPCS 423

>Scas_633.29
          Length = 789

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 86/211 (40%), Gaps = 61/211 (28%)

Query: 224 ERDILTTTRSEWLVKLLYAFQ-DPSSLYLAMEFVPGGDYRTLLINTRFLQAP----HARF 278
           E ++L    +E  V  L+ +Q D   L+L ME    GD+    I ++    P      R+
Sbjct: 346 EIELLEKLSNESRVVKLFDYQMDSGVLFLIMEC---GDHDLSQILSQRSDMPLDMDFVRY 402

Query: 279 YISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLE 338
           +  E+   +  +H  G  H DLKP NF+   +G +K+ DFG+A                 
Sbjct: 403 HAREVVRCIKIVHDAGIVHSDLKPANFVF-VKGILKIIDFGIANA--------------- 446

Query: 339 EVKNLDFPKFEEKSMNDRREMYTNLRENDVN-YASSTVGSPDYMALEVLEAKNYDFT--- 394
                                   + ++ VN Y  + +G+P+YMA E L A NY      
Sbjct: 447 ------------------------IPDHTVNIYRENQIGTPNYMAPEALVAMNYTNENDG 482

Query: 395 ---------VDYWSLGCILFESLVGYTPFSG 416
                     D WS GCI+++ + G  P++G
Sbjct: 483 GNKWKVGKPSDIWSCGCIIYQMIYGRPPYAG 513

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 91/234 (38%), Gaps = 59/234 (25%)

Query: 224 ERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGD-YRTLLINTRFLQAPHARFYISE 282
           E  IL       +V+    F+     Y+  +   GG+ +  +L   +F +   A F + +
Sbjct: 95  ELSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEV-DAVFIVKQ 153

Query: 283 MFCAVDALHQLGYTHRDLKPENFLIDSRGH---IKLTDFGLAAGTVSMERIESMKIRLEE 339
           +   V  LHQ    HRDLKPEN L  ++     + + DFG+A                  
Sbjct: 154 ILQGVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIA------------------ 195

Query: 340 VKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWS 399
                      K + D  E+        ++ A+ ++G   Y+A EVL +  +    D WS
Sbjct: 196 -----------KELKDDNEL--------IHKAAGSMG---YVAPEVLTSSGHGKPCDIWS 233

Query: 400 LGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGRY--AFSDRTWD 451
           +G I +  L GY+PF   S +   E             C +G+Y   F    W+
Sbjct: 234 IGVITYTLLCGYSPFLAESADGFIE------------ECTSGQYPVVFHKPYWN 275

>AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH]
            complement(196774..201870) [5097 bp, 1698 aa]
          Length = 1698

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 114/262 (43%), Gaps = 55/262 (20%)

Query: 247  SSLYLAMEFVPGGDYRTL--LINTRFLQAPHARFY--ISEMFCAVDALHQLGYTHRDLKP 302
            S+L++ ME+    + RTL  LI+   L      ++    ++  A+  +H  G  HRDLKP
Sbjct: 821  STLFIQMEYC---ENRTLYDLIHNENLSQQRDEYWRLFRQILEALSYIHSQGIIHRDLKP 877

Query: 303  ENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTN 362
             N  ID   +IK+ DFGLA        I    +R+E                      +N
Sbjct: 878  MNIFIDESRNIKIGDFGLAKNVHKSADI----LRIEGA------------------FGSN 915

Query: 363  LRENDVNYASSTVGSPDYMALEVLEAK-NYDFTVDYWSLGCILFESLVGYTPFSGSSTNE 421
            +  +D+   +S +G+  Y+A EVL    NY+  +D +SLG I FE +  +      +T+ 
Sbjct: 916  VSADDL---TSAIGTALYVASEVLTGNGNYNEKIDMYSLGIIFFEMVYHFDTLMERATD- 971

Query: 422  TYENLRCWKQVLRRPRCDN----GRYAFSDRTWDLIIRLIA--DPISRLRSFEHVKK--- 472
                       LR+ R         +  S R    IIRL+   DP  R  + + +     
Sbjct: 972  -----------LRKLRSSAVELPANFDSSKRNEKKIIRLLLDHDPAKRPTAAKLLASGWL 1020

Query: 473  -MKYFAEISFENLRNVSPPFIP 493
             +K+  E++ E L+N++ P  P
Sbjct: 1021 PVKHQDEVTKEALKNLADPSSP 1042

>Scas_710.28
          Length = 352

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 79/176 (44%), Gaps = 33/176 (18%)

Query: 242 AFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLK 301
           +F++ + +Y+  E +    +R  +I+T+ L   H +++I +   AV  LH     HRDLK
Sbjct: 82  SFENFNEVYIIQELMQTDLHR--VISTQNLTDDHIQYFIYQTLRAVKVLHGSNVIHRDLK 139

Query: 302 PENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYT 361
           P N LI+S   +K+ DFGLA       RI                  EE + +D  E   
Sbjct: 140 PSNLLINSNCDLKICDFGLA-------RI-----------------IEEDTGDD--EPNA 173

Query: 362 NLRENDVNYASSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSG 416
            L+     Y ++      Y A EV L A  Y   +D WS GCIL E  +    F G
Sbjct: 174 QLQNGMTEYVATRW----YRAPEVMLTAARYSKAMDIWSCGCILAELFMKRPIFPG 225

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 68/160 (42%), Gaps = 36/160 (22%)

Query: 248 SLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLI 307
            LY   E +     R +  N +F +  H + +  ++ C V  +H     HRDLKP N L 
Sbjct: 152 GLYCYQELIDYDLARVIHSNVQFSEF-HIKHFTYQILCGVKYIHSADVIHRDLKPGNILC 210

Query: 308 DSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLREND 367
              G +K+ DFGLA G                                   ++TN + + 
Sbjct: 211 SISGQLKICDFGLARGI--------------------------------SPLFTNTKTS- 237

Query: 368 VNYASSTVGSPDYMALE-VLEAKNYDFTVDYWSLGCILFE 406
            N+ ++ V +  Y A E +L  K Y+ ++D W++GCIL E
Sbjct: 238 -NHITNYVATRWYRAPELILSHKRYNKSIDMWAIGCILAE 276

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,627,622
Number of extensions: 816544
Number of successful extensions: 3832
Number of sequences better than 10.0: 646
Number of HSP's gapped: 3620
Number of HSP's successfully gapped: 984
Length of query: 563
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 456
Effective length of database: 12,891,983
Effective search space: 5878744248
Effective search space used: 5878744248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)