Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.398587686442700.0
YPR112C (MRD1)88789526310.0
KLLA0D14949g87889126300.0
Scas_705.2286988525630.0
ADR035C83886824510.0
CAGL0B04169g86187924450.0
Scas_88.125624510081e-131
CAGL0E03245g4251861925e-15
KLLA0C17600g5921831901e-14
Scas_621.104151851863e-14
Scas_576.75752001874e-14
YER165W (PAB1)5771751864e-14
AGR122C5852001839e-14
CAGL0L11792g5792001821e-13
YGR159C (NSR1)4141861792e-13
KLLA0C11495g4451821792e-13
AFR107W3961861773e-13
Sklu_1838.35894411776e-13
Sklu_1879.44211821731e-12
YHR015W (MIP6)6593331687e-12
Kwal_56.234865872001562e-10
Sklu_2442.114642051302e-07
AGL250W7291961303e-07
Sklu_2307.26971371303e-07
YCL011C (GBP2)4271741274e-07
CAGL0J11154g3801951248e-07
CAGL0L03806g2551091229e-07
YNL004W (HRB1)4293121241e-06
AFL224W206791191e-06
Scas_701.3321601221e-06
KLLA0F07799g5241311222e-06
Scas_565.8322861212e-06
Scas_558.14353551222e-06
CAGL0M03795g5131621203e-06
Kwal_27.103644433411194e-06
YNL110C (NOP15)220811154e-06
KLLA0A08338g7661031196e-06
Kwal_27.118326861911178e-06
KLLA0D08206g391831169e-06
Sklu_2407.32211031139e-06
CAGL0I08943g6021691161e-05
YNL175C (NOP13)4032001141e-05
Kwal_33.15208186791101e-05
Sklu_2353.52521011121e-05
AEL016C6781741151e-05
YIL061C (SNP1)300601122e-05
ADL063W320741132e-05
Sklu_1715.13962351132e-05
Scas_696.324453381132e-05
KLLA0A05346g874741142e-05
Sklu_1790.3473731123e-05
Kwal_23.5864278481103e-05
CAGL0A04213g639801123e-05
Scas_637.2377841114e-05
KLLA0C12925g5701801105e-05
CAGL0H03861g4432481097e-05
Scas_376.14041891088e-05
KLLA0F23650g312791078e-05
Scas_666.112241151058e-05
ADR017W173921039e-05
Scas_635.7581511081e-04
AAR151W4812771071e-04
ABL134C375781071e-04
CAGL0E01947g452501071e-04
ADR183C320591061e-04
YBL051C (PIN4)668801081e-04
YOL123W (HRP1)534751071e-04
YPL043W (NOP4)685891071e-04
CAGL0I09900g211811031e-04
ADL160W526481062e-04
ACR235W578801062e-04
YIR001C (SGN1)250971032e-04
Scas_500.6621801062e-04
Sklu_2182.3371791052e-04
Kwal_0.2502161631022e-04
YOL041C (NOP12)459491052e-04
Scas_316.1483891052e-04
KLLA0B00847g269561032e-04
YBR212W (NGR1)672731052e-04
Kwal_47.18572363971043e-04
YNL016W (PUB1)4531741033e-04
KLLA0C05522g540731043e-04
Kwal_33.14463393781033e-04
CAGL0L12672g682891044e-04
Scas_717.413791001024e-04
CAGL0D06182g280721005e-04
Scas_697.106102051025e-04
Kwal_26.845821977995e-04
CAGL0C01529g23660996e-04
KLLA0D11792g685891026e-04
Sklu_1706.16722891026e-04
KLLA0B00979g342821007e-04
KLLA0D13772g3451411007e-04
YDR432W (NPL3)414631008e-04
CAGL0B04807g419201999e-04
KLLA0E11011g43277999e-04
Kwal_26.717945684990.001
Kwal_26.752226270980.001
Scas_671.4443232990.001
Sklu_2375.520770950.001
Kwal_55.2196059775990.001
AFR649W31080970.001
Kwal_27.1109620172950.001
CAGL0H10604g41681970.002
AER285C426220970.002
Kwal_56.2470982874980.002
AGR010C26690950.002
Scas_720.224572940.002
Kwal_33.1481057480960.003
Sklu_2221.828163940.003
YFR023W (PES4)61184960.003
KLLA0E19943g59280950.003
AFL050W21872930.003
YPL178W (CBC2)20865920.003
KLLA0F09383g25870930.003
Kwal_0.370560149950.003
Kwal_55.2090314769890.004
ABL059W20489910.004
CAGL0D05236g44382940.004
Kwal_14.1851535301940.004
AEL217W83474940.005
CAGL0H04763g383141930.005
CAGL0M12573g29977920.005
Scas_643.1644848930.005
Sklu_905.1515193930.006
Scas_598.151649930.006
CAGL0H02211g381124920.006
Kwal_55.2041428480910.007
ACR274W42674920.007
Kwal_55.2097213592860.008
Kwal_27.1233720976890.009
Scas_621.1631470900.009
ADR189W26957900.009
YGL044C (RNA15)29670900.010
Scas_665.421980880.011
Sklu_2213.425758890.012
AAL018W33778900.012
KLLA0C08019g30160890.013
KLLA0F14861g589136890.016
AGR390C37881890.016
Kwal_33.1349633059880.020
ADR001C32497870.021
Kwal_27.11447439169880.021
CAGL0F01023g39647880.022
CAGL0E03630g746118880.024
ADR307W566172870.032
Sklu_2249.430979860.033
KLLA0E08745g475184860.035
Kwal_56.2394580660870.037
YFR032C28983850.041
AGL038C71261850.054
CAGL0I05082g60484840.064
YHR086W (NAM8)52361840.067
CAGL0J02200g14497800.069
Sklu_2257.418887810.071
YIR005W (IST3)14872790.075
Scas_714.5923364810.090
Kwal_30.1289028063810.10
KLLA0F18216g70856830.10
Scas_607.10605113830.11
CAGL0H04675g27464810.11
CAGL0H02123g55561820.12
Sklu_1984.3284112810.13
Kwal_55.2015452261820.13
CAGL0A03117g232100800.13
YGR250C78180820.14
KLLA0B10472g19872790.15
KLLA0D13420g16662780.16
YDR429C (TIF35)27464790.17
Scas_622.8287106800.17
Sklu_2085.220976780.19
CAGL0H03267g77573800.23
KLLA0E02706g22286770.25
Scas_241.118661760.30
YHL024W (RIM4)71361790.30
CAGL0K06655g80265790.32
YOR319W (HSH49)21371760.36
Scas_530.468460780.37
CAGL0J01914g16994740.43
CAGL0F08217g67885770.54
KLLA0D05016g26269750.60
YHL034C (SBP1)29482750.63
Scas_645.1471730760.69
YDR381W (YRA1)22685740.75
YMR268C (PRP24)444173750.79
ADL371C28455730.99
AFR149C22081731.0
Scas_709.2*17164701.4
KLLA0B11594g11480681.4
KLLA0C07194g29745721.5
KLLA0E00484g24272711.5
CAGL0J05566g81337731.6
KLLA0B09658g34253721.6
Scas_157.1232136711.7
KLLA0C14388g20379701.7
Kwal_23.392840748712.4
KLLA0B08976g30563693.3
YOR361C (PRT1)763112703.6
Scas_683.3227265693.6
Kwal_23.3650299237684.3
Scas_611.1210252644.4
Kwal_55.2103911966645.1
KLLA0C08041g57432685.2
Scas_632.7*22980675.4
KLLA0D16049g42579676.4
YBL035C (POL12)705113678.1
Kwal_23.623334246668.8
AER349C21859659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3985
         (864 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3985                                                         1649   0.0  
YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein w...  1018   0.0  
KLLA0D14949g complement(1259860..1262496) similar to sgd|S000631...  1017   0.0  
Scas_705.22                                                           991   0.0  
ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH] (768392..77...   948   0.0  
CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...   946   0.0  
Scas_88.1                                                             392   e-131
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    79   5e-15
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...    78   1e-14
Scas_621.10                                                            76   3e-14
Scas_576.7                                                             77   4e-14
YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding prot...    76   4e-14
AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH] (978634..98...    75   9e-14
CAGL0L11792g 1259275..1261014 highly similar to sp|P04147 Saccha...    75   1e-13
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    74   2e-13
KLLA0C11495g complement(990832..992169) some similarities with s...    74   2e-13
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    73   3e-13
Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement         73   6e-13
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         71   1e-12
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...    69   7e-12
Kwal_56.23486                                                          65   2e-10
Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement      55   2e-07
AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH] complement(...    55   3e-07
Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement         55   3e-07
YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein inv...    54   4e-07
CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces...    52   8e-07
CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces c...    52   9e-07
YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with simila...    52   1e-06
AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH] complement...    50   1e-06
Scas_701.3                                                             52   1e-06
KLLA0F07799g complement(734889..736463) similar to sp|Q08208 Sac...    52   2e-06
Scas_565.8                                                             51   2e-06
Scas_558.1                                                             52   2e-06
CAGL0M03795g complement(428607..430148) highly similar to sp|Q99...    51   3e-06
Kwal_27.10364                                                          50   4e-06
YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein ...    49   4e-06
KLLA0A08338g 736461..738761 weakly similar to sp|P39684 Saccharo...    50   6e-06
Kwal_27.11832                                                          50   8e-06
KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces c...    49   9e-06
Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement         48   9e-06
CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces c...    49   1e-05
YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleola...    49   1e-05
Kwal_33.15208                                                          47   1e-05
Sklu_2353.5 YIL061C, Contig c2353 10817-11575                          48   1e-05
AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W (...    49   1e-05
YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1 snRNA-a...    48   2e-05
ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH] complement(...    48   2e-05
Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement          48   2e-05
Scas_696.32                                                            48   2e-05
KLLA0A05346g 485886..488510 some similarities with sp|P53316 Sac...    49   2e-05
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            48   3e-05
Kwal_23.5864                                                           47   3e-05
CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces c...    48   3e-05
Scas_637.2                                                             47   4e-05
KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383 S...    47   5e-05
CAGL0H03861g complement(361189..362520) similar to sp|P38922 Sac...    47   7e-05
Scas_376.1                                                             46   8e-05
KLLA0F23650g 2210563..2211501 some similarities with sp|P53927 S...    46   8e-05
Scas_666.11                                                            45   8e-05
ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH] complement(...    44   9e-05
Scas_635.7                                                             46   1e-04
AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH] complement(6...    46   1e-04
ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH] (140625..14...    46   1e-04
CAGL0E01947g 193225..194583 some similarities with sp|Q99383 Sac...    46   1e-04
ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH] (1024792..1...    45   1e-04
YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein wit...    46   1e-04
YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylate...    46   1e-04
YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein r...    46   1e-04
CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces c...    44   1e-04
ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH] complement(...    45   2e-04
ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH] complement(...    45   2e-04
YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein wi...    44   2e-04
Scas_500.6                                                             45   2e-04
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            45   2e-04
Kwal_0.250                                                             44   2e-04
YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein ...    45   2e-04
Scas_316.1                                                             45   2e-04
KLLA0B00847g complement(65983..66792) similar to sp|Q04067 Sacch...    44   2e-04
YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible R...    45   2e-04
Kwal_47.18572                                                          45   3e-04
YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylate...    44   3e-04
KLLA0C05522g 494240..495862 some similarities with sp|P32831 Sac...    45   3e-04
Kwal_33.14463                                                          44   3e-04
CAGL0L12672g complement(1359637..1361685) similar to sp|P37838 S...    45   4e-04
Scas_717.41                                                            44   4e-04
CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces c...    43   5e-04
Scas_697.10                                                            44   5e-04
Kwal_26.8458                                                           43   5e-04
CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces c...    43   6e-04
KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces...    44   6e-04
Sklu_1706.1 YFR023W, Contig c1706 1364-3382                            44   6e-04
KLLA0B00979g 77439..78467 some similarities with sp|Q01560 Sacch...    43   7e-04
KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4 A...    43   7e-04
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    43   8e-04
CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces c...    43   9e-04
KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces c...    43   9e-04
Kwal_26.7179                                                           43   0.001
Kwal_26.7522                                                           42   0.001
Scas_671.4                                                             43   0.001
Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement       41   0.001
Kwal_55.21960                                                          43   0.001
AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073...    42   0.001
Kwal_27.11096                                                          41   0.001
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    42   0.002
AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH] (1162117.....    42   0.002
Kwal_56.24709                                                          42   0.002
AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH] (736609..7...    41   0.002
Scas_720.2                                                             41   0.002
Kwal_33.14810                                                          42   0.003
Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement       41   0.003
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...    42   0.003
KLLA0E19943g 1766853..1768631 weakly similar to sp|P34217 Saccha...    41   0.003
AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH] complement(...    40   0.003
YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of nu...    40   0.003
KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces c...    40   0.003
Kwal_0.370                                                             41   0.003
Kwal_55.20903                                                          39   0.004
ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH] complement(...    40   0.004
CAGL0D05236g 499006..500337 weakly similar to sp|P43607 Saccharo...    41   0.004
Kwal_14.1851                                                           41   0.004
AEL217W [2289] [Homologous to ScYGR250C - SH] complement(225217....    41   0.005
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    40   0.005
CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces...    40   0.005
Scas_643.16                                                            40   0.005
Sklu_905.1 YMR268C, Contig c905 196-1743                               40   0.006
Scas_598.1                                                             40   0.006
CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces c...    40   0.006
Kwal_55.20414                                                          40   0.007
ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH] complement...    40   0.007
Kwal_55.20972                                                          38   0.008
Kwal_27.12337                                                          39   0.009
Scas_621.16                                                            39   0.009
ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH] complement...    39   0.009
YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component...    39   0.010
Scas_665.4                                                             39   0.011
Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement         39   0.012
AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C (G...    39   0.012
KLLA0C08019g complement(704199..705104) some similarities with s...    39   0.013
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    39   0.016
AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH] (1446842..1...    39   0.016
Kwal_33.13496                                                          39   0.020
ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH] (708437..70...    38   0.021
Kwal_27.11447                                                          39   0.021
CAGL0F01023g complement(108155..109345) similar to tr|Q08208 Sac...    39   0.022
CAGL0E03630g complement(335091..337331) weakly similar to sp|P38...    39   0.024
ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH] complement(...    38   0.032
Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement         38   0.033
KLLA0E08745g 782800..784227 some similarities with sp|P32588 Sac...    38   0.035
Kwal_56.23945                                                          38   0.037
YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein...    37   0.041
AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH] (639306..64...    37   0.054
CAGL0I05082g complement(473462..475276) some similarities with s...    37   0.064
YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated ...    37   0.067
CAGL0J02200g complement(215042..215476) similar to sp|P40561 Sac...    35   0.069
Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement         36   0.071
YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in ...    35   0.075
Scas_714.59                                                            36   0.090
Kwal_30.12890                                                          36   0.10 
KLLA0F18216g 1677731..1679857 some similarities with sp|P38741 S...    37   0.10 
Scas_607.10                                                            37   0.11 
CAGL0H04675g complement(447256..448080) highly similar to sp|Q04...    36   0.11 
CAGL0H02123g complement(188454..190121) similar to sp|Q00539 Sac...    36   0.12 
Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement         36   0.13 
Kwal_55.20154                                                          36   0.13 
CAGL0A03117g join(315979..316263,317561..317974) highly similar ...    35   0.13 
YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein...    36   0.14 
KLLA0B10472g complement(914512..915108) similar to sgd|S0006099 ...    35   0.15 
KLLA0D13420g complement(1157491..1157991) some similarities with...    35   0.16 
YDR429C (TIF35) [1252] chr4 complement(1324465..1325289) Transla...    35   0.17 
Scas_622.8                                                             35   0.17 
Sklu_2085.2 YOR319W, Contig c2085 3158-3787                            35   0.19 
CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces c...    35   0.23 
KLLA0E02706g join(256959..257213,258450..258863) similar to sp|Q...    34   0.25 
Scas_241.1                                                             34   0.30 
YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for s...    35   0.30 
CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces c...    35   0.32 
YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein a...    34   0.36 
Scas_530.4                                                             35   0.37 
CAGL0J01914g complement(189309..189818) similar to sp|P40565 Sac...    33   0.43 
CAGL0F08217g complement(814508..816544) similar to sp|P53316 Sac...    34   0.54 
KLLA0D05016g complement(431592..432380) similar to sp|P25555 Sac...    33   0.60 
YHL034C (SBP1) [2252] chr8 complement(33191..34075) Single-stran...    33   0.63 
Scas_645.14                                                            34   0.69 
YDR381W (YRA1) [1208] chr4 (1236546..1236830,1237597..1237992) P...    33   0.75 
YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA...    33   0.79 
ADL371C [1370] [Homologous to ScYBR119W (MUD1) - SH] (55727..565...    33   0.99 
AFR149C [3341] [Homologous to ScYDR381W (YRA1) - SH] (705111..70...    33   1.0  
Scas_709.2*                                                            32   1.4  
KLLA0B11594g complement(1018044..1018388) some similarities with...    31   1.4  
KLLA0C07194g 624694..625587 no similarity, hypothetical start          32   1.5  
KLLA0E00484g complement(45755..46483) similar to sp|P10080 Sacch...    32   1.5  
CAGL0J05566g complement(528304..530745) highly similar to sp|P40...    33   1.6  
KLLA0B09658g complement(837873..838901) similar to sgd|S0006331 ...    32   1.6  
Scas_157.1                                                             32   1.7  
KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181 S...    32   1.7  
Kwal_23.3928                                                           32   2.4  
KLLA0B08976g complement(786122..787039) weakly similar to sp|P32...    31   3.3  
YOR361C (PRT1) [5138] chr15 complement(1015357..1017648) Transla...    32   3.6  
Scas_683.32                                                            31   3.6  
Kwal_23.3650                                                           31   4.3  
Scas_611.12                                                            29   4.4  
Kwal_55.21039                                                          29   5.1  
KLLA0C08041g complement(705516..707240) gi|24741192|emb|CAD56154...    31   5.2  
Scas_632.7*                                                            30   5.4  
KLLA0D16049g complement(1352380..1353657) some similarities with...    30   6.4  
YBL035C (POL12) [159] chr2 complement(151458..153575) DNA polyme...    30   8.1  
Kwal_23.6233                                                           30   8.8  
AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,...    30   9.7  

>Kwal_23.3985
          Length = 876

 Score = 1649 bits (4270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 822/864 (95%), Positives = 822/864 (95%)

Query: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGF 60
           MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGF
Sbjct: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGF 60

Query: 61  KSEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMREKRREALKRLHEREEQLLE 120
           KSEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMREKRREALKRLHEREEQLLE
Sbjct: 61  KSEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMREKRREALKRLHEREEQLLE 120

Query: 121 DKKAKKQQQQRGPAKHNLDAEIKSNTQLQEFLDTMKPSAQVTSWDNLGGAVQAANDAQNT 180
           DKKAKKQQQQRGPAKHNLDAEIKSNTQLQEFLDTMKPSAQVTSWDNLGGAVQAANDAQNT
Sbjct: 121 DKKAKKQQQQRGPAKHNLDAEIKSNTQLQEFLDTMKPSAQVTSWDNLGGAVQAANDAQNT 180

Query: 181 VSSDAPQGNSLLAQALAMKTGEPSGNFKVQENESDDEYTMLNNKAXXXXXXXXXXXXQMV 240
           VSSDAPQGNSLLAQALAMKTGEPSGNFKVQENESDDEYTMLNNKA            QMV
Sbjct: 181 VSSDAPQGNSLLAQALAMKTGEPSGNFKVQENESDDEYTMLNNKANDGGNEDGGEEEQMV 240

Query: 241 KLDDFEDKTKENMAQDEKVSDFNWLKQHRIRIKENTEGTENTDPEGVTARPKSDIREEDN 300
           KLDDFEDKTKENMAQDEKVSDFNWLKQHRIRIKENTEGTENTDPEGVTARPKSDIREEDN
Sbjct: 241 KLDDFEDKTKENMAQDEKVSDFNWLKQHRIRIKENTEGTENTDPEGVTARPKSDIREEDN 300

Query: 301 VESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELE 360
           VESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELE
Sbjct: 301 VESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELE 360

Query: 361 EVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHRLDEF 420
           EVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHRLDEF
Sbjct: 361 EVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHRLDEF 420

Query: 421 DLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLGVQKSDLIDATDASAA 480
           DLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLGVQKSDLIDATDASAA
Sbjct: 421 DLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLGVQKSDLIDATDASAA 480

Query: 481 VKQALAEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLF 540
           VKQALAEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLF
Sbjct: 481 VKQALAEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLF 540

Query: 541 LPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPE 600
           LPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPE
Sbjct: 541 LPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPE 600

Query: 601 GDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFST 660
           GDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPE             SIFVKNLNFST
Sbjct: 601 GDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEDDGTDDVVDGPTVSIFVKNLNFST 660

Query: 661 TGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVL 720
           TGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVL
Sbjct: 661 TGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVL 720

Query: 721 DGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSSFGQLKSVRLP 780
           DGHRIQLKLSHR                 IIVKNLPFEVERKQIFELFSSFGQLKSVRLP
Sbjct: 721 DGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFSSFGQLKSVRLP 780

Query: 781 KKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQDAEEQIARMTKK 840
           KKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQDAEEQIARMTKK
Sbjct: 781 KKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQDAEEQIARMTKK 840

Query: 841 VRSQVTTREHAALRNGGRRKVDLD 864
           VRSQVTTREHAALRNGGRRKVDLD
Sbjct: 841 VRSQVTTREHAALRNGGRRKVDLD 864

>YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein with
           similarity to Pab1p, Pub1p, Nsr1p, Nop4p and other
           RNA-binding proteins, contains multiple RNA-binding
           domains, is required for 35S rRNA processing [2664 bp,
           887 aa]
          Length = 887

 Score = 1018 bits (2631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/895 (60%), Positives = 661/895 (73%), Gaps = 46/895 (5%)

Query: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISES----LTDVKILKNRAGESRRFA 56
           MSR+IVKG+P YLT+D L++HF KRL   H  + ++ S    +TDVKIL++R GESRRF 
Sbjct: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60

Query: 57  FVGFKSEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMREKRREALKRLHEREE 116
           F+G+++EEDAFDAV YF+ SFI+TSKIEVSMAKSFADPRVPQPM+EKRREALKR   RE+
Sbjct: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRF--REK 118

Query: 117 QLLEDKKAKKQQQQRGPAKH-NLDAEIKSNTQLQEFLDTMKPSAQVTSWDNLGGAVQAAN 175
           +    ++  +++++    KH N+D EI+ N QLQEF++TMKPS+QVTSW+ +G      +
Sbjct: 119 EEKLLQEENRKKKKVDENKHSNIDDEIRKNKQLQEFMETMKPSSQVTSWEKVGIDKSIED 178

Query: 176 DAQNTVSSDAP-QGNSLLAQALAMK---TGEPSGNFKVQENESDDEYTMLNNKAXXXXXX 231
           +       D+  QGNSLLA ALA+K     + + N  V ENESDDEY+ LN +       
Sbjct: 179 EKLKREEEDSSVQGNSLLAHALALKEENNKDEAPNL-VIENESDDEYSALN-RNRDEDQE 236

Query: 232 XXXXXXQMVKL-----------------DDFEDKTKENMAQDEKVSDFNWLKQHRIRIKE 274
                 +M+ +                 D+ E++ + N+AQDEKVSD +W KQ R+RIKE
Sbjct: 237 DAGEEEKMISISNLKDTDIGLVNDDANSDEKENEKRRNLAQDEKVSDLDWFKQRRVRIKE 296

Query: 275 NTEGTENTDPEGVTARPKS-DIREEDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATG 333
           +   T        T + +S D ++E      E PE    Q+     T+EE  I+KI  TG
Sbjct: 297 SEAETREKSSSYATEQNESLDTKKE------EQPERAVPQK-----TDEELAIEKINQTG 345

Query: 334 RLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVE 393
           RLFLRNILYT+ E+DFRKLF+PFGELEEVHVALDTRTG+SKGFAYV+FK+  +A NAYVE
Sbjct: 346 RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405

Query: 394 LDKQIFQGRLLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQ 453
           LDKQIFQGRLLHILPGE+KKSHRLDEFDLKN+PLKKQ+ LKRKA AS  TFSWNSLYMNQ
Sbjct: 406 LDKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQ 465

Query: 454 DAVLGSVAAKLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTKFEQFKS 513
           DAVLGSVAAKLG++KS LIDA ++S+AVKQALAEAHVIGDVRKYFESKG+DLTKF Q KS
Sbjct: 466 DAVLGSVAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKS 525

Query: 514 PSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFS 573
            + RDD V+LVKNFPFGTT  EL ++FLP+GKL+RLL+PPA TIA+VQ+RD TSARAAF+
Sbjct: 526 TNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFT 585

Query: 574 KLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTA--T 631
           KLSYKRFKDGI+YLE+GPK+CF++  E D+ + +    +  N  E + + +++M+     
Sbjct: 586 KLSYKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDV 645

Query: 632 ASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNK 691
                             SIF+KNLNFSTT + LT++FK F GFVVAQVKTKPDPK+  K
Sbjct: 646 TEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGK 705

Query: 692 TLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHRXXXXX-XXXXXXXXXXXXI 750
           TLSMGFGF EF+T+EQA AVI AMDG V+DGH+IQLKLSHR                  I
Sbjct: 706 TLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKTKSNKKSGKI 765

Query: 751 IVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQG 810
           IVKNLPFE  RK +FELF+SFGQLKSVR+PKKFDKSARGFAFVEFLLPKEAENAM+QL G
Sbjct: 766 IVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825

Query: 811 VHLLGRRLVMQHAEEEPQDAEEQIARMTKKVRSQVTTREHAALRN-GGRRKVDLD 864
           VHLLGRRLVMQ+AEE+  DAEE+IARMTKKVR QV T E AALRN GGR+K+D+D
Sbjct: 826 VHLLGRRLVMQYAEEDAVDAEEEIARMTKKVRKQVATNEMAALRNGGGRKKLDVD 880

>KLLA0D14949g complement(1259860..1262496) similar to sgd|S0006316
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 878

 Score = 1017 bits (2630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/891 (60%), Positives = 655/891 (73%), Gaps = 50/891 (5%)

Query: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGF 60
           MSRVIVKG+P YL ED+L+D   KRL   H+  ++   L+DVK++KNR GESRRFAF+GF
Sbjct: 1   MSRVIVKGLPIYLKEDRLRDLIEKRLTQKHQSTDVQSYLSDVKLMKNRDGESRRFAFIGF 60

Query: 61  KSEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMREKRREALKRLHEREEQLL- 119
           + EEDAFD VNYF+ +F+DTSKIEVSMAKSFADPRVPQPMREKRREALKRL EREE LL 
Sbjct: 61  RDEEDAFDCVNYFNGTFVDTSKIEVSMAKSFADPRVPQPMREKRREALKRLREREELLLA 120

Query: 120 ----EDKKAKKQQQQRGPAKHNLDAEIKSNTQLQEFLDTMKPSAQVTSWDNL------GG 169
                 KK K      G  KH++DAEI  N QLQEF++TMKPS+QVTSW+ +      G 
Sbjct: 121 DKKDSQKKQKSDSNNDGGKKHDIDAEIAKNKQLQEFINTMKPSSQVTSWETVQSSKTQGE 180

Query: 170 AVQAANDAQNTVSSDAPQGNSLLAQALAMK-----TGEPSGNFKVQENESDDEYTMLNNK 224
             +AA+D    +SS     N LL+QALA+K       E +  FK+  NESDDEY  LN  
Sbjct: 181 DEEAADDEVGEMSS-----NPLLSQALALKGNSRDADEDTDMFKLPGNESDDEYVSLNGG 235

Query: 225 AXXXXXXXXXXXXQMVKLDDFED---KTKENMAQDEKVSDFNWLKQHRIRIKENTEGTEN 281
           +            QM+ LD F+     + ++MA+DE VSD +WLK  R+RIK+  +    
Sbjct: 236 SNNANTDEPEP--QMMSLDTFDTAGPTSTDDMAKDEAVSDLDWLKNRRVRIKDGAD---- 289

Query: 282 TDPEGVTARPKSDIREEDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNIL 341
                 T   K   + +   +  E+ E    QES     EEEK ++KI  TGRLFLRNIL
Sbjct: 290 ------TPVSKQQQQPDTEQQQPEETEVETSQES-----EEEKSLKKIRETGRLFLRNIL 338

Query: 342 YTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQG 401
           YTATEDDFRKLF+P+GELEEVH+A+DTRTG+SKGFAYV+FKN  +AA A+VELDKQIFQG
Sbjct: 339 YTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVELDKQIFQG 398

Query: 402 RLLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVA 461
           RLLHILP + KKSH+LDEFDLKNLPLKKQR LKRKAN++  TFSWNSLYMNQDAVL SVA
Sbjct: 399 RLLHILPADAKKSHKLDEFDLKNLPLKKQRELKRKANSAQQTFSWNSLYMNQDAVLSSVA 458

Query: 462 AKLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTV 521
            KLG++KS+LIDA ++S+AVKQALAEA VIGDVRK+FE++G+DLTKF Q K+ S+RDD V
Sbjct: 459 DKLGMKKSELIDAENSSSAVKQALAEASVIGDVRKFFETRGVDLTKFAQLKN-SERDDRV 517

Query: 522 LLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKRFK 581
           +LVKNFP+GTT  E+A+LFLPFGKLQRLLLPP+ TIA++Q+RD  +ARAAFSK+SYKRFK
Sbjct: 518 ILVKNFPYGTTREEIAELFLPFGKLQRLLLPPSGTIAILQFRDVPAARAAFSKISYKRFK 577

Query: 582 DGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTAT------ASKP 635
           DGI+YLEKGP +CF+R+ +GDE +  E   Q    KEA+ +G ++++  +          
Sbjct: 578 DGIIYLEKGPSDCFTRDAQGDELVESETDIQKATAKEAKISGADLLEAQSLPAADKDDHD 637

Query: 636 EXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSM 695
           +             SIF+KNLNFSTT ++LTEKFK F GFVVAQVKTKPDPK   KTLSM
Sbjct: 638 DDDDDDDVQAGPTVSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSM 697

Query: 696 GFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXX--IIVK 753
           GFGFAEFKT+EQA AVI AM+G +LDGH++QLKLSHR                   IIVK
Sbjct: 698 GFGFAEFKTKEQANAVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVK 757

Query: 754 NLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHL 813
           NLPFE  RK +FELFSSFGQLKSVR+PKKFDKSARGFAFVEFLLPKEAENAM+QLQGVHL
Sbjct: 758 NLPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 817

Query: 814 LGRRLVMQHAEEEPQDAEEQIARMTKKVRSQVTTREHAALRNGGRRKVDLD 864
           LGRRLVM+  E++P+D E+QI +MT+KV+ QV T + A +RN G+RK+DLD
Sbjct: 818 LGRRLVMEFVEQDPEDVEQQIEKMTRKVKKQVNTTKIANMRNSGKRKIDLD 868

>Scas_705.22
          Length = 869

 Score =  991 bits (2563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/885 (60%), Positives = 648/885 (73%), Gaps = 47/885 (5%)

Query: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGF 60
           MSR+IVKG+P +LT+D LK HF KRL   HK E I+  +TDVKIL+NR GESR+FAF+G+
Sbjct: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGY 60

Query: 61  KSEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMREKRREALKRLHEREEQLLE 120
            +EEDAFDAVNYF+ S+I+T+K+EVSMAKSFADPRVPQPM+E++REALKR  E+EE+LL 
Sbjct: 61  HNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEERLLA 120

Query: 121 DKKAKKQQQQRGPAKHNLDAEIKSNTQLQEFLDTMKPSAQVTSWDNLGGAVQAANDAQNT 180
           +   KKQ+ +    + ++DAEI  N QLQEF++TMKPS+QV SW+       A  D + +
Sbjct: 121 ESDKKKQKVKEKERRLSIDAEISKNKQLQEFIETMKPSSQVPSWEKPVSHKNAEEDNEES 180

Query: 181 VSSDAPQGNSLLAQALAMKTGEPSGNFKVQENESDDEYTMLNNKAXXXXXXXXXXXXQMV 240
                   N LLA    +  G+      ++ENESDDEY   N                M+
Sbjct: 181 -------SNPLLA---LLNNGDDDKKPLLKENESDDEYADFN-----KDQKDEQEDEPMM 225

Query: 241 KLDDFED--------KTKENMAQDEKVSDFNWLKQHRIRIKENTEGTENTDPEGVTARPK 292
           KLDD           +  +++AQDEKVSD NW KQ R+RI+E          E   A+P 
Sbjct: 226 KLDDLNTTETTEKKTREDDHLAQDEKVSDLNWFKQRRVRIREG---------ESEAAKPS 276

Query: 293 SDIRE---EDNVESTEDPESTEQQESKLDT-------TEEEKFIQKIEATGRLFLRNILY 342
           S  +E   E N    E+ +S  + + +          T E+  ++KI  TGRLFLRNILY
Sbjct: 277 SLSKEGNTEGNASLKENTDSENKNDEEEKKEEQEPQQTPEDIAMEKISKTGRLFLRNILY 336

Query: 343 TATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGR 402
           T TEDDFRKLF PFGELEEVHVALDTRTGKSKGFAY++FK+P +A  AY+ELDKQIFQGR
Sbjct: 337 TTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGR 396

Query: 403 LLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAA 462
           LLHILP + KKSHRLDEFDLKN+PLKKQR LK+K NAS  TFSWNSLYMNQDAVLGSVAA
Sbjct: 397 LLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQDAVLGSVAA 456

Query: 463 KLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVL 522
           KLG++KSDLID   +++AVKQALAEAH+IGDVRKYFESKG+DLTKF Q KSP  RD  V+
Sbjct: 457 KLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKVI 516

Query: 523 LVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKRFKD 582
           LVKNFP+GTT  E+ +LFLPFGKL+RLL+PP+ TIA+V+YRD TS R+AF+KL++KRFKD
Sbjct: 517 LVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFKD 576

Query: 583 GILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEXXXXXX 642
           GI+YLEKGPK+CF+R+ E  + +  E  A   NV E + T  EIM +   +  E      
Sbjct: 577 GIIYLEKGPKDCFTRDAEPADLI--EADAPEENVVEVKDTVKEIMDSTDKTSNEEHEDEH 634

Query: 643 XXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEF 702
                  SIF+KNLNF+TT  EL+++FKTF GFVVAQVKTKPDPK+++KTLSMGFGFAEF
Sbjct: 635 VADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEF 694

Query: 703 KTREQALAVIDAMDGAVLDGHRIQLKLSHR--XXXXXXXXXXXXXXXXXIIVKNLPFEVE 760
           +T+EQA AVI A+DG V+DGHRIQLKLSHR                   IIVKNLPFE  
Sbjct: 695 RTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEAT 754

Query: 761 RKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVM 820
           RK +FELF+SFGQLKSVR+PKKFDKSARGFAFVEFLLPKEAENAM+QLQGVHLLGRRLVM
Sbjct: 755 RKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814

Query: 821 QHAEEEPQDAEEQIARMTKKVRSQVTTREHAALRN-GGRRKVDLD 864
           Q+A+EE  DAEE+IARMTKKV+ QV + E AALRN GGR+K++L+
Sbjct: 815 QYAQEEAADAEEEIARMTKKVKKQVVSSELAALRNSGGRKKLELE 859

>ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH]
           (768392..770908) [2517 bp, 838 aa]
          Length = 838

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/868 (57%), Positives = 625/868 (72%), Gaps = 46/868 (5%)

Query: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGF 60
           MSRVIVKG+P YL E +L+ HF KRL    +G    + +TDVKI+K+++G SRRFAF+G+
Sbjct: 1   MSRVIVKGLPIYLEEARLRAHFLKRLQ--QQGRGSEDQITDVKIVKDKSGNSRRFAFIGY 58

Query: 61  KSEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMREKRREALKRLHEREEQLLE 120
           +SE+DAFDA+ YF+ SFIDT++IEV+MAKSFADPRVP PMREKRREALKRL ERE+++L 
Sbjct: 59  RSEQDAFDAIEYFNGSFIDTARIEVAMAKSFADPRVPTPMREKRREALKRLREREDRIL- 117

Query: 121 DKKAKKQQQQRGPAKHNLDAEIKSNTQLQEFLDTMKPSAQVTSWDNLGGAVQAANDAQNT 180
              A+K+Q+Q  P +H +DAEI  N QLQEF++TM P     + + +  A +    A   
Sbjct: 118 ---AEKRQKQTKP-QHGIDAEISKNKQLQEFIETMNPKMAAAAANPMARAAEQPASA--- 170

Query: 181 VSSDAPQGNSLLAQALAMKTGEPSGNFKVQENESDDEYTMLNNK--AXXXXXXXXXXXXQ 238
                   N LL+     +  E    F++ E ESDDEYT L+ +  +            Q
Sbjct: 171 --------NPLLSALHGAEDDEEVDMFQLSEQESDDEYTDLHQRPQSAEEDELEEPAVGQ 222

Query: 239 MVKLDDFEDKTKENMAQDEKVSDFNWLKQHRIRIK--ENTEGTENTDPEGVTARPKSDIR 296
            +      D  ++ MA +++VSD  WLK  RIRI+  E+ E       +      + ++ 
Sbjct: 223 DLDAAPAPDAAEDGMATNQEVSDLEWLKNRRIRIRDGEDAEAAPAPQEQAAEEPAEQEVP 282

Query: 297 EEDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPF 356
           +ED V +                  EE  + KI ATGRLFLRNILY ATE+DF++LF+P+
Sbjct: 283 QEDEVSA------------------EEAALTKIRATGRLFLRNILYDATEEDFKQLFSPY 324

Query: 357 GELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHR 416
           GELEEVHVA+DTRTG+SKGFAYV+FK+P  AANAY+ELDKQIFQGRLLHILP + KK+HR
Sbjct: 325 GELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIELDKQIFQGRLLHILPADAKKTHR 384

Query: 417 LDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLGVQKSDLIDATD 476
           LDEFDLKNLPLKKQR LKRKA A+  TFSWNSL+MNQDAVL SVAAKLG++KS LID  +
Sbjct: 385 LDEFDLKNLPLKKQRELKRKATAAQQTFSWNSLFMNQDAVLSSVAAKLGMEKSQLIDPEN 444

Query: 477 ASAAVKQALAEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSEL 536
           + +AVKQALAEAHVIGDVRKYFE++G+DLT+FE+FK  ++RDD ++LVKNFP GTT  EL
Sbjct: 445 SGSAVKQALAEAHVIGDVRKYFEARGVDLTQFEKFKKVTERDDRIILVKNFPHGTTREEL 504

Query: 537 ADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFS 596
           A+LFLPFGK++R+L+PP+ TIA++QYRD  +AR AF+KLSYKRFK  ILYLEKGPK+CFS
Sbjct: 505 AELFLPFGKIERMLMPPSGTIAIIQYRDVPAARGAFTKLSYKRFKAPILYLEKGPKDCFS 564

Query: 597 REPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNL 656
           REP GDE +  E  A   +VKE + + +++M  A +  P              SIFVKNL
Sbjct: 565 REPRGDELL--EGDAAPEDVKEIKKSVEDVMD-ADSKTP--SSEATAIDGPTVSIFVKNL 619

Query: 657 NFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMD 716
           NFSTT  +L EKFK F GFVVAQVKTKPDPKNS+K LSMGFGF EF+T+EQA AVI AMD
Sbjct: 620 NFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAGAVIAAMD 679

Query: 717 GAVLDGHRIQLKLSHRXXXX-XXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSSFGQLK 775
           GAV+DGH+IQLK+SH+                  IIVKNLPFE  RK +FELFSSFGQLK
Sbjct: 680 GAVIDGHKIQLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFELFSSFGQLK 739

Query: 776 SVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQDAEEQIA 835
           SVR+PKKFDKSARGFAFVEFLLP EAENAM+QLQGVHLLGRRLVMQ+AE+E  D EEQI+
Sbjct: 740 SVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQYAEQESDDVEEQIS 799

Query: 836 RMTKKVRSQVTTREHAALRNGGRRKVDL 863
           +MT K++ Q    +  ALRN G+RK+D+
Sbjct: 800 KMTMKMKKQAAVSKMGALRNSGKRKIDM 827

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/879 (57%), Positives = 645/879 (73%), Gaps = 39/879 (4%)

Query: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGF 60
           MSRVIVKG+P YLTE +L+ HF KRL T H   N+   +TD++ILKNR G+SRRFAF+G+
Sbjct: 1   MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGY 60

Query: 61  KSEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMREKRREALKRLHEREEQLLE 120
           K+E+DA DAVNYFD SFI TSKIEV MAKSFADPRVP+ M+EK+REALKRL E+EE+LLE
Sbjct: 61  KNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSMKEKKREALKRLREKEEKLLE 120

Query: 121 DKKAKKQQQQRGPAKHNLDAEIKSNTQLQEFLDTMKPSAQVTSWDNLGGAVQAAN---DA 177
           +K  K + Q    +K N+DAEI+ + QL+EF++TMKPSAQ +SWD +    +  +   + 
Sbjct: 121 EKNKKLKVQDT-KSKINIDAEIEKDKQLKEFIETMKPSAQTSSWDKITETAEPESGLAEE 179

Query: 178 QNTVSSDAPQGNSLLAQALAMKTGEPSGNFKVQENESDDEYTMLNNKAXXXXXXXXXXXX 237
           Q     ++   N LL  AL+MK G+        EN+SDDEY   NN              
Sbjct: 180 QELDDEESSNVNPLLKHALSMKKGD--------ENDSDDEYMSFNNADSKAGSDESNEEE 231

Query: 238 QMVKLDDF---------EDKTKENMAQDEKVSDFNWLKQHRIRIKENTEGTENTDPEGVT 288
           +M+ L +          E K  + +A++E++SD +W+KQ R+RI+EN E         V 
Sbjct: 232 KMISLSELPVQNEESSAEPKEDDGLAKNEEISDMDWIKQRRVRIRENGEK--------VG 283

Query: 289 ARPKSDIREEDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDD 348
               ++++++   ES E+ ++T  +E + +  +EE+ I KI+ TGRLFLRNILY++TEDD
Sbjct: 284 EEFATNVQDK---ESEENSQATPAEELQEEIPDEEQAIAKIQKTGRLFLRNILYSSTEDD 340

Query: 349 FRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILP 408
           F+KLF+P+GEL+EVHVA+DTRTG SKGFAYV+F  P +A  AY+ELDKQIFQGRLLHIL 
Sbjct: 341 FKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHILA 400

Query: 409 GEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLGVQK 468
            ++ K HRLDEFDLKN+PLKKQR LK+KA AS  TFSWNSLYMNQDAVLGSVAAKLGVQK
Sbjct: 401 ADEMKDHRLDEFDLKNMPLKKQRELKKKAAASKATFSWNSLYMNQDAVLGSVAAKLGVQK 460

Query: 469 SDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKNFP 528
           +DLID  ++++AVKQALAEAHVIGDVRKYFE+KG+DLTKF   KSPS RDD V+LVKNFP
Sbjct: 461 ADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNLKSPSQRDDRVILVKNFP 520

Query: 529 FGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKRFKDGILYLE 588
           FGTT  EL +LF+PFGKL+RLL+PPA TIA+VQ+RD  S R+AFSKL++KRFK  ++YLE
Sbjct: 521 FGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKGTVIYLE 580

Query: 589 KGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEXXXXXXXXXXX- 647
           KGPK+CF++    ++ M  +   +  + KEA  +  +++++ ++ K E            
Sbjct: 581 KGPKDCFTKAASNEDAMEHD---EEKSAKEAGPSSADLLESVSSKKTEDKEDEDEQVVDG 637

Query: 648 -XXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTRE 706
              SIF+KNLNF TT ++LT++FK F GFVVAQVKTKPDPK  NK LSMGFGF EF+T+E
Sbjct: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697

Query: 707 QALAVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFE 766
           QA AVI AMDG V+DGH+IQLKLSHR                 IIVKNLPFE  RK +FE
Sbjct: 698 QATAVISAMDGTVIDGHKIQLKLSHR-QGNAGSQEKKKAKNGKIIVKNLPFEATRKDVFE 756

Query: 767 LFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEE 826
           LF+SFGQLKSVR+PKKFDKSARGFAFVEF+LPKEAENAM+QLQGVHLLGRRLVMQ AE+E
Sbjct: 757 LFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQPAEQE 816

Query: 827 PQDAEEQIARMTKKVRSQVTTREHAAL-RNGGRRKVDLD 864
             +AEE++ RMTKKVR Q    E AA+ RN G+RK+D++
Sbjct: 817 AANAEEELERMTKKVRKQAAVSEIAAMTRNAGKRKLDME 855

>Scas_88.1
          Length = 256

 Score =  392 bits (1008), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 186/245 (75%), Positives = 217/245 (88%), Gaps = 2/245 (0%)

Query: 334 RLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVE 393
           RLF+  I       DF +LF+P+GELEEVHVALDTRTG+SKGFAY+MFKNP +A +AY+E
Sbjct: 2   RLFVHFIHCKGI--DFXQLFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIE 59

Query: 394 LDKQIFQGRLLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQ 453
           LDKQIFQGRLLHILP E KKSHRLDEFDLKNLPLKKQR LKRKANAS  TFSWNSLYMNQ
Sbjct: 60  LDKQIFQGRLLHILPAEAKKSHRLDEFDLKNLPLKKQRELKRKANASQQTFSWNSLYMNQ 119

Query: 454 DAVLGSVAAKLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTKFEQFKS 513
           DAVL SVA+KLG++KS+LID T++ +AVKQALAEAHVIGDVRK+FES+G+DLTKF ++KS
Sbjct: 120 DAVLSSVASKLGMEKSELIDPTNSGSAVKQALAEAHVIGDVRKFFESRGVDLTKFVEYKS 179

Query: 514 PSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFS 573
           PS+RD+ V+LVKNFPFGTT  ELA+LFLPFGKLQRLL+PPA TIA+VQ+RD T+ARAAF+
Sbjct: 180 PSERDECVMLVKNFPFGTTKEELAELFLPFGKLQRLLMPPAGTIAIVQFRDMTAARAAFT 239

Query: 574 KLSYK 578
           K+  K
Sbjct: 240 KIPTK 244

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 22/31 (70%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLP 780
           ++VKN PF   ++++ ELF  FG+L+ + +P
Sbjct: 188 MLVKNFPFGTTKEELAELFLPFGKLQRLLMP 218

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 94/186 (50%), Gaps = 13/186 (6%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV  L++S   + L ++F+  GG V A+V  +   + +++  S G+G+ +F+ +  A 
Sbjct: 177 TVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYE---RGTDR--SRGYGYVDFEDKSYAE 231

Query: 710 AVIDAMDGAVLDGHRIQLKLS-------HRXXXXXXXXXXXXXXXXXIIVKNLPFEVERK 762
             +  M G  +DG  I + +S        R                 + + NL F  +R 
Sbjct: 232 KAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRD 291

Query: 763 QIFELFSSFGQLKSVRLPKKFD-KSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQ 821
            I+E+F  FG++ SVR+P   + +  +GF +V++    +A+ A+E LQG ++  R + + 
Sbjct: 292 NIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPVRLD 351

Query: 822 HAEEEP 827
           ++  +P
Sbjct: 352 YSTPKP 357

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%)

Query: 330 EATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAAN 389
           E +  LFL N+ + A  D+  ++F  FGE+  V +     T + KGF YV + +  DA  
Sbjct: 274 EPSDTLFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKK 333

Query: 390 AYVELDKQIFQGRLLHI 406
           A   L  +    R + +
Sbjct: 334 ALEALQGEYIDNRPVRL 350

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 316 KLDTTEEEKFIQKIEATGR---LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGK 372
           K +  EEE   +K +  G    +F+  + ++  ++  ++ F   G +    V  +  T +
Sbjct: 156 KAEDEEEESSPKKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDR 215

Query: 373 SKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHI 406
           S+G+ YV F++   A  A  E+  +   GR +++
Sbjct: 216 SRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINV 249

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 88/183 (48%), Gaps = 6/183 (3%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +IF+KNL+ +   K L E F TFG  +  +V      +N N   S GFGF  FK    A 
Sbjct: 139 NIFIKNLHPAIDNKALHETFSTFGEVLSCKVALD---ENGN---SRGFGFVHFKEESDAK 192

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFS 769
             I+A++G +++G  + + +                    I VKN+  E   ++  +LFS
Sbjct: 193 DAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDVETTDEEFEQLFS 252

Query: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQD 829
            +G++ S  L K  +   +GF FV F+    A  A+E+L G     + L +  A+++ + 
Sbjct: 253 QYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQALYVGRAQKKYER 312

Query: 830 AEE 832
           AEE
Sbjct: 313 AEE 315

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 95/413 (23%), Positives = 162/413 (39%), Gaps = 68/413 (16%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           L++  +    TE     +F+P G +  + V  D  T  S G+AYV + +      A  EL
Sbjct: 52  LYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQEL 111

Query: 395 DKQIFQGRLLHILPGEQKKSHR---LDEFDLKNL-PLKKQRSLKRKANASHDTFSWNSLY 450
           +     GR   I+  E+  + R        +KNL P    ++L       H+TFS     
Sbjct: 112 NYAEINGRPCRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKAL-------HETFSTFGEV 164

Query: 451 MNQDAVLGSVAAKLGV------QKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMD 504
           ++    L       G       ++SD  DA +A   +     E +V   V      K   
Sbjct: 165 LSCKVALDENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYVAMHV-----PKKDR 219

Query: 505 LTKFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLP-----PAQTIAV 559
           ++K E+ K+    + T + VKN    TT  E   LF  +G++    L        +    
Sbjct: 220 ISKLEEAKA----NFTNIYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGF 275

Query: 560 VQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEA 619
           V + D  +A  A  +L+ K FK   LY+ +  K  + R  E     + +   Q    K A
Sbjct: 276 VNFVDHNAAAKAVEELNGKEFKSQALYVGRAQKK-YERAEE-----LKKQYEQYRLEKLA 329

Query: 620 RTTGDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQ 679
           +  G                          ++F+KNL+ S   ++L E+F  +G    A+
Sbjct: 330 KFQG-------------------------VNLFIKNLDDSIDDEKLKEEFAPYGTITSAR 364

Query: 680 VKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHR 732
           V    D + ++K    GFGF  F + E+A   +   +  ++ G  + + ++ R
Sbjct: 365 VMR--DQEGNSK----GFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQR 411

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 80/185 (43%), Gaps = 16/185 (8%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +I+VKN++  TT +E  + F  +G  V A ++   + K        GFGF  F     A 
Sbjct: 232 NIYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGK------PKGFGFVNFVDHNAAA 285

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXX----------XXIIVKNLPFEV 759
             ++ ++G       + +  + +                           + +KNL   +
Sbjct: 286 KAVEELNGKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSI 345

Query: 760 ERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLV 819
           + +++ E F+ +G + S R+ +  + +++GF FV F  P+EA  AM +     + G+ L 
Sbjct: 346 DDEKLKEEFAPYGTITSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLY 405

Query: 820 MQHAE 824
           +  A+
Sbjct: 406 VAIAQ 410

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF++N+  +  ++  ++ FAP+G +    V  D + G SKGF +V F +P +A  A  E 
Sbjct: 336 LFIKNLDDSIDDEKLKEEFAPYGTITSARVMRD-QEGNSKGFGFVCFSSPEEATKAMTEK 394

Query: 395 DKQIFQGRLLHILPGEQKKSHR 416
           ++QI  G+ L++   ++K   R
Sbjct: 395 NQQIVAGKPLYVAIAQRKDVRR 416

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 43/86 (50%), Gaps = 11/86 (12%)

Query: 4   VIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFKSE 63
           + +K +   + ++KLK+ F               ++T  ++++++ G S+ F FV F S 
Sbjct: 336 LFIKNLDDSIDDEKLKEEFAPY-----------GTITSARVMRDQEGNSKGFGFVCFSSP 384

Query: 64  EDAFDAVNYFDQSFIDTSKIEVSMAK 89
           E+A  A+   +Q  +    + V++A+
Sbjct: 385 EEATKAMTEKNQQIVAGKPLYVAIAQ 410

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 39  LTDVKILKNRAGESRRFAFVGFKSEEDAFDAVNYFDQSFIDTSKIEVSM 87
           +   K+  +  G SR F FV FK E DA DA+   +   ++  ++ V+M
Sbjct: 164 VLSCKVALDENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYVAM 212

>Scas_621.10
          Length = 415

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 93/185 (50%), Gaps = 12/185 (6%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +IFV  L++S   + L ++F+  GG V A+V  +   + +++  S G+G+ +F+ +  A 
Sbjct: 163 TIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIME---RGTDR--SRGYGYVDFEDKSYAE 217

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXX------XXXXXXIIVKNLPFEVERKQ 763
             I  M G  +DG  I + +S                         + + NL F  +R  
Sbjct: 218 KAIKEMQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDA 277

Query: 764 IFELFSSFGQLKSVRLPKKFD-KSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQH 822
           I ELFS +G++ SVR+P   + +  +GF +V++   ++A+ A+E LQG ++  R + + +
Sbjct: 278 ISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRLDY 337

Query: 823 AEEEP 827
           +   P
Sbjct: 338 STPRP 342

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LFL N+ + A  D   +LF+ +GE+  V +     T + KGF YV + N  DA  A   L
Sbjct: 264 LFLGNLSFNADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGL 323

Query: 395 DKQIFQGRLLHI 406
             +    R + +
Sbjct: 324 QGEYIDNRPVRL 335

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 37/72 (51%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+  + ++  ++  +K F   G +    V ++  T +S+G+ YV F++   A  A  E+
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 395 DKQIFQGRLLHI 406
             +   GR +++
Sbjct: 224 QGKEIDGREINV 235

>Scas_576.7
          Length = 575

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 92/200 (46%), Gaps = 11/200 (5%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +IF+KNL+     K L E F  FG  + +++ T    K      S GFGF  F+    A 
Sbjct: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGK------SKGFGFVHFEHESSAK 177

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFS 769
             IDA++G +L+G  I +                      + VKN+  E   ++  ELF+
Sbjct: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237

Query: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQD 829
            +G + S  L K  D   +GF FV+F   ++A  A+E+L G     + L +  A+++ + 
Sbjct: 238 KYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYER 297

Query: 830 AEE-----QIARMTKKVRSQ 844
            +E     + +R+ K  + Q
Sbjct: 298 MQELKKQYEASRLEKMAKYQ 317

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 90/212 (42%), Gaps = 16/212 (7%)

Query: 623 GDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKT 682
           G EI      ++ E             +++VKN+N  TT +E  E F  +G  + + ++ 
Sbjct: 190 GQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEK 249

Query: 683 KPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGA-----VLDGHRIQLKLSH-----R 732
             D K        GFGF +F+  E A   ++ ++G       L   R Q K        +
Sbjct: 250 TEDGK------LKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKYERMQELKK 303

Query: 733 XXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAF 792
                            + VKNL   ++ +++ E F+ +G + SVR+ +  +  ++GF F
Sbjct: 304 QYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGF 363

Query: 793 VEFLLPKEAENAMEQLQGVHLLGRRLVMQHAE 824
           V F  P+EA  A+ +     + G+ L +  A+
Sbjct: 364 VCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF++N+  +  ++  ++ FAP+G +  V V + T  GKSKGF +V F  P +A  A  E 
Sbjct: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAITEK 379

Query: 395 DKQIFQGRLLHILPGEQKKSHR 416
           ++QI  G+ L++   ++K   R
Sbjct: 380 NQQIVAGKPLYVAIAQRKDVRR 401

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 97/423 (22%), Positives = 158/423 (37%), Gaps = 88/423 (20%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           L++  +  T +E     +F+P G +  + V  D  T  S G+AYV F +      A  +L
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 395 DKQIFQGRLLHIL-----PGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSL 449
           +    +GRL  I+     P  +KK        +KNL       +  KA      F   S+
Sbjct: 97  NYTPIKGRLCRIMWSQRDPALRKKGS--GNIFIKNL----HPDIDNKA-----LFETFSV 145

Query: 450 YMNQDAVLGSVAA--KLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTK 507
           + N   +L S  A  + G  K       +  ++ K+A+   +            GM L  
Sbjct: 146 FGN---ILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN------------GMLLNG 190

Query: 508 FEQFKSP----SDRDD---------TVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPA 554
            E + +P     +RD          T + VKN    TT  E  +LF  +G +    L   
Sbjct: 191 QEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKT 250

Query: 555 Q-----TIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEI 609
           +         V +     A  A  +L+   FKD  L++        SR  +  E M    
Sbjct: 251 EDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV--------SRAQKKYERM---- 298

Query: 610 VAQSTNVKEARTTGDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKF 669
                          E+ +   AS+ E             ++FVKNL+ S   ++L E+F
Sbjct: 299 --------------QELKKQYEASRLE-----KMAKYQGVNLFVKNLDDSIDDEKLKEEF 339

Query: 670 KTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKL 729
             +G     +V    + K      S GFGF  F T E+A   I   +  ++ G  + + +
Sbjct: 340 APYGTITSVRVMRTDNGK------SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 393

Query: 730 SHR 732
           + R
Sbjct: 394 AQR 396

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 331 ATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
            +G +F++N+          + F+ FG +    +A D  TGKSKGF +V F++   A  A
Sbjct: 121 GSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEA 179

Query: 391 YVELDKQIFQGRLLHILP 408
              L+  +  G+ +++ P
Sbjct: 180 IDALNGMLLNGQEIYVAP 197

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V  L   V    ++++FS  G + S+R+ +    K++ G+A+V F   +  + A+EQL
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 809 QGVHLLGRRLVMQHAEEEP 827
               + GR   +  ++ +P
Sbjct: 97  NYTPIKGRLCRIMWSQRDP 115

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 11/86 (12%)

Query: 4   VIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFKSE 63
           + VK +   + ++KLK+ F               ++T V++++   G+S+ F FV F + 
Sbjct: 321 LFVKNLDDSIDDEKLKEEFAPY-----------GTITSVRVMRTDNGKSKGFGFVCFSTP 369

Query: 64  EDAFDAVNYFDQSFIDTSKIEVSMAK 89
           E+A  A+   +Q  +    + V++A+
Sbjct: 370 EEATKAITEKNQQIVAGKPLYVAIAQ 395

>YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding protein
           of cytoplasm and nucleus, part of the 3'-end
           RNA-processing complex (cleavage factor I), involved in
           translation termination with Sup35p, has 4 RNA
           recognition (RRM) domains [1734 bp, 577 aa]
          Length = 577

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 80/175 (45%), Gaps = 6/175 (3%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +IF+KNL+     K L + F  FG  + +++ T  + K      S GFGF  F+    A 
Sbjct: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK------SKGFGFVHFEEEGAAK 180

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFS 769
             IDA++G +L+G  I +                      + VKN+  E   +Q  ELF+
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAE 824
            FG + S  L K  D   +GF FV +   ++A  A+E L    L G +L +  A+
Sbjct: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ 295

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 94/213 (44%), Gaps = 16/213 (7%)

Query: 622 TGDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVK 681
            G EI      S+ E             +++VKN+N  TT ++  E F  FG  V A ++
Sbjct: 192 NGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLE 251

Query: 682 TKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRI----------QLKLSH 731
              D K        GFGF  ++  E A+  ++A++ + L+G ++          ++ +  
Sbjct: 252 KDADGK------LKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLK 305

Query: 732 RXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFA 791
           +                 + VKNL   V+ +++ E F+ +G + S ++ +  +  ++GF 
Sbjct: 306 KQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFG 365

Query: 792 FVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAE 824
           FV F  P+EA  A+ +     + G+ L +  A+
Sbjct: 366 FVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 99/427 (23%), Positives = 169/427 (39%), Gaps = 79/427 (18%)

Query: 327 QKIE-ATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPG 385
           Q +E ++  L++ ++  + +E     +F+P G +  + V  D  T  S G+AYV F +  
Sbjct: 31  QSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHE 90

Query: 386 DAANAYVELDKQIFQGRLLHILPGEQKKSHR---LDEFDLKNL-PLKKQRSLKRKANASH 441
               A  +L+    +GRL  I+  ++  S R        +KNL P    ++L       +
Sbjct: 91  AGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKAL-------Y 143

Query: 442 DTFSWNSLYMNQDAVLGSV-AAKLGVQKSDLIDATDASAAVKQ-ALAEAHVIGDVRKYFE 499
           DTFS          V G + ++K+         ATD +   K          G  ++  +
Sbjct: 144 DTFS----------VFGDILSSKI---------ATDENGKSKGFGFVHFEEEGAAKEAID 184

Query: 500 S-KGMDLTKFEQFKSP----SDRDD---------TVLLVKNFPFGTTHSELADLFLPFGK 545
           +  GM L   E + +P     +RD          T L VKN    TT  +  +LF  FG 
Sbjct: 185 ALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGP 244

Query: 546 LQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPEGDETM 605
           +          ++    +DA      F  ++Y++ +D +  +E         E  G++  
Sbjct: 245 I----------VSASLEKDADGKLKGFGFVNYEKHEDAVKAVEA----LNDSELNGEKLY 290

Query: 606 VDEIVAQSTNVKEARTTGDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKEL 665
           V    AQ  N         E M      + E             ++FVKNL+ S   ++L
Sbjct: 291 VGR--AQKKN---------ERMHV-LKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKL 338

Query: 666 TEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRI 725
            E+F  +G    A+V    + K      S GFGF  F T E+A   I   +  ++ G  +
Sbjct: 339 EEEFAPYGTITSAKVMRTENGK------SKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392

Query: 726 QLKLSHR 732
            + ++ R
Sbjct: 393 YVAIAQR 399

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF++N+  +  ++   + FAP+G +    V + T  GKSKGF +V F  P +A  A  E 
Sbjct: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEK 382

Query: 395 DKQIFQGRLLHILPGEQKKSHR 416
           ++QI  G+ L++   ++K   R
Sbjct: 383 NQQIVAGKPLYVAIAQRKDVRR 404

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V +L   V    ++++FS  G + S+R+ +    K++ G+A+V F   +    A+EQL
Sbjct: 40  LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQL 99

Query: 809 QGVHLLGRRLVMQHAEEEP 827
               + GR   +  ++ +P
Sbjct: 100 NYTPIKGRLCRIMWSQRDP 118

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 30/52 (57%)

Query: 38  SLTDVKILKNRAGESRRFAFVGFKSEEDAFDAVNYFDQSFIDTSKIEVSMAK 89
           ++T  K+++   G+S+ F FV F + E+A  A+   +Q  +    + V++A+
Sbjct: 347 TITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

>AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH]
           (978634..980391) [1758 bp, 585 aa]
          Length = 585

 Score = 75.1 bits (183), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 93/200 (46%), Gaps = 11/200 (5%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +I++KNL+ +   K L E F TFG  +  +V T          +S GFGF  F+    A 
Sbjct: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT------DENGVSRGFGFVHFENESDAR 180

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFS 769
             I+A+DG +++   + + L                    + VKN+  E  +++  ELF 
Sbjct: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240

Query: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQD 829
            +G++ S  L K  +   RGF FV F     A  A+++L  +   G++L +  A+++ + 
Sbjct: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER 300

Query: 830 AEE-----QIARMTKKVRSQ 844
            +E     + AR+ K  + Q
Sbjct: 301 LQELKKQYEAARLEKLAKYQ 320

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 109/451 (24%), Positives = 177/451 (39%), Gaps = 79/451 (17%)

Query: 297 EEDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPF 356
           E+  +E    P +TE +  K++T+    ++ ++E T            +E     +F+P 
Sbjct: 13  EQLKIEEQTAPTTTESETPKVETSGASLYVGELEPT-----------VSEALLYDIFSPI 61

Query: 357 GELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHR 416
           G +  + V  D  T  S G+AYV F +      A  +L+  + +G+   I+  ++  S R
Sbjct: 62  GSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLR 121

Query: 417 ---LDEFDLKNL-PLKKQRSLKRKANASHDTFS--WNSLYMNQDAVLGSVAAKLG-VQKS 469
                   +KNL P    +SL       H+TFS   N L          V+   G V   
Sbjct: 122 KKGSGNIYIKNLHPAIDNKSL-------HETFSTFGNILSCKVATDENGVSRGFGFVHFE 174

Query: 470 DLIDATDASAAVKQALA---EAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKN 526
           +  DA DA  AV   L    E +V   V     SK    +K E+ K+      T + VKN
Sbjct: 175 NESDARDAIEAVDGMLMNDQEVYVALHV-----SKKDRQSKLEEVKA----KFTNVYVKN 225

Query: 527 FPFGTTHSELADLFLPFGKLQRLLLP-----PAQTIAVVQYRDATSARAAFSKLSYKRFK 581
               T+  E  +LF  +GK+   +L        +    V + D  +A  A  +L+   FK
Sbjct: 226 IDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFK 285

Query: 582 DGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEXXXXX 641
              LY+ +  K  + R        + E+  Q                       E     
Sbjct: 286 GQKLYVGRAQKK-YER--------LQELKKQY----------------------EAARLE 314

Query: 642 XXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAE 701
                   ++FVKNL+ S   ++L E+F  FG    A+V  + +  NS      GFGF  
Sbjct: 315 KLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKV-MRDETGNSR-----GFGFVC 368

Query: 702 FKTREQALAVIDAMDGAVLDGHRIQLKLSHR 732
           F T E+A   I   +  ++ G  + + ++ R
Sbjct: 369 FSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF++N+  +  ++  ++ FAPFG +    V  D  TG S+GF +V F  P +A  A  E 
Sbjct: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382

Query: 395 DKQIFQGRLLHILPGEQKKSHR 416
           ++QI  G+ L++   ++K+  R
Sbjct: 383 NQQIVAGKPLYVAIAQRKEVRR 404

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 83/185 (44%), Gaps = 16/185 (8%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +++VKN++  T+ +E  E F  +G    A ++     K+S   L  GFGF  F+    A 
Sbjct: 220 NVYVKNIDQETSQEEFEELFGKYGKITSAVLE-----KDSEGKLR-GFGFVNFEDHAAAA 273

Query: 710 AVIDAMDGAVLDGHRI----------QLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEV 759
             +D ++     G ++          +L+   +                 + VKNL   +
Sbjct: 274 KAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSI 333

Query: 760 ERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLV 819
           + +++ E F+ FG + S ++ +    ++RGF FV F  P+EA  A+ +     + G+ L 
Sbjct: 334 DDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 393

Query: 820 MQHAE 824
           +  A+
Sbjct: 394 VAIAQ 398

 Score = 36.6 bits (83), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 11/86 (12%)

Query: 4   VIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFKSE 63
           + VK +   + ++KLK+ F     TI          T  K++++  G SR F FV F + 
Sbjct: 324 LFVKNLDDSIDDEKLKEEFAP-FGTI----------TSAKVMRDETGNSRGFGFVCFSTP 372

Query: 64  EDAFDAVNYFDQSFIDTSKIEVSMAK 89
           E+A  A+   +Q  +    + V++A+
Sbjct: 373 EEATKAITEKNQQIVAGKPLYVAIAQ 398

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%)

Query: 28  TIHKGENISESLTDVKILKNRAGESRRFAFVGFKSEEDAFDAVNYFDQSFIDTSKIEVSM 87
           ++H+  +   ++   K+  +  G SR F FV F++E DA DA+   D   ++  ++ V++
Sbjct: 141 SLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVAL 200

Query: 88  AKSFAD 93
             S  D
Sbjct: 201 HVSKKD 206

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V  L   V    ++++FS  G + S+R+ +     ++ G+A+V F   +    A+EQL
Sbjct: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99

Query: 809 QGVHLLGRRLVMQHAEEEP 827
               + G+   +  ++ +P
Sbjct: 100 NYTLIKGKPCRIMWSQRDP 118

>CAGL0L11792g 1259275..1261014 highly similar to sp|P04147
           Saccharomyces cerevisiae YER165w PAB1 mRNA
           polyadenylate-binding protein, start by similarity
          Length = 579

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 91/200 (45%), Gaps = 11/200 (5%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +IF+KNL+     K L + F  FG  + ++V T    K      S GFG+  F+  E A 
Sbjct: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGK------SKGFGYVHFEEDESAS 177

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFS 769
             IDA++G +L+G  I +                      + +KN+  E   K+  EL +
Sbjct: 178 EAIDALNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVA 237

Query: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQD 829
            FG+  SV L +  +   +GF FV F+  ++A   +E+L      G+ L +  A+++ + 
Sbjct: 238 KFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYER 297

Query: 830 AEE-----QIARMTKKVRSQ 844
            +E     +  RM K  + Q
Sbjct: 298 QQELKKQYEATRMEKMAKYQ 317

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 102/432 (23%), Positives = 175/432 (40%), Gaps = 66/432 (15%)

Query: 314 ESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKS 373
           + K + T EE   + + A+  L++ ++  + +E     +F+P G +  + V  D  T  S
Sbjct: 18  QDKQEGTNEENQSETVSAS--LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTS 75

Query: 374 KGFAYVMFKNPGDAANAYVE-LDKQIFQGRLLHILPGEQKKSHR---LDEFDLKNL-PLK 428
            G+AYV F N  DAA   +E L+    +G+L  I+  ++  S R        +KNL P  
Sbjct: 76  LGYAYVNF-NDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDI 134

Query: 429 KQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLGVQKSDLIDATDASAAVKQALAEA 488
             ++L       +DTFS     ++            G       +   AS A+  AL   
Sbjct: 135 DNKAL-------YDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAI-DALNGM 186

Query: 489 HVIGD---VRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLFLPFGK 545
            + G    V  +   K  + +KFE+ K+    + T + +KN    TT  E  +L   FGK
Sbjct: 187 LLNGQEIYVGPHLSKKERE-SKFEEMKA----NFTNVYIKNINTETTDKEFEELVAKFGK 241

Query: 546 LQRLLL---PPAQT--IAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPE 600
              ++L   P  +      V + +   A     +L+   FK   LY+ +  K  + R+  
Sbjct: 242 TDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK-YERQ-- 298

Query: 601 GDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFST 660
                                   E+ +   A++ E             ++F+KNL+ S 
Sbjct: 299 -----------------------QELKKQYEATRME-----KMAKYQGINLFIKNLDDSI 330

Query: 661 TGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVL 720
             K+L E+F  +G    A+V T  + K      S GFGF  F T E+A   I   +  ++
Sbjct: 331 DDKKLEEEFAPYGTITSAKVMTTENGK------SKGFGFVCFSTPEEATKAITEKNQQIV 384

Query: 721 DGHRIQLKLSHR 732
            G  + + ++ R
Sbjct: 385 AGKPLYVAIAQR 396

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 86/212 (40%), Gaps = 16/212 (7%)

Query: 623 GDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKT 682
           G EI      SK E             ++++KN+N  TT KE  E    FG      ++ 
Sbjct: 190 GQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLER 249

Query: 683 KPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDG-----HRIQLKLSH-----R 732
            P+ +N       GFGF  F   E A+  ++ ++     G     +R Q K        +
Sbjct: 250 TPEGENK------GFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKK 303

Query: 733 XXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAF 792
                            + +KNL   ++ K++ E F+ +G + S ++    +  ++GF F
Sbjct: 304 QYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGF 363

Query: 793 VEFLLPKEAENAMEQLQGVHLLGRRLVMQHAE 824
           V F  P+EA  A+ +     + G+ L +  A+
Sbjct: 364 VCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF++N+  +  +    + FAP+G +    V + T  GKSKGF +V F  P +A  A  E 
Sbjct: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTTENGKSKGFGFVCFSTPEEATKAITEK 379

Query: 395 DKQIFQGRLLHILPGEQKKSHR 416
           ++QI  G+ L++   ++K   R
Sbjct: 380 NQQIVAGKPLYVAIAQRKDVRR 401

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V +L   V    ++++FS  G + S+R+ +    K++ G+A+V F     A+ A+E+L
Sbjct: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96

Query: 809 QGVHLLGRRLVMQHAEEEP 827
               + G+   +  ++ +P
Sbjct: 97  NFTPIKGKLCRIMWSQRDP 115

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 29/52 (55%)

Query: 38  SLTDVKILKNRAGESRRFAFVGFKSEEDAFDAVNYFDQSFIDTSKIEVSMAK 89
           ++T  K++    G+S+ F FV F + E+A  A+   +Q  +    + V++A+
Sbjct: 344 TITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 88/186 (47%), Gaps = 11/186 (5%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +IFV  L++S   + L ++F+  GG + A+V  +          S G+G+ +F+ +  A 
Sbjct: 169 TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYE-----RGTDRSRGYGYVDFENKSYAE 223

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXX-----XXXXXXIIVKNLPFEVERKQI 764
             I  M G  +DG  I   +S                        + + NL F  +R  I
Sbjct: 224 KAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAI 283

Query: 765 FELFSSFGQLKSVRLPKKFD-KSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHA 823
           FELF+  G++ SVR+P   + +  +GF +V+F   ++A+ A++ LQG ++  R + +  +
Sbjct: 284 FELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFS 343

Query: 824 EEEPQD 829
              P +
Sbjct: 344 SPRPNN 349

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%)

Query: 330 EATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAAN 389
           E +  LFL N+ + A  D   +LFA  GE+  V +     T + KGF YV F N  DA  
Sbjct: 264 EPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKK 323

Query: 390 AYVELDKQIFQGRLLHI 406
           A   L  +    R + +
Sbjct: 324 ALDALQGEYIDNRPVRL 340

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 38/80 (47%)

Query: 327 QKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGD 386
           ++ E    +F+  + ++  ++  +K F   G +    V  +  T +S+G+ YV F+N   
Sbjct: 162 EETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSY 221

Query: 387 AANAYVELDKQIFQGRLLHI 406
           A  A  E+  +   GR ++ 
Sbjct: 222 AEKAIQEMQGKEIDGRPINC 241

>KLLA0C11495g complement(990832..992169) some similarities with
           sp|P27476 Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, hypothetical
           start
          Length = 445

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 90/182 (49%), Gaps = 13/182 (7%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +IFV  L++S   + L  +F+  GG + A+V  +   + +++  S G+G+ +F+ +  A 
Sbjct: 197 TIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYE---RGTDR--SRGYGYVDFEDKSYAE 251

Query: 710 AVIDAMDGAVLDGHRIQLKLS-------HRXXXXXXXXXXXXXXXXXIIVKNLPFEVERK 762
             I  M G  +DG  I   +S        R                 + + NL FE +R 
Sbjct: 252 KAIKEMHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRD 311

Query: 763 QIFELFSSFGQLKSVRLPKKFD-KSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQ 821
            ++E+F  +G++ SVR+P   + +  +GF +V++   ++A  A E LQG ++  R + + 
Sbjct: 312 NLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPVRLD 371

Query: 822 HA 823
           ++
Sbjct: 372 YS 373

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%)

Query: 330 EATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAAN 389
           E +  LFL N+ + A  D+  ++F  +GE+  V +     T + KGF YV + +  DA  
Sbjct: 294 EPSDTLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATK 353

Query: 390 AYVELDKQIFQGRLLHI 406
           A+  L  +    R + +
Sbjct: 354 AFEGLQGEYINNRPVRL 370

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 88/186 (47%), Gaps = 13/186 (6%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +IFV  L++S   + L  +F   GG V A+V  +   + ++K  S G+G+ +F+    A 
Sbjct: 168 TIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYE---RGTDK--SRGYGYVDFEDVSYAE 222

Query: 710 AVIDAMDGAVLDGHRIQLKLS-------HRXXXXXXXXXXXXXXXXXIIVKNLPFEVERK 762
             +  M G  +DG  I   +S        R                 + + NL F  +R 
Sbjct: 223 KAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRD 282

Query: 763 QIFELFSSFGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQ 821
            +FELFS  G + SVR+P   + +  +GF +V++   +EA+ A++ LQG ++  R + + 
Sbjct: 283 ALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRID 342

Query: 822 HAEEEP 827
            +   P
Sbjct: 343 FSSPRP 348

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LFL N+ + A  D   +LF+  G +  V +     + + KGF YV + +  +A  A   L
Sbjct: 270 LFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDAL 329

Query: 395 DKQIFQGRLLHI 406
             +    R + I
Sbjct: 330 QGEYIDNRPVRI 341

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRL--PKKFDKSARGFAFVEFLLPKEAENAMEQ 807
           I V  L + V+ + +   F   G +   R+   +  DKS RG+ +V+F     AE A+++
Sbjct: 169 IFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKS-RGYGYVDFEDVSYAEKAVKE 227

Query: 808 LQGVHLLGRRLVMQHAEEEPQDA 830
           + G  + GR +    +  +P  A
Sbjct: 228 MHGKEIDGRAINCDMSTSKPASA 250

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 21/101 (20%), Positives = 48/101 (47%), Gaps = 3/101 (2%)

Query: 309 STEQQESKLDTTEEEKFIQKIEATGR---LFLRNILYTATEDDFRKLFAPFGELEEVHVA 365
           S E+ + +   +E++   +K +  G+   +F+  + ++  ++  +  F   G +    V 
Sbjct: 140 SKEESKKRSAESEDDAVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVI 199

Query: 366 LDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHI 406
            +  T KS+G+ YV F++   A  A  E+  +   GR ++ 
Sbjct: 200 YERGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINC 240

>Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement
          Length = 589

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 108/441 (24%), Positives = 171/441 (38%), Gaps = 79/441 (17%)

Query: 307 PESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVAL 366
           P STE + +K+DT+    ++ +++ T            TE     LF+P G +  + V  
Sbjct: 25  PTSTESENAKVDTSSASLYVGELDPT-----------VTEALLYDLFSPIGSVSSIRVCR 73

Query: 367 DTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHR---LDEFDLK 423
           D  T  S G+AYV F +      A  +L+    +GR   I+  ++  S R        +K
Sbjct: 74  DAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIK 133

Query: 424 NL-PLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLG---VQKSDLIDATDASA 479
           NL P    ++L       HDTFS     ++            G   V   +   A +A  
Sbjct: 134 NLHPAIDNKAL-------HDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVD 186

Query: 480 AVKQAL---AEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSEL 536
           A+   L    E +V   V     SK    +K E+ KS    + T + VKN    TT  E 
Sbjct: 187 AINGMLLNGQEVYVAPHV-----SKKDRQSKLEEAKS----NFTNIYVKNIDLETTQEEF 237

Query: 537 ADLFLPFGKLQRLLLP-----PAQTIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGP 591
             LF  FGK+   +L        +    + + D  SA  A  +L+   FK   LY+ +  
Sbjct: 238 EALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQ 297

Query: 592 KNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEXXXXXXXXXXXXXSI 651
           K  + R                  ++E R             + E             ++
Sbjct: 298 KK-YER------------------LQELR------------KQYEVSRLEKLAKYQGVNL 326

Query: 652 FVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAV 711
           FVKNL+ S   ++L ++F  FG    A+V  + D  NS      GFGF  F T E+A   
Sbjct: 327 FVKNLDDSIDDEKLRDEFAPFGAITSAKV-MRDDAGNSK-----GFGFVCFSTPEEATKA 380

Query: 712 IDAMDGAVLDGHRIQLKLSHR 732
           I   +  ++ G  + + ++ R
Sbjct: 381 ITEKNQQIVAGKPLYVAIAQR 401

 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 94/200 (47%), Gaps = 11/200 (5%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +IF+KNL+ +   K L + F  FG  +  ++ T  D   ++K    GFGF  F+    A 
Sbjct: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIAT--DEAGNSK----GFGFVHFEEEYSAK 182

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFS 769
             +DA++G +L+G  + +                      I VKN+  E  +++   LF+
Sbjct: 183 EAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFT 242

Query: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQD 829
            FG++ S  L +  +   RGF F+ F   + A  A+++L       +RL +  A+++ + 
Sbjct: 243 QFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKYER 302

Query: 830 AEE-----QIARMTKKVRSQ 844
            +E     +++R+ K  + Q
Sbjct: 303 LQELRKQYEVSRLEKLAKYQ 322

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF++N+  +  ++  R  FAPFG +    V  D   G SKGF +V F  P +A  A  E 
Sbjct: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITEK 384

Query: 395 DKQIFQGRLLHILPGEQKKSHR 416
           ++QI  G+ L++   ++K   R
Sbjct: 385 NQQIVAGKPLYVAIAQRKDVRR 406

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/371 (19%), Positives = 130/371 (35%), Gaps = 68/371 (18%)

Query: 516 DRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRL------LLPPAQTIAVVQYRDATSAR 569
           D     L V       T + L DLF P G +  +      +   +   A V + D  + R
Sbjct: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGR 95

Query: 570 AAFSKLSYKRFKDG---ILYLE-------KGPKNCFSR--EPEGDETMVDEIVAQSTNVK 617
            A  KL+Y   K     I++ +       KG  N F +   P  D   + +  +   N+ 
Sbjct: 96  TAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNIL 155

Query: 618 EARTT----------------------------------GDEIMQTATASKPEXXXXXXX 643
             +                                    G E+      SK +       
Sbjct: 156 SCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEE 215

Query: 644 XXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFK 703
                 +I+VKN++  TT +E    F  FG    A ++   + K        GFGF  F+
Sbjct: 216 AKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGK------PRGFGFINFE 269

Query: 704 TREQALAVIDAMDGAVLDGHRI----------QLKLSHRXXXXXXXXXXXXXXXXXIIVK 753
             E A   +D ++       R+          +L+   +                 + VK
Sbjct: 270 DHESAAKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVK 329

Query: 754 NLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHL 813
           NL   ++ +++ + F+ FG + S ++ +    +++GF FV F  P+EA  A+ +     +
Sbjct: 330 NLDDSIDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIV 389

Query: 814 LGRRLVMQHAE 824
            G+ L +  A+
Sbjct: 390 AGKPLYVAIAQ 400

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 11/86 (12%)

Query: 4   VIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFKSE 63
           + VK +   + ++KL+D F    A           +T  K++++ AG S+ F FV F + 
Sbjct: 326 LFVKNLDDSIDDEKLRDEFAPFGA-----------ITSAKVMRDDAGNSKGFGFVCFSTP 374

Query: 64  EDAFDAVNYFDQSFIDTSKIEVSMAK 89
           E+A  A+   +Q  +    + V++A+
Sbjct: 375 EEATKAITEKNQQIVAGKPLYVAIAQ 400

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 88/182 (48%), Gaps = 13/182 (7%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +IFV  L++S   + L  +F   GG V A+V  +   + S++  S G+G+ +F+ +  A 
Sbjct: 174 TIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYE---RGSDR--SRGYGYVDFEDKHYAE 228

Query: 710 AVIDAMDGAVLDGHRIQLKLS-------HRXXXXXXXXXXXXXXXXXIIVKNLPFEVERK 762
             +  M G  +DG  I   +S        R                 + + NL F  +R 
Sbjct: 229 KAVKEMHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRD 288

Query: 763 QIFELFSSFGQLKSVRLPKKFD-KSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQ 821
            +FE+FS  G++ SVR+P   + +  +GF +V++    +A+ A E LQG ++  R + + 
Sbjct: 289 NLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLD 348

Query: 822 HA 823
           ++
Sbjct: 349 YS 350

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LFL N+ + A  D+  ++F+  GE+  V +     T + KGF YV + +  DA  A+  L
Sbjct: 276 LFLGNLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEAL 335

Query: 395 DKQIFQGRLLHI 406
             +    R + +
Sbjct: 336 QGEYIDNRPVRL 347

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 140/333 (42%), Gaps = 42/333 (12%)

Query: 289 ARPKSDIREEDNVESTEDPESTEQQ-ESKLDTTEEEKFIQKIEATGRLFLRNILYTATED 347
            + K+ +++ D   +T++ +  EQ  E  +     +K+I K   T  LF+ N+  T TE+
Sbjct: 66  VKEKNSLKKYDCKNATQEKKEQEQVFEKTVAKGSVQKYITKTSKTNSLFIGNLKSTVTEE 125

Query: 348 DFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHIL 407
             RK+F  +   E   V  D  T KS G+ Y+ FK+  DA +A  E +  +F G+ + I+
Sbjct: 126 MLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIM 185

Query: 408 PGEQKKSHRLD---EFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAK- 463
           P  +    R +        NLPL+         N    T S+  + +    VL  +  + 
Sbjct: 186 PSMKNTLFRKNIGTNVFFSNLPLE---------NPQLTTRSFYLIMIEYGNVLSCLLERR 236

Query: 464 --LGVQKSDLIDATDASAAVK----------QALAEAHVIGDVR------KYFESKGMDL 505
             +G    D  +   A   +K          + +   H   +VR      K  +  G D+
Sbjct: 237 KNIGFVYFD--NDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEFTKRKKMIGSDI 294

Query: 506 TKFEQFKSPSDRDDT----VLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQT----I 557
              ++  + ++  D      +LVKN P  TT  E+ D F   G ++ + +   Q      
Sbjct: 295 VIEDELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANTPHK 354

Query: 558 AVVQYRDATSARAAFSKLSYKRFKDGILYLEKG 590
           A V Y++   ++ A   L+   FK+  +++  G
Sbjct: 355 AFVTYKNEEESKKAQKCLNKTIFKNHTIWVGPG 387

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/174 (19%), Positives = 67/174 (38%), Gaps = 19/174 (10%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           S+F+ NL  + T + L + FK +  F  A+V      K S     +G+G+  FK +  A 
Sbjct: 112 SLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKS-----LGYGYLNFKDKNDAE 166

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFE---VERKQIFE 766
           +     +  V  G  +++  S +                 +   NLP E   +  +  + 
Sbjct: 167 SARKEFNYTVFFGQEVKIMPSMK------NTLFRKNIGTNVFFSNLPLENPQLTTRSFYL 220

Query: 767 LFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVM 820
           +   +G + S  L ++     +   FV F     A N +++       G +++ 
Sbjct: 221 IMIEYGNVLSCLLERR-----KNIGFVYFDNDISARNVIKKYNNQEFFGNKIIC 269

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           + ++N+    T+++    F+  G ++ V ++   +   +   A+V +KN  ++  A   L
Sbjct: 315 ILVKNLPSDTTQEEVLDYFSTIGPIKSVFIS--EKQANTPHKAFVTYKNEEESKKAQKCL 372

Query: 395 DKQIFQGRLLHILPGEQKKSH 415
           +K IF+   + + PG+ K  H
Sbjct: 373 NKTIFKNHTIWVGPGKDKPVH 393

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQL 808
           I+VKNLP +  ++++ + FS+ G +KSV + +K   +    AFV +   +E++ A + L
Sbjct: 315 ILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANTPHK-AFVTYKNEEESKKAQKCL 372

>Kwal_56.23486
          Length = 587

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 90/200 (45%), Gaps = 11/200 (5%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++F+KNL+ +   K L + F  FG  +  ++ T    K      S  FGF  F+  E A 
Sbjct: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGK------SRKFGFVHFEEEEAAK 182

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFS 769
             IDA++G +L+G  + +                      + VKN+  E ++ +  +LFS
Sbjct: 183 EAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFS 242

Query: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQD 829
            +G + S  L    +   RGF FV F     A  A+E+L      G++L +  A+++ + 
Sbjct: 243 QYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYER 302

Query: 830 AEE-----QIARMTKKVRSQ 844
            +E     + +RM K  + Q
Sbjct: 303 LQELKKQYESSRMEKLAKYQ 322

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 100/420 (23%), Positives = 164/420 (39%), Gaps = 74/420 (17%)

Query: 331 ATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
           ++  L++  +  + TE     LF+P G +  + V  D  T  S G+AYV F +      A
Sbjct: 38  SSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTA 97

Query: 391 YVELDKQIFQGRLLHILPGEQKKSHR---LDEFDLKNL-PLKKQRSLKRKANASHDTFS- 445
             +L+    +GR   I+  ++  S R        +KNL P    ++L       HDTFS 
Sbjct: 98  IEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKAL-------HDTFSV 150

Query: 446 WNSLYMNQDAV--------LGSVAAKLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKY 497
           + ++   + A          G V  +      + IDA +    +   L E +V   V   
Sbjct: 151 FGNILSCKIATDETGKSRKFGFVHFEEEEAAKEAIDAIN--GMLLNGL-EVYVAPHV--- 204

Query: 498 FESKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPP---- 553
             SK    +K ++ KS    + T + VKN    T   E   LF  +G +   +L      
Sbjct: 205 --SKKDRQSKLDEVKS----NFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEG 258

Query: 554 -AQTIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEIVAQ 612
             +    V + D  +A  A  +L+   F    LY+ +  K  + R  E     + +    
Sbjct: 259 KLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK-YERLQE-----LKKQYES 312

Query: 613 STNVKEARTTGDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTF 672
           S   K A+  G                          ++FVKNL+ S   ++L E+F  F
Sbjct: 313 SRMEKLAKYQG-------------------------VNLFVKNLDDSIDDEKLQEEFAPF 347

Query: 673 GGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHR 732
           G   +  VK   D   S+K    GFGF  F T E+A   I   +  ++ G  + + ++ R
Sbjct: 348 G--TITSVKVMRDDAGSSK----GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF++N+  +  ++  ++ FAPFG +  V V  D   G SKGF +V F  P +A  A  E 
Sbjct: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITEK 384

Query: 395 DKQIFQGRLLHILPGEQKKSHR 416
           ++QI  G+ L++   ++K+  R
Sbjct: 385 NQQIVAGKPLYVAIAQRKEVRR 406

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 82/185 (44%), Gaps = 16/185 (8%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +++VKN++  T   E  + F  +G    A ++T       N+    GFGF  F+    A 
Sbjct: 222 NVYVKNIDPETKQDEFEKLFSQYGAITSAVLET------DNEGKLRGFGFVNFEDHNAAA 275

Query: 710 AVIDAMDGAVLDGHRI----------QLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEV 759
             ++ ++    +G ++          +L+   +                 + VKNL   +
Sbjct: 276 KAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSI 335

Query: 760 ERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLV 819
           + +++ E F+ FG + SV++ +    S++GF FV F  P+EA  A+ +     + G+ L 
Sbjct: 336 DDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 395

Query: 820 MQHAE 824
           +  A+
Sbjct: 396 VAIAQ 400

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 32/52 (61%)

Query: 38  SLTDVKILKNRAGESRRFAFVGFKSEEDAFDAVNYFDQSFIDTSKIEVSMAK 89
           ++T VK++++ AG S+ F FV F + E+A  A+   +Q  +    + V++A+
Sbjct: 349 TITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V  L   V    +++LFS  G + S+R+ +    K++ G+A+V F        A+E+L
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101

Query: 809 QGVHLLGRRLVMQHAEEEP 827
               + GR   +  ++ +P
Sbjct: 102 NYTPIKGRPCRIMWSQRDP 120

>Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement
          Length = 464

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 77/205 (37%), Gaps = 38/205 (18%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +F+ NL +S   + L + FK  G  + A VK   D        S G+G   +KT+E+   
Sbjct: 263 VFIANLPYSVNWQALKDMFKECGDVLRADVKLDRD------GYSRGYGVVYYKTKEEVQV 316

Query: 711 VID-----AMDGAVLDGHRIQLKLSHRXXXX---------------------------XX 738
            I+      ++G VLD H  +L  +                                   
Sbjct: 317 AIERYNGYELEGRVLDVHEGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLNTEFTE 376

Query: 739 XXXXXXXXXXXIIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLP 798
                      I V NLP+   +  +F+LF + G++    L   ++    G A VE+  P
Sbjct: 377 MATGGGDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNP 436

Query: 799 KEAENAMEQLQGVHLLGRRLVMQHA 823
            +AE  + +L   +  GR L + + 
Sbjct: 437 ADAEVCISRLNSYNYGGRDLDISYV 461

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 70/185 (37%), Gaps = 14/185 (7%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           SIFV NL +    ++L E F   G  V A + T       ++    G G  EF   +   
Sbjct: 163 SIFVGNLTYDCQPEDLKEYFSQIGEVVRADIIT-------SRGHHRGMGTVEFTNADDVD 215

Query: 710 AVIDAMDGAVLDGHRIQLKLSH-------RXXXXXXXXXXXXXXXXXIIVKNLPFEVERK 762
             I   DG+ L    I ++  +                         + + NLP+ V  +
Sbjct: 216 EAIRRFDGSTLLDREIFVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNWQ 275

Query: 763 QIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQH 822
            + ++F   G +    +    D  +RG+  V +   +E + A+E+  G  L GR L +  
Sbjct: 276 ALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVHE 335

Query: 823 AEEEP 827
            +  P
Sbjct: 336 GKLGP 340

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 506 TKFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQT-----IAVV 560
           T+F +  +      + + V N P+ T  S+L DLF   GK+ R  L  A        AVV
Sbjct: 372 TEFTEMATGGGDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVV 431

Query: 561 QYRDATSARAAFSKLS 576
           +Y +   A    S+L+
Sbjct: 432 EYDNPADAEVCISRLN 447

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+ N+ ++  + D   LF   G++    +      GK  G A V + NP DA      L
Sbjct: 388 IFVDNLPWSTAQSDLFDLFETIGKVNRAELKF-AYNGKPSGAAVVEYDNPADAEVCISRL 446

Query: 395 DKQIFQGRLLHI 406
           +   + GR L I
Sbjct: 447 NSYNYGGRDLDI 458

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 1/84 (1%)

Query: 326 IQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPG 385
           IQ       +F+ N+ Y+      + +F   G++    V LD R G S+G+  V +K   
Sbjct: 254 IQASAPGYEVFIANLPYSVNWQALKDMFKECGDVLRADVKLD-RDGYSRGYGVVYYKTKE 312

Query: 386 DAANAYVELDKQIFQGRLLHILPG 409
           +   A    +    +GR+L +  G
Sbjct: 313 EVQVAIERYNGYELEGRVLDVHEG 336

>AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH]
           complement(232080..234269) [2190 bp, 729 aa]
          Length = 729

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 74/196 (37%), Gaps = 28/196 (14%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV+N+ F  T  ELT+ F  F     A +         N   S GFGF  F       
Sbjct: 17  TLFVRNIPFDATDAELTDFFSQFAPIKHAVIV------KDNAGSSRGFGFVSFAVESDTQ 70

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXX--------------------- 748
           A +D        G  +++ ++ R                                     
Sbjct: 71  AALDKGRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKP 130

Query: 749 XIIVKNLPFEV-ERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQ 807
            +I++N+P+   +  ++ ++F  FG +    +P+K D    GFAFV          A+E+
Sbjct: 131 KLIIRNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEE 190

Query: 808 LQGVHLLGRRLVMQHA 823
            +G+ + GR + +  A
Sbjct: 191 CKGLKIDGREVAVDFA 206

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+RNI + AT+ +    F+ F  ++   +  D   G S+GF +V F    D   A  + 
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDN-AGSSRGFGFVSFAVESDTQAALDKG 76

Query: 395 DKQIFQGRLLHI 406
            K  F+GRLL +
Sbjct: 77  RKTQFKGRLLRV 88

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 88/216 (40%), Gaps = 32/216 (14%)

Query: 518 DDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLL-----PPAQTIAVVQYRDATSARAAF 572
           D   L V+N PF  T +EL D F  F  ++  ++       ++    V +   +  +AA 
Sbjct: 14  DLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAAL 73

Query: 573 SKLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATA 632
            K    +FK  +L ++   +    R  +GDE              EA+T+ ++  +  TA
Sbjct: 74  DKGRKTQFKGRLLRVDVAKRR--ERSKKGDEA-------------EAQTSAEDAEKPTTA 118

Query: 633 SKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGF-VVAQVKTKPDPKNSNK 691
             PE              + ++N+ +S   ++ T+  K FG F VVA+      P+ ++ 
Sbjct: 119 --PEGDEALMRGKPK---LIIRNMPWSC--RDPTKLKKIFGRFGVVAEASI---PRKADG 168

Query: 692 TLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQL 727
            L  GF F   K        I+   G  +DG  + +
Sbjct: 169 KL-CGFAFVTMKKLSNCRKAIEECKGLKIDGREVAV 203

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 15/89 (16%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGD----AANA 390
           +F+RN+ Y AT++     F+ FG ++      D  TG  KG A+V FK+        ANA
Sbjct: 290 VFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFKDESTFDTCVANA 349

Query: 391 YVELDKQ-----------IFQGRLLHILP 408
            V   K            +++GR+L I P
Sbjct: 350 PVVDSKSLLISDDVAPEYVYEGRILAITP 378

>Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement
          Length = 697

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 25/137 (18%)

Query: 297 EEDNVESTEDPESTEQQ-----ESKLDTTEEEKFIQKIEATGR-----LFLRNILYTATE 346
           E+DN+E+++D E + QQ     E +L++ EE +  Q  +   +     +F+RN+ Y AT+
Sbjct: 252 EKDNLENSDDDEESSQQGESEDEVELNSDEEVEEPQPRQKKNKQESFSIFVRNVPYDATQ 311

Query: 347 DDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKN-----------PGDAANAYV--- 392
           +     F  FG ++     LD  TG +KG A+V FK            P  A+ + +   
Sbjct: 312 ESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAFKTEEAFSECVDNAPSAASTSLLISD 371

Query: 393 -ELDKQIFQGRLLHILP 408
             L + +++GR+L I P
Sbjct: 372 DVLPQYVYEGRILSITP 388

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 75/190 (39%), Gaps = 22/190 (11%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV+++ F    +E  + F  F     A +K     K+S K  S GFGF  F   +   
Sbjct: 27  TLFVRSIPFDANDEEFADFFSQF-----APIKHSVIVKDSEKQ-SRGFGFVSFAVEDDTK 80

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXX---------------IIVKN 754
             +     A      +++ ++ R                                +I++N
Sbjct: 81  EALAQARKAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKPKLIIRN 140

Query: 755 LPFEVERKQIFE-LFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHL 813
           +P+      + + LFS FG +   ++PKK      GFAFV        + A+E+ + + +
Sbjct: 141 MPWSCRDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKI 200

Query: 814 LGRRLVMQHA 823
            GR++ +  A
Sbjct: 201 DGRQVAIDFA 210

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+R+I + A +++F   F+ F  ++   +  D+   +S+GF +V F    D   A  + 
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEK-QSRGFGFVSFAVEDDTKEALAQA 86

Query: 395 DKQIFQGRLLHI 406
            K  F+ RLL I
Sbjct: 87  RKAKFKNRLLRI 98

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 43/224 (19%), Positives = 87/224 (38%), Gaps = 40/224 (17%)

Query: 512 KSPSDR--DDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLL-----PPAQTIAVVQYRD 564
           +SP+D   D   L V++ PF     E AD F  F  ++  ++       ++    V +  
Sbjct: 16  QSPNDDGLDMKTLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAV 75

Query: 565 ATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGD 624
               + A ++    +FK+ +L ++   +   S+         +E   +S +     +  +
Sbjct: 76  EDDTKEALAQARKAKFKNRLLRIDIAKRRERSKR--------NEPRQESEHKSYKESNEE 127

Query: 625 EIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEK-FKTFGGFVVAQVKTK 683
           E+M+     KP+              + ++N+ +S     + +K F  FG  V A++   
Sbjct: 128 ELMK----GKPK--------------LIIRNMPWSCRDAAVLKKLFSRFGTVVEAKI--- 166

Query: 684 PDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQL 727
             PK +   L  GF F   K        I+      +DG ++ +
Sbjct: 167 --PKKAGGKLC-GFAFVTMKKLSACKRAIEEGKDMKIDGRQVAI 207

>YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein
           involved in mRNA export, binds poly(A)+ RNA and
           single-stranded G-strand telomere sequence, has three
           RNA recognition (RRM) domains [1284 bp, 427 aa]
          Length = 427

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 69/174 (39%), Gaps = 12/174 (6%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           SIFV+NL F  T ++L E F T G  V A + T        K    G G  EF   E   
Sbjct: 123 SIFVRNLTFDCTPEDLKELFGTVGEVVEADIITS-------KGHHRGMGTVEFTKNESVQ 175

Query: 710 AVIDAMDGAVLDGHRIQLKLSH-----RXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQI 764
             I   DGA+    ++ ++  +                       + + NLP+ +  + +
Sbjct: 176 DAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSL 235

Query: 765 FELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRL 818
            ++F   G +    +   F+  +RGF  V +    E   A++   G+ + GR L
Sbjct: 236 KDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVL 289

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/255 (20%), Positives = 90/255 (35%), Gaps = 62/255 (24%)

Query: 327 QKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGD 386
           ++I+    +F+ N+ Y+      + +F   G +    V LD   G S+GF  V++    +
Sbjct: 213 EEIDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDF-NGFSRGFGSVIYPTEDE 271

Query: 387 AANAYVELDKQIFQGRLLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSW 446
              A    +    +GR+L +  G   K    D ++ +   L+  R               
Sbjct: 272 MIRAIDTFNGMEVEGRVLEVREGRFNKRKNNDRYNQRREDLEDTR--------------- 316

Query: 447 NSLYMNQDAVLGSVAAKLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLT 506
                           + G+       A DA+  + +  A                    
Sbjct: 317 --------------GTEPGL-------AQDAAVHIDETAA-------------------- 335

Query: 507 KFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQT-----IAVVQ 561
           KF +  +P    +  +   N PF T  S+L DLF P GK+    L P +      +AVV+
Sbjct: 336 KFTEGVNPGGDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVE 395

Query: 562 YRDATSARAAFSKLS 576
           Y +   A     KL+
Sbjct: 396 YENLVDADFCIQKLN 410

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I   NLPF   R  +F+LF   G++ +  L  + +    G A VE+    +A+  +++L 
Sbjct: 351 IYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLN 410

Query: 810 GVHLLGRRLVMQHA 823
             +  G  L + +A
Sbjct: 411 NYNYGGCSLQISYA 424

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 45/91 (49%), Gaps = 1/91 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I V+NL F+   + + ELF + G++    +        RG   VEF   +  ++A+ +  
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADIITS-KGHHRGMGTVEFTKNESVQDAISKFD 182

Query: 810 GVHLLGRRLVMQHAEEEPQDAEEQIARMTKK 840
           G   + R+L+++     P+ A+E   + T++
Sbjct: 183 GALFMDRKLMVRQDNPPPEAAKEFSKKATRE 213

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 2/72 (2%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+RN+ +  T +D ++LF   GE+ E  +   T  G  +G   V F       +A  + 
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADII--TSKGHHRGMGTVEFTKNESVQDAISKF 181

Query: 395 DKQIFQGRLLHI 406
           D  +F  R L +
Sbjct: 182 DGALFMDRKLMV 193

>CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 380

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 85/195 (43%), Gaps = 28/195 (14%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVK--------------TKPDPKNSNKTL-SM 695
           +++ NL+F TT +++T        F+V + K                P  KN  K + + 
Sbjct: 115 VWIGNLSFDTTKEDITR-------FIVGKTKGTDVEITEEDLVRVNMPLAKNDGKQIKNK 167

Query: 696 GFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSH----RXXXXXXXXXXXXXXXXXII 751
           GF + +FKT+EQ  A I  +  + L+G  + +K S     R                 + 
Sbjct: 168 GFCYVDFKTQEQVEAAI-KLSESQLNGRNLLIKNSKSYEGRPDKTDLVSMSKNPPSRILF 226

Query: 752 VKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQLQG 810
           V NL F+   + + + F   G++  +R+    D    +GFAFV+F   + A NA++    
Sbjct: 227 VGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDKSC 286

Query: 811 VHLLGRRLVMQHAEE 825
             + GR L M+  E+
Sbjct: 287 RKIAGRPLRMEFGED 301

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 43/78 (55%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+ N+ +  T++  RK F   GE+ ++ +A    +GK KGFA+V FKN   A NA  + 
Sbjct: 225 LFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDK 284

Query: 395 DKQIFQGRLLHILPGEQK 412
             +   GR L +  GE +
Sbjct: 285 SCRKIAGRPLRMEFGEDR 302

>CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces
           cerevisiae YNL110c, hypothetical start
          Length = 255

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 306 DPESTEQQESKLDTTEEEKFIQK----IEATGRLFLRNILYTATEDDFRKLFAPFGELEE 361
           + E +     KLDT++++K  +K     + +G +++  +     E +  K F+ FG+L+E
Sbjct: 94  ETEQSGHHIKKLDTSKKQKATKKDDKDSDISGIIYVGRLPKGFHERELSKYFSQFGDLKE 153

Query: 362 VHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHI--LP 408
           V +A + +TG S+ + +V F N  D+  AY  ++  +  G LL +  LP
Sbjct: 154 VRLARNKKTGNSRHYGFVQFVNTDDSRVAYDTMNNYLLMGHLLQVRLLP 202

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V  LP     +++ + FS FG LK VRL + K   ++R + FV+F+   ++  A + +
Sbjct: 127 IYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDTM 186

Query: 809 QGVHLLGRRL 818
               L+G  L
Sbjct: 187 NNYLLMGHLL 196

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 5/112 (4%)

Query: 618 EARTTGDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVV 677
           E   +G  I +  T+ K +              I+V  L      +EL++ F  FG   +
Sbjct: 94  ETEQSGHHIKKLDTSKKQKATKKDDKDSDISGIIYVGRLPKGFHERELSKYFSQFGD--L 151

Query: 678 AQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKL 729
            +V+   + K  N   S  +GF +F   + +    D M+  +L GH +Q++L
Sbjct: 152 KEVRLARNKKTGN---SRHYGFVQFVNTDDSRVAYDTMNNYLLMGHLLQVRL 200

>YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with
           similarity to Rlf6p, contains three RNA recognition
           motif (RRM) domains [1290 bp, 429 aa]
          Length = 429

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/312 (21%), Positives = 108/312 (34%), Gaps = 71/312 (22%)

Query: 316 KLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKG 375
           +LD+T EEK  +    +  +F+ N+ Y +T +D  + F+  G++  V   + T  G  +G
Sbjct: 121 ELDSTYEEKVNRNYSNS--IFVGNLTYDSTPEDLTEFFSQIGKV--VRADIITSRGHHRG 176

Query: 376 FAYVMFKNPGDAANAYVELDKQIFQGRLLHILP-----------------GEQKKSHRLD 418
              V F N  D   A  + D   F  R + +                   GE + + +  
Sbjct: 177 MGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRKTH 236

Query: 419 EFDLKNLPLK-KQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLGVQKSDLIDATDA 477
           E  +KNLP     ++LK       D F       + D  L       G       D  D 
Sbjct: 237 EVIVKNLPASVNWQALK-------DIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDL 289

Query: 478 SAAVKQALAEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDT----------------- 520
             A+++    +          E   +D+   E   + SD DD                  
Sbjct: 290 HRAIEKYNGYS---------IEGNVLDVKSKESVHNHSDGDDVDIPMDDSPVNEEARKFT 340

Query: 521 -----------VLLVKNFPFGTTHSELADLFLPFGKLQRLLL-----PPAQTIAVVQYRD 564
                      ++   N PF T  S+L DLF   GK+    L          IAVV+Y +
Sbjct: 341 ENVVGGGERNRLIYCSNLPFSTAKSDLYDLFETIGKVNNAELRYDSKGAPTGIAVVEYDN 400

Query: 565 ATSARAAFSKLS 576
              A     +L+
Sbjct: 401 VDDADVCIERLN 412

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 69/183 (37%), Gaps = 15/183 (8%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           SIFV NL + +T ++LTE F   G  V A + T        +    G G  EF   +   
Sbjct: 137 SIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITS-------RGHHRGMGTVEFTNSDDVD 189

Query: 710 AVIDAMDGAVLDGHRIQLKLSH--------RXXXXXXXXXXXXXXXXXIIVKNLPFEVER 761
             I   DGA     +I ++  +                          +IVKNLP  V  
Sbjct: 190 RAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRKTHEVIVKNLPASVNW 249

Query: 762 KQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQ 821
           + + ++F   G +    +    D  + G   V F   K+   A+E+  G  + G  L ++
Sbjct: 250 QALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDVK 309

Query: 822 HAE 824
             E
Sbjct: 310 SKE 312

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/196 (19%), Positives = 72/196 (36%), Gaps = 28/196 (14%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           + VKNL  S   + L + FK  G    A V+   D       +S G G   F   +    
Sbjct: 238 VIVKNLPASVNWQALKDIFKECGNVAHADVELDGD------GVSTGSGTVSFYDIKDLHR 291

Query: 711 VIDAMDGAVLDGHRIQLK----------------------LSHRXXXXXXXXXXXXXXXX 748
            I+  +G  ++G+ + +K                      ++                  
Sbjct: 292 AIEKYNGYSIEGNVLDVKSKESVHNHSDGDDVDIPMDDSPVNEEARKFTENVVGGGERNR 351

Query: 749 XIIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQL 808
            I   NLPF   +  +++LF + G++ +  L      +  G A VE+    +A+  +E+L
Sbjct: 352 LIYCSNLPFSTAKSDLYDLFETIGKVNNAELRYDSKGAPTGIAVVEYDNVDDADVCIERL 411

Query: 809 QGVHLLGRRLVMQHAE 824
              +  G  L + +A+
Sbjct: 412 NNYNYGGCDLDISYAK 427

>AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH]
           complement(18862..19482) [621 bp, 206 aa]
          Length = 206

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 44/79 (55%)

Query: 328 KIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDA 387
           + + +G +++  + +   E +    FA FG+L++V +A + +TG S+ +A++ F NP DA
Sbjct: 73  RTDLSGIIYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDDA 132

Query: 388 ANAYVELDKQIFQGRLLHI 406
             A   +   +  G LL +
Sbjct: 133 VVAQETMHNYLLMGHLLQV 151

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           I +  LP     +++   F+ FG LK VRL + K   ++R +AF+EF  P +A  A E +
Sbjct: 80  IYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQETM 139

Query: 809 QGVHLLGRRL 818
               L+G  L
Sbjct: 140 HNYLLMGHLL 149

>Scas_701.3
          Length = 321

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 39/60 (65%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+  + Y  TE + +KLF  FGE+E++ +  D  T KSKG+A+++F +P  +  A+ E+
Sbjct: 108 IFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKEI 167

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           I +  LP++    ++ +LF  FG+++ +R+ + K    ++G+AF+ FL P  ++ A +++
Sbjct: 108 IFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKEI 167

Query: 809 ---QGVHLLGRRLVM 820
              +G+ + GR  ++
Sbjct: 168 GVHRGIDIKGRTCIV 182

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 521 VLLVKNFPFGTTHSELADLFLPFGKLQRL------LLPPAQTIAVVQYRDATSARAAFSK 574
            + +   P+ TT  EL  LF+ FG+++++      L   ++  A + + D  S++ AF +
Sbjct: 107 TIFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKE 166

Query: 575 LSYKR 579
           +   R
Sbjct: 167 IGVHR 171

>KLLA0F07799g complement(734889..736463) similar to sp|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, start by
           similarity
          Length = 524

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 59/131 (45%), Gaps = 19/131 (14%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+ N+ +   E+   K F P G++E V +  D++T   KGFAYV FK+    + A +  
Sbjct: 361 VFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLLH 420

Query: 395 DKQIFQGRLLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQD 454
           +K+I +G          KK+ +L     KN+         RKA  +  +   N L   Q 
Sbjct: 421 EKKIHEG----------KKARKLRISRCKNM---------RKAQGNQSSLQNNKLNDQQR 461

Query: 455 AVLGSVAAKLG 465
             LG     LG
Sbjct: 462 TKLGRAKKVLG 472

>Scas_565.8
          Length = 322

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 7/86 (8%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTG------KSKGFAYVMFKNPG 385
           T +L   N+ +  ++ +  +L  PFG++  V    ++  G       S G+AYV+F+ P 
Sbjct: 16  THKLVFTNVRFNTSDAELEELLKPFGKVS-VLTPTESLFGFRGTKVVSIGYAYVIFETPQ 74

Query: 386 DAANAYVELDKQIFQGRLLHILPGEQ 411
            AA A+ EL K  F+GR L+I P E+
Sbjct: 75  LAATAFNELHKTEFKGRTLYIKPYEE 100

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 22/123 (17%)

Query: 522 LLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTI-------------AVVQYRDATSA 568
           L+  N  F T+ +EL +L  PFGK+   +L P +++             A V +     A
Sbjct: 19  LVFTNVRFNTSDAELEELLKPFGKVS--VLTPTESLFGFRGTKVVSIGYAYVIFETPQLA 76

Query: 569 RAAFSKLSYKRFKDGILYLEK-------GPKNCFSREPEGDETMVDEIVAQSTNVKEART 621
             AF++L    FK   LY++        G +  + ++   +E  VD  + Q   V +  T
Sbjct: 77  ATAFNELHKTEFKGRTLYIKPYEEFIPFGWRTKWKKKVRNEEDAVDTQLIQPKKVSKKET 136

Query: 622 TGD 624
           + D
Sbjct: 137 STD 139

>Scas_558.1
          Length = 435

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 74/355 (20%), Positives = 128/355 (36%), Gaps = 82/355 (23%)

Query: 522 LLVKNFPFGTTHSELADLFLPFGKLQRLLLPPA----QTIAVVQYRDATSARAAFSKLSY 577
           + V N  +  T  +L D F   G++ R  +  +    + +  V++ ++     A  +   
Sbjct: 107 IFVGNLTYDCTPEDLRDYFSGIGEVVRADIITSKGHHRGMGTVEFTNSRDVEEAIRQYDS 166

Query: 578 KRFKDGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEAR----TTGDEIMQTATAS 633
             F D  +++ +         P  D    +   ++ T    +R    ++G   MQ+    
Sbjct: 167 SYFMDRQIFVRQD-------NPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQSNMKQ 219

Query: 634 KPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTL 693
             E              IFV NL +S   + L + FK  G  + A V+     +      
Sbjct: 220 GYE--------------IFVANLPYSINWQALKDMFKECGDVMRADVELDRAGR------ 259

Query: 694 SMGFGFAEFKTREQALAVID-----AMDGAVLD---GH--------RIQLKL-------- 729
           S GFG   F+TR+     ID      +DG  LD   GH         IQ +         
Sbjct: 260 SRGFGTVIFRTRDDMERAIDRYNRFEVDGRTLDVREGHSNNRNDDMNIQHQTQNAMTNDA 319

Query: 730 -------------------SHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSS 770
                              S+R                 I   NLP    R  +++LF S
Sbjct: 320 TSDATSNERSLPTQPSEPASNRTSTFTEGVVEGGERNTLIYCSNLPPSTARSDLYDLFES 379

Query: 771 FGQLKSVRLPKKFDKSAR--GFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHA 823
            G++++  L  K+D++    G A VEF+   +A+  +E+L   +  G  L + +A
Sbjct: 380 IGKVRNAEL--KYDRNGETTGVAIVEFISQDDADVCIERLNKYNYGGCDLEISYA 432

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 4/91 (4%)

Query: 316 KLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKG 375
           +LD+T EEK  +    +  +F+ N+ Y  T +D R  F+  GE+  V   + T  G  +G
Sbjct: 90  ELDSTYEEKVNRNYANS--IFVGNLTYDCTPEDLRDYFSGIGEV--VRADIITSKGHHRG 145

Query: 376 FAYVMFKNPGDAANAYVELDKQIFQGRLLHI 406
              V F N  D   A  + D   F  R + +
Sbjct: 146 MGTVEFTNSRDVEEAIRQYDSSYFMDRQIFV 176

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 87/233 (37%), Gaps = 40/233 (17%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTR---E 706
           SIFV NL +  T ++L + F   G  V A + T       +K    G G  EF      E
Sbjct: 106 SIFVGNLTYDCTPEDLRDYFSGIGEVVRADIIT-------SKGHHRGMGTVEFTNSRDVE 158

Query: 707 QALAVIDA---MDGAVL--------DGHRIQLKLSHRXXXXXXXXXXXXXXXXX------ 749
           +A+   D+   MD  +         D  R +   S R                       
Sbjct: 159 EAIRQYDSSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQSNMK 218

Query: 750 ----IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS--ARGFAFVEFLLPKEAEN 803
               I V NLP+ +  + + ++F   G +  +R   + D++  +RGF  V F    + E 
Sbjct: 219 QGYEIFVANLPYSINWQALKDMFKECGDV--MRADVELDRAGRSRGFGTVIFRTRDDMER 276

Query: 804 AMEQLQGVHLLGRRLVMQHAEEEPQDAEEQIAR-----MTKKVRSQVTTREHA 851
           A+++     + GR L ++      ++ +  I       MT    S  T+ E +
Sbjct: 277 AIDRYNRFEVDGRTLDVREGHSNNRNDDMNIQHQTQNAMTNDATSDATSNERS 329

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 3/89 (3%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+ N+ Y+      + +F   G++    V LD R G+S+GF  V+F+   D   A    
Sbjct: 223 IFVANLPYSINWQALKDMFKECGDVMRADVELD-RAGRSRGFGTVIFRTRDDMERAIDRY 281

Query: 395 DKQIFQGRLLHILPGEQKKSHRLDEFDLK 423
           ++    GR L +  G    ++R D+ +++
Sbjct: 282 NRFEVDGRTLDVREGH--SNNRNDDMNIQ 308

>CAGL0M03795g complement(428607..430148) highly similar to sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 513

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 64/162 (39%), Gaps = 26/162 (16%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +F+  LN+ TT   L E F  +G  V  ++K   DP   N   S GFGF  F        
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVV--ELKIMKDP---NTGRSRGFGFLSFDAPSSVDE 186

Query: 711 VIDA---MDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFEL 767
           V+     +DG V+D  R   +                     I V  L  +V  K+  E 
Sbjct: 187 VVKTQHILDGKVIDPKRAIPR-------------EEQDKTGKIFVGGLGTDVRPKEFEEY 233

Query: 768 FSSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAME 806
           FS +G +   +L    DK    +RGF FV +  P  AE   E
Sbjct: 234 FSQWGTIIDAQL--MLDKDTGRSRGFGFVTYDSPDAAEKVCE 273

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAY 391
           TG++F+  +       +F + F+ +G + +  + LD  TG+S+GF +V + +P DAA   
Sbjct: 213 TGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQLMLDKDTGRSRGFGFVTYDSP-DAAEKV 271

Query: 392 VELDKQIFQGRLLHI 406
            E   + F+G+ + I
Sbjct: 272 CESRYREFKGKQIEI 286

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 47/87 (54%), Gaps = 5/87 (5%)

Query: 303 STEDPESTEQQESKLDTTEEEKFIQKIEA-----TGRLFLRNILYTATEDDFRKLFAPFG 357
           S+E   S + Q S+   + EE   ++++A       ++F+  + +  TED  R+ F+ +G
Sbjct: 95  SSEPQVSNQTQNSEQRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDGLREYFSKYG 154

Query: 358 ELEEVHVALDTRTGKSKGFAYVMFKNP 384
            + E+ +  D  TG+S+GF ++ F  P
Sbjct: 155 NVVELKIMKDPNTGRSRGFGFLSFDAP 181

>Kwal_27.10364
          Length = 443

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 70/341 (20%), Positives = 136/341 (39%), Gaps = 69/341 (20%)

Query: 511 FKSPSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARA 570
            K  + R+++ ++V+N P G    ++  LF   G ++            +  +  T+  +
Sbjct: 32  LKPKTYREESTVVVRNLPKGYNFFKVRKLFKDCGNIKH-----------IDVKQVTNEDS 80

Query: 571 AFSKLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTA 630
             +++ ++ F D +  L K  K        GD+ +   IV QS N               
Sbjct: 81  KVARIEFEDFNDVLSALTKSHKRL------GDQEI---IVEQSQN--------------- 116

Query: 631 TASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSN 690
                              +++V N        EL + F  FGG V++ ++      +S+
Sbjct: 117 ------------------STLWVTNYPPLFGELELQKLFSQFGGTVLS-IRFPSLRYDSH 157

Query: 691 KTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXI 750
           +     F + +  + E+A  ++D + G V+D H + +KLS+                  +
Sbjct: 158 RR----FAYVDMASSEEAKLIVDRLHGFVVDNHELIIKLSN-PLKAEKRTDSDVLERRQV 212

Query: 751 IVKNLP-FEVERKQIFELFSSFGQLKSVRLPKKFDKSAR--------GFAFVEFLLPKEA 801
            +KNL  F V  + I + FS +G ++ + LP K +            GF FV F     A
Sbjct: 213 YLKNLDYFRVSEEIISKSFSKYGHIERISLPHKEEPGLSGAEKRLNDGFGFVTFSESTSA 272

Query: 802 ENAMEQLQGVHLLGRRLVMQHAEEEPQDAEEQIARMTKKVR 842
            +++ QL G  L GR++ +  A+ +     + + R+  + R
Sbjct: 273 ASSL-QLDGSELEGRKISVTLADRKAYIERQAVKRLLHRKR 312

>YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein
           that may be involved in coping with heat stresses,
           contains one RNA recognition (RRM) domain [663 bp, 220
           aa]
          Length = 220

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 330 EATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAAN 389
           E +G +++  + +   E +  K FA FG+L+EV +A + +TG S+ + ++ F N  DA  
Sbjct: 88  EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMI 147

Query: 390 AYVELDKQIFQGRLLH--ILP 408
           A   ++  +  G LL   +LP
Sbjct: 148 AQESMNNYLLMGHLLQVRVLP 168

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V  LP     K++ + F+ FG LK VRL + K   ++R + F+EF+  ++A  A E +
Sbjct: 93  IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESM 152

Query: 809 QGVHLLGRRL 818
               L+G  L
Sbjct: 153 NNYLLMGHLL 162

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           I+V  L      KEL++ F  FG   + +V+   + K  N   S  +GF EF  +E A+ 
Sbjct: 93  IYVSRLPHGFHEKELSKYFAQFGD--LKEVRLARNKKTGN---SRHYGFLEFVNKEDAMI 147

Query: 711 VIDAMDGAVLDGHRIQLKL 729
             ++M+  +L GH +Q+++
Sbjct: 148 AQESMNNYLLMGHLLQVRV 166

>KLLA0A08338g 736461..738761 weakly similar to sp|P39684
           Saccharomyces cerevisiae YFR023w PES4 DNA-directed DNA
           polymerase epsilon suppressor, start by similarity
          Length = 766

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 328 KIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDA 387
           K E    LF+ ++    TED    +F  F     V + +D+ T KS G+ Y+ F +P DA
Sbjct: 133 KSEKQTALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDA 192

Query: 388 ANAYVELDKQIFQGRLLHILPGEQKKSHRLD---EFDLKNLPL 427
            NA  E +     GR + ++P  +    R +        NLPL
Sbjct: 193 ENAVDEYNYMPIFGREIRMMPSLRNTYFRKNIGTNVFFSNLPL 235

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLP--KKFDKSARGFAFVEFLLPKEAENAMEQ 807
           I VKNLP       +   FS  G +KSV      KFD S   +AF+ +   ++ + A+E+
Sbjct: 388 IFVKNLPINPSHDNLLNFFSKIGPVKSVYTSDVSKFDSS---WAFITYKRIQDTKTAIEK 444

Query: 808 LQGVHLLGRRLVMQHAE 824
           L G   + R + ++  E
Sbjct: 445 LNGCKYMKRTIEVKKTE 461

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFD-KSARGFAFVEFLLPKEAENAMEQL 808
           + + +LP  V    +  +F+ F    SV++    + K + G+ ++ F  PK+AENA+++ 
Sbjct: 140 LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEY 199

Query: 809 QGVHLLGRRLVM 820
             + + GR + M
Sbjct: 200 NYMPIFGREIRM 211

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 66/164 (40%), Gaps = 19/164 (11%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++F+ +L  + T   L   F  F  F   ++       +SN   S+G+G+  F   + A 
Sbjct: 139 ALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICV-----DSNTKKSLGYGYLNFGDPKDAE 193

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFE---VERKQIFE 766
             +D  +   + G  I++  S R                 +   NLP +   +  +  ++
Sbjct: 194 NAVDEYNYMPIFGREIRMMPSLR------NTYFRKNIGTNVFFSNLPLDNTKLTTRVFYD 247

Query: 767 LFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQG 810
            F  FG++ S +L ++     +   F+ F     A+ A++Q  G
Sbjct: 248 EFKKFGKILSCKLDRR-----KNIGFIYFENDAAAKEAIKQYNG 286

>Kwal_27.11832
          Length = 686

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 77/191 (40%), Gaps = 23/191 (12%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV+++ F  T +EL   F        A V  K D KNS      GFGF  F   +   
Sbjct: 22  TLFVRSIPFDATDEELANYFSNLAPIKHA-VIVKDDQKNSR-----GFGFVSFAVEDDTK 75

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXX----------------IIVK 753
             +D        G  +++ ++ R                                 +IV+
Sbjct: 76  DALDKARKTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVR 135

Query: 754 NLPFEVER-KQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVH 812
           N+P+ V    ++ ++F  +G +   ++PK+ D    GFAFV        + A+E+ + + 
Sbjct: 136 NMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLK 195

Query: 813 LLGRRLVMQHA 823
           + GR++ +  A
Sbjct: 196 IGGRQVAVDFA 206

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 15/90 (16%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKN----------- 383
           +F+RN+ Y AT++   + F  FG ++      D  TG +KG A+V+F+            
Sbjct: 293 VFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQEAFDECVNNA 352

Query: 384 PGDAANAYVELD----KQIFQGRLLHILPG 409
           P     + +  D    + ++ GR+L I P 
Sbjct: 353 PASGTTSLLISDDVPYRYVYDGRILSIAPA 382

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 47/86 (54%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V+++PF+   +++   FS+   +K   + K   K++RGF FV F +  + ++A+++ +
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDKAR 82

Query: 810 GVHLLGRRLVMQHAEEEPQDAEEQIA 835
                GR L +  A+   +  ++Q A
Sbjct: 83  KTKFKGRLLRVDIAKRRDRTKKDQNA 108

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+R+I + AT+++    F+    ++   +  D +   S+GF +V F    D  +A  + 
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKN-SRGFGFVSFAVEDDTKDALDKA 81

Query: 395 DKQIFQGRLLHI 406
            K  F+GRLL +
Sbjct: 82  RKTKFKGRLLRV 93

>KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 391

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+ N+ +  TED  RK F   GE+  + +A    TGK KGFA++ FK+   A NA  + 
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNALKDK 288

Query: 395 DKQIFQGRLLHILPGEQKKSHRL 417
             +    R + +  GE +   ++
Sbjct: 289 SCRKIASRPIRMEYGEDRSKRQV 311

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 81/197 (41%), Gaps = 30/197 (15%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTK----------------PDPKNSNKTL- 693
           ++V N+ F T  +++         F+VA+ K                  P  KN NK L 
Sbjct: 117 VWVGNMAFDTVKEDIIR-------FIVAKTKENDEGGAITEKDIVRINMPLTKNDNKKLR 169

Query: 694 SMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLK----LSHRXXXXXXXXXXXXXXXXX 749
           + GF + +FKT +Q  AV+  +  + L+G  + +K       R                 
Sbjct: 170 NKGFAYIDFKTEKQMEAVV-GLSESALNGRNLLIKNAGSYEGRPDKNDLVAASKNPPSRI 228

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQL 808
           + V NL F+     + + F   G++  +R+    D    +GFAF++F     A NA++  
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNALKDK 288

Query: 809 QGVHLLGRRLVMQHAEE 825
               +  R + M++ E+
Sbjct: 289 SCRKIASRPIRMEYGED 305

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 86/202 (42%), Gaps = 39/202 (19%)

Query: 238 QMVKLDD-----FEDKTKENMAQDEKVSDFN-----------WLKQHRIRIKENTEGTEN 281
           ++ K+DD      +D TK+  A+DE   D N            L++ ++ I+E      N
Sbjct: 7   EVKKVDDAVSQVLKDPTKKRKAEDEIEIDLNQSVPLSKKQKRLLRRGKVTIEE-LNAKYN 65

Query: 282 TDPEGVTARPKSDIREEDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATGR--LFLRN 339
            D + +    K    ++DN    ED  + ++  S+    EEEK   K     +  +++ N
Sbjct: 66  IDSKSIEEYKKETAEKQDN----EDTSNKKEGSSEETNVEEEKITSKPNKEKKFGVWVGN 121

Query: 340 ILY-TATEDDFRKLFAPFGELEE-----------VHVAL---DTRTGKSKGFAYVMFKNP 384
           + + T  ED  R + A   E +E           +++ L   D +  ++KGFAY+ FK  
Sbjct: 122 MAFDTVKEDIIRFIVAKTKENDEGGAITEKDIVRINMPLTKNDNKKLRNKGFAYIDFKTE 181

Query: 385 GDAANAYVELDKQIFQGRLLHI 406
                A V L +    GR L I
Sbjct: 182 -KQMEAVVGLSESALNGRNLLI 202

>Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement
          Length = 221

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 7/103 (6%)

Query: 346 EDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLH 405
           E +  K F+ FG+L++V +A + +TG S+ +A++ F N  DA  A   ++  +  G LL 
Sbjct: 105 ERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDDALVAQDTMNNYLILGHLLK 164

Query: 406 --ILPGEQKKSHRLDEFD---LKNLPLKKQ-RSLKRKANASHD 442
             +LP + KK  +L ++     +  P+KK    LK +A A HD
Sbjct: 165 VVVLP-KGKKIEKLFKYKKRVYQETPVKKDVEELKERARAKHD 206

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V  LP     +++ + FS FG LK VRL + K   ++R +AF+EF+   +A  A + +
Sbjct: 94  IYVSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDDALVAQDTM 153

Query: 809 QGVHLLGRRL 818
               +LG  L
Sbjct: 154 NNYLILGHLL 163

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           I+V  L      +EL++ F  FG   + QV+   + K  N   S  + F EF  ++ AL 
Sbjct: 94  IYVSRLPQGFHERELSKYFSQFGD--LKQVRLARNKKTGN---SRHYAFIEFVNKDDALV 148

Query: 711 VIDAMDGAVLDGHRIQL 727
             D M+  ++ GH +++
Sbjct: 149 AQDTMNNYLILGHLLKV 165

>CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces
           cerevisiae YFR023w PES4 DNA-directed DNA polymerase
           epsilon suppressor, hypothetical start
          Length = 602

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 73/169 (43%), Gaps = 19/169 (11%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV NL    T + LTE FK +  F+ A+V T     N++   S+G G+  F  +E A 
Sbjct: 65  ALFVGNLAEEITSERLTEMFKVYKSFISAKVCT-----NADDNRSLGHGYINFGNKEDAE 119

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVER---KQIFE 766
              +  +   + G  I++  S R                 I   NLP + E+   +  ++
Sbjct: 120 RATEDFNYNKIMGKEIRIMPSIR------DSVYRKNFGTNIFFSNLPLQKEKLTHRMFYD 173

Query: 767 LFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLG 815
           +F  +G + SV+L      S++   FV F     A + +++      LG
Sbjct: 174 IFRKYGNVLSVKL-----DSSKNIGFVYFEDDTIARDVIKEFNNKEFLG 217

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I +KNLP +    +I  +FS  G +KSV L    +     +AFV +      E A+    
Sbjct: 278 IFIKNLPLDTNNNEILAIFSEVGPIKSVFLSPLNESREYLWAFVTYKDKASVEKAISLFN 337

Query: 810 GVHLLGRRLVMQHA 823
           G  +  R + + HA
Sbjct: 338 GKAIGNRNVFVTHA 351

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 48/230 (20%), Positives = 82/230 (35%), Gaps = 43/230 (18%)

Query: 514 PSDRDD-------TVLLVKNFPF---GTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYR 563
           PS RD        T +   N P      TH    D+F  +G +  + L  ++ I  V + 
Sbjct: 139 PSIRDSVYRKNFGTNIFFSNLPLQKEKLTHRMFYDIFRKYGNVLSVKLDSSKNIGFVYFE 198

Query: 564 DATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPEGDETMV---DEIVAQ------ST 614
           D T AR    + + K F   I+           ++P  D+ +    D+I+ +       +
Sbjct: 199 DDTIARDVIKEFNNKEFLGNIISCGLHFDKELRKKPNFDKQISKLDDDIIIEKEKEIFDS 258

Query: 615 NVKEARTTGDEIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGG 674
           N  E +   D++       +P               IF+KNL   T   E+   F   G 
Sbjct: 259 NKVEIKIDKDKV----AIIQPN-------------GIFIKNLPLDTNNNEILAIFSEVGP 301

Query: 675 FVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHR 724
             +  V   P     N++    + F  +K +      I   +G  + G+R
Sbjct: 302 --IKSVFLSP----LNESREYLWAFVTYKDKASVEKAISLFNGKAI-GNR 344

>YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleolar
           protein with similarity to Nsr1p, has two RNA
           recognition (RRM) domains [1212 bp, 403 aa]
          Length = 403

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 83/200 (41%), Gaps = 34/200 (17%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPD-------------------PKNSNK 691
           +++ NL+F TT  +L         F +A+ K   D                    KNSN 
Sbjct: 127 VWIGNLSFDTTKDDLVR-------FFIAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNA 179

Query: 692 TLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLK----LSHRXXXXXXXXXXXXXXX 747
             + GF +  FK  EQ  AV++ +  + L+G  + +K     S R               
Sbjct: 180 MKNKGFCYMFFKNVEQMKAVLE-LSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPS 238

Query: 748 XXIIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS--ARGFAFVEFLLPKEAENAM 805
             + V NL F+V    + + F   G +  +R+   F+ S   +GFAF++F   + + N +
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMAT-FEDSGKCKGFAFIDFKNEEGSTNEL 297

Query: 806 EQLQGVHLLGRRLVMQHAEE 825
           +      + GR L M++ E+
Sbjct: 298 KDKSCRKIAGRPLRMEYGED 317

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+ N+ +  T+D  RK F   G++ ++ +A    +GK KGFA++ FKN   + N   + 
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKDK 300

Query: 395 DKQIFQGRLLHILPGEQKKSHRL 417
             +   GR L +  GE +   ++
Sbjct: 301 SCRKIAGRPLRMEYGEDRSKRQV 323

>Kwal_33.15208
          Length = 186

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 2/79 (2%)

Query: 331 ATGRLFLRNILYTATEDDFRKLFA-PFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAAN 389
           +T  +F+ NI  + T ++ + LF      +  V + ++   G +KGFAYV F  P D   
Sbjct: 51  STRSVFVGNISQSITAEELQLLFKDVVSCVNRVEIQVNRVNGLTKGFAYVEFAQPKDVT- 109

Query: 390 AYVELDKQIFQGRLLHILP 408
           A VELD   F GR L ++P
Sbjct: 110 AAVELDNVDFHGRRLRVVP 128

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 788 RGFAFVEFLLPKEAENAMEQLQGVHLLGRRL 818
           +GFA+VEF  PK+   A+E L  V   GRRL
Sbjct: 95  KGFAYVEFAQPKDVTAAVE-LDNVDFHGRRL 124

>Sklu_2353.5 YIL061C, Contig c2353 10817-11575
          Length = 252

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 58/101 (57%), Gaps = 1/101 (0%)

Query: 295 IREEDNVESTEDPESTEQQESKLDT-TEEEKFIQKIEATGRLFLRNILYTATEDDFRKLF 353
           +++ + +ES ++ E  +  E  L+   E ++ I+  +    +F+  + Y  TE + +K F
Sbjct: 18  LKKYEELESAKNEEMGKLHEKTLEWDPENDEHIKGTDPFRTVFIGRLPYEVTEVELQKHF 77

Query: 354 APFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           + FGE+E+V V  D  T KS+G+A+++F++   +  A  E+
Sbjct: 78  SRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAACKEI 118

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 46/77 (59%), Gaps = 8/77 (10%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAME 806
           + +  LP+EV   ++ + FS FG+++ VR+ +  DKS   +RG+AF+ F     +  A +
Sbjct: 59  VFIGRLPYEVTEVELQKHFSRFGEIEKVRVVR--DKSTSKSRGYAFIVFRDETGSRAACK 116

Query: 807 QL---QGVHLLGRRLVM 820
           ++   +G+ + GR +++
Sbjct: 117 EIGVHRGLDIQGRSVIV 133

>AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W
           (MIP6) - SH] (605004..607040) [2037 bp, 678 aa]
          Length = 678

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 73/174 (41%), Gaps = 19/174 (10%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++F+ +L+   T K L + F  F  FV A++       +SN   S+G+G+  F   E A 
Sbjct: 117 ALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICI-----DSNTKKSLGYGYLNFSNEEDAE 171

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFE---VERKQIFE 766
            VI+  +   + G  +++  S R                 +   NLP E   +  +  ++
Sbjct: 172 RVIEEFNYIPIFGREVRIMPSLR------NSFYRKNIGTNVFFSNLPLENLALTTRVFYD 225

Query: 767 LFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVM 820
            F  FG++ S +L ++     +   FV F     A+ A+ +  G    G  ++ 
Sbjct: 226 AFKKFGKILSCKLDRR-----KNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILC 274

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 3/96 (3%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+ ++    TE + R  F  F       + +D+ T KS G+ Y+ F N  DA     E 
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 395 DKQIFQGRLLHILPGEQKKSHRLD---EFDLKNLPL 427
           +     GR + I+P  +   +R +        NLPL
Sbjct: 178 NYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPL 213

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + +KNLP   +   + + FS  G +KS+       K +  +AF+ F    +A++A++ L 
Sbjct: 327 VFIKNLPLNPDSDLLLDYFSQIGPVKSI-FTSNVSKLSSAWAFITFQKGSDAQDAIDNLN 385

Query: 810 GVHLLGRRLVMQHAEEEPQ 828
              LLGR + +  A++  Q
Sbjct: 386 HSQLLGRPIELSRAQKNFQ 404

>YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1
           snRNA-associated protein with RNA recognition (RRM)
           domain, homologous to human 70 kDa U1 snRNP protein [903
           bp, 300 aa]
          Length = 300

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 38/60 (63%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+  + Y   E + +K F  FGE+E++ +  D  T KSKG+A+++FK+P  +  A+ E+
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI 168

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 41/64 (64%), Gaps = 2/64 (3%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           I +  LP++++  ++ + F  FG+++ +R+ K K  + ++G+AF+ F  P  ++ A +++
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI 168

Query: 809 QGVH 812
            GVH
Sbjct: 169 -GVH 171

>ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH]
           complement(569855..569857,569915..570874) [963 bp, 320
           aa]
          Length = 320

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%)

Query: 321 EEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVM 380
           E +  IQ  +    +F+  + Y   E + +K F  FGE+E V +  D  T K +G+A+V+
Sbjct: 95  ENDTNIQGTDPFRTIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVL 154

Query: 381 FKNPGDAANAYVEL 394
           F++P  +  AY E+
Sbjct: 155 FRDPECSKKAYREI 168

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V  L ++V+  ++ + F  FG+++ VR+ + K     RG+AFV F  P+ ++ A  ++
Sbjct: 109 IFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYREI 168

Query: 809 QGVH 812
            GVH
Sbjct: 169 -GVH 171

>Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement
          Length = 396

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 96/235 (40%), Gaps = 44/235 (18%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVK----------------TKPDPKNSNKTL- 693
           ++V NL+F T+ ++L         F+VA+ K                  P  +N  K + 
Sbjct: 119 VWVGNLSFDTSKEDLIR-------FIVAKTKDLEGESKVEEDSIIRVNLPLAQNDGKKIR 171

Query: 694 SMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSH----RXXXXXXXXXXXXXXXXX 749
           + GF + +FK +EQ  AVI  +  + L+G  + +K S     R                 
Sbjct: 172 NKGFAYMDFKNKEQMNAVI-GLSESQLNGRNMLIKNSSSYEGRPDKNDLIAMSKNPPSRI 230

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQL 808
           + V NL F+   + + + F   G++  VR+    D    +GFAF++F   K    A+   
Sbjct: 231 LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDK 290

Query: 809 QGVHLLGRRLVMQHAEEEPQDAEEQIARMTKKVRSQVTTREHAALRNGGRRKVDL 863
               + GR L M+  E+              + + QV  RE+++  +  R+  D+
Sbjct: 291 SCRKIAGRPLRMEFGED--------------RSKRQVKRRENSSQYDNNRKPFDI 331

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 50/107 (46%), Gaps = 16/107 (14%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+ N+ +  T++  RK F   GE+ +V +A    +GK KGFA++ FK+      A  + 
Sbjct: 231 LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDK 290

Query: 395 DKQIFQGRLLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASH 441
             +   GR L +  GE                 + +R +KR+ N+S 
Sbjct: 291 SCRKIAGRPLRMEFGED----------------RSKRQVKRRENSSQ 321

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 88/195 (45%), Gaps = 41/195 (21%)

Query: 238 QMVKLDDFEDKTKENMAQDEKVSDFNWL-----KQHRI--RIKENTEGTE---NTDPEGV 287
           Q+ K+    D TK+  A+DE   D N       KQ R+  R K+N E      N DP  +
Sbjct: 25  QIAKV--LSDATKKRKAEDEIEIDLNQSVPLSKKQKRLLRRGKKNIEELNKKFNIDPSSI 82

Query: 288 TARPKSDIREEDNVESTED-PESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILY-TAT 345
               K    E D   +TE+  E++E  +SK    +E+KF         +++ N+ + T+ 
Sbjct: 83  EEYKK----ESDGKATTEEVAETSENDDSKSKVKKEKKF--------GVWVGNLSFDTSK 130

Query: 346 EDDFRKLFAPFGELE-----------EVHVALDTRTGK---SKGFAYVMFKNPGDAANAY 391
           ED  R + A   +LE            V++ L    GK   +KGFAY+ FKN  +  NA 
Sbjct: 131 EDLIRFIVAKTKDLEGESKVEEDSIIRVNLPLAQNDGKKIRNKGFAYMDFKN-KEQMNAV 189

Query: 392 VELDKQIFQGRLLHI 406
           + L +    GR + I
Sbjct: 190 IGLSESQLNGRNMLI 204

>Scas_696.32
          Length = 445

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/338 (19%), Positives = 137/338 (40%), Gaps = 65/338 (19%)

Query: 505 LTKFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRD 564
           L K +  K   +R+ T +LVKN P  T  + L   F   G        P + + +V   D
Sbjct: 20  LVKKQDSKPTRNRELTTVLVKNLPKSTNQNRLRKFFQDCG--------PLKHVDIVDTLD 71

Query: 565 ATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGD 624
            +S  A   +L ++ F D    L K  K   + E E         V+   N         
Sbjct: 72  KSSRVA---RLEFENFLDASSALTKTFKKLGNNEIE---------VSWLKNC-------- 111

Query: 625 EIMQTATASKPEXXXXXXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKP 684
                                    ++++ N   + T +EL   F  +    ++ V+   
Sbjct: 112 -------------------------TVWLTNFPPTFTSRELKSLFTEYDCLPIS-VRLPS 145

Query: 685 DPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXX 744
              N+N+     F + +  T  +A  +++ ++   +D +++  K+S              
Sbjct: 146 LRFNANRR----FAYVDVCTSNEATNMVNNLNNKEIDNYKLVAKMSD-PSQRSKRSDAAA 200

Query: 745 XXXXXIIVKNL-PFEVERKQIFELFSSFGQLKSVRLPKKFDKSA----RGFAFVEFLLPK 799
                +I++NL P  ++  ++  +F + G+++S+ +PKK ++++     G AF+ FL   
Sbjct: 201 IERRELIIRNLDPSSIDEGELRNMFGTLGEIESINIPKKQEENSNQYTNGVAFITFLNSD 260

Query: 800 EAENAMEQLQGVHLLGRRLVMQHAEEEPQDAEEQIARM 837
           +A +A+ +L    +  R + +  A+++P    +++ R+
Sbjct: 261 DAHSAL-KLNNSKINDRIITVSLADQKPYLERQEVKRI 297

>KLLA0A05346g 485886..488510 some similarities with sp|P53316
           Saccharomyces cerevisiae YGR250c singleton, hypothetical
           start
          Length = 874

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%)

Query: 333 GRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYV 392
           G L++R I    T++D   +FA FG +  + + LD+ T +S GF +V +     A+N   
Sbjct: 191 GNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFVSYALGSQASNCIK 250

Query: 393 ELDKQIFQGRLLHI 406
           EL+  +  G  L +
Sbjct: 251 ELNGNLMNGSPLFV 264

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +++V+ +  + T ++L   F  FG  +V ++       +SN   SMGFGF  +    QA 
Sbjct: 192 NLYVRGIPKNLTKEDLVPIFAKFGPILVLKIIL-----DSNTNESMGFGFVSYALGSQAS 246

Query: 710 AVIDAMDGAVLDG 722
             I  ++G +++G
Sbjct: 247 NCIKELNGNLMNG 259

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 330 EATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVAL---------------DTRTGKSK 374
           E    L+++++     ++D  + F  FGE+    +                 D   GKSK
Sbjct: 727 EQESNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSK 786

Query: 375 GFAYVMFKNPGDAANAYVELD 395
           G+ +V F+NP DA+ A    D
Sbjct: 787 GYGFVCFQNPLDASRAMYHTD 807

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 18/81 (22%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRL-----------------PKKFDKSARGFAF 792
           + VK+LP +   + +++ F  FG++ S ++                  + F KS +G+ F
Sbjct: 732 LYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKS-KGYGF 790

Query: 793 VEFLLPKEAENAMEQLQGVHL 813
           V F  P +A  AM    G+ L
Sbjct: 791 VCFQNPLDASRAMYHTDGLKL 811

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 696 GFGFAEFKTREQALAVIDAMDGAVLDGHRI 725
           G+GF  F T E AL  I+  + +   GH++
Sbjct: 446 GYGFFRFATHEMALKCIETFNDSQWYGHQL 475

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+ N+ +   E++  K F+P GE+E + +  D++T   KGFAYV FK+      A +  
Sbjct: 309 VFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKALLLN 368

Query: 395 DKQI-FQGRLLHI 406
           +K+I   GR L +
Sbjct: 369 EKKINGNGRKLRV 381

>Kwal_23.5864
          Length = 278

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 32/48 (66%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFK 382
           +F+  + YT TE + +K F  FGE+E+V V  D  + KS+G+ ++MFK
Sbjct: 103 VFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFK 150

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEF---LLPKEAENAM 805
           + V  LP+ V   ++ + F  FG+++ VR+ + K    +RG+ F+ F   L  + A   +
Sbjct: 103 VFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACREI 162

Query: 806 EQLQGVHLLGRRLVM 820
              +GV + GR +++
Sbjct: 163 GVHRGVEIGGRPVIV 177

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFK 703
           ++FV  L ++ T  EL ++F  FG   + +V+   D K SNK  S G+GF  FK
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGE--IEKVRVVRD-KTSNK--SRGYGFIMFK 150

>CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces
           cerevisiae YBL051c, hypothetical start
          Length = 639

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSA-RGFAFVEFLLPKEAENAMEQL 808
           I++KN+PF ++++Q+ ++    G          FD    RG AF  F  P++    +  L
Sbjct: 58  IVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDL 117

Query: 809 QGVHLLGRRLVMQHAEEEPQ 828
            G  + GR+L +++ +  PQ
Sbjct: 118 NGKEINGRKLKVEYKKMLPQ 137

>Scas_637.2
          Length = 377

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 323 EKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFK 382
           E  ++K    G +F+ N+ + ATE+D R  F+  GE+  V+  + +  G+SKG   V F 
Sbjct: 69  ESGVEKHHENG-IFIGNLSFDATEEDLRDFFSQVGEV--VNAEVMSYRGRSKGMGTVEFT 125

Query: 383 NPGDAANAYVELDKQIFQGRLLHI 406
           NP DA  A  + +   F GR + +
Sbjct: 126 NPADAEEAIRQYNGVPFMGRDIFV 149

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 72/206 (34%), Gaps = 40/206 (19%)

Query: 652 FVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAV 711
           FV NL +S T + L + F+  G  + A V+            S GFG   +   E     
Sbjct: 175 FVVNLPYSITWQNLKDIFRECGDVIRADVEL------DYNGYSRGFGSVIYANEEDMFKA 228

Query: 712 IDAMDGAVLDGHRIQL---KLSH-------------------------------RXXXXX 737
           ID+ +GA L+G  +++   K +H                                     
Sbjct: 229 IDSFNGAELEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFT 288

Query: 738 XXXXXXXXXXXXIIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLL 797
                       +   NLP       +++LF S G++    L      ++ G A VE+  
Sbjct: 289 EGVSGDGERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYAS 348

Query: 798 PKEAENAMEQLQGVHLLGRRLVMQHA 823
              A+  + +L G +  GR L + +A
Sbjct: 349 QDAADVCINKLNGYNYGGRDLHITYA 374

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I + NL F+   + + + FS  G++ +  +   +   ++G   VEF  P +AE A+ Q  
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEV-MSYRGRSKGMGTVEFTNPADAEEAIRQYN 138

Query: 810 GVHLLGRRLVMQHAEEEPQDAEE 832
           GV  +GR + ++  +  P   +E
Sbjct: 139 GVPFMGRDIFVKQDQPPPGSRQE 161

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 65/171 (38%), Gaps = 9/171 (5%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
            IF+ NL+F  T ++L + F   G  V A+V        S +  S G G  EF     A 
Sbjct: 79  GIFIGNLSFDATEEDLRDFFSQVGEVVNAEVM-------SYRGRSKGMGTVEFTNPADAE 131

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXX--XXXXXXXXXXIIVKNLPFEVERKQIFEL 767
             I   +G    G  I +K                         V NLP+ +  + + ++
Sbjct: 132 EAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDI 191

Query: 768 FSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRL 818
           F   G +    +   ++  +RGF  V +   ++   A++   G  L GR L
Sbjct: 192 FRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRIL 242

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 336 FLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELD 395
           F+ N+ Y+ T  + + +F   G++    V LD   G S+GF  V++ N  D   A    +
Sbjct: 175 FVVNLPYSITWQNLKDIFRECGDVIRADVELDY-NGYSRGFGSVIYANEEDMFKAIDSFN 233

Query: 396 KQIFQGRLLHILPG 409
               +GR+L +  G
Sbjct: 234 GAELEGRILEVREG 247

>KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1 CF Ib (RNA3
           Cleavage factor Ib), hypothetical start
          Length = 570

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 79/180 (43%), Gaps = 27/180 (15%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +F+  LN+ TT + L + F  +G   VA+VK     K++    S GFGF  F+       
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYG--AVAEVKIM---KDTATGRSRGFGFLTFENASSVDE 242

Query: 711 VIDA---MDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFEL 767
           V+     +DG V+D  R   +                     I V  +  +V  K+  E 
Sbjct: 243 VVKTQHILDGKVIDPKRAIPR-------------EEQDKTGKIFVGGIGPDVRPKEFEEF 289

Query: 768 FSSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAE 824
           FS +G +   +L    DK    +RGF F+ +  P +A + + Q + +   G+++ ++ AE
Sbjct: 290 FSQWGSIIDAQL--MLDKDTGRSRGFGFITYDTP-DAVDRVCQNKFIEFKGKQIEIKRAE 346

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 32/50 (64%)

Query: 334 RLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKN 383
           ++F+  + +  TE+  R  F+ +G + EV +  DT TG+S+GF ++ F+N
Sbjct: 187 KMFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFEN 236

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAY 391
           TG++F+  I       +F + F+ +G + +  + LD  TG+S+GF ++ +  P DA +  
Sbjct: 269 TGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDTP-DAVDRV 327

Query: 392 VELDKQIFQGRLLHI 406
            +     F+G+ + I
Sbjct: 328 CQNKFIEFKGKQIEI 342

>CAGL0H03861g complement(361189..362520) similar to sp|P38922
           Saccharomyces cerevisiae YNL004w HRB1, start by
           similarity
          Length = 443

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 98/248 (39%), Gaps = 52/248 (20%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           L + N+ Y+ +    + +F  FG++ + +V +D+ TG S G   V+FKN  D   AY   
Sbjct: 219 LMILNLPYSISWQTLKTMFKEFGDVLKANVEVDS-TGMSIGVGNVIFKNQEDMVKAYEHF 277

Query: 395 DKQIFQGRLLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQD 454
           +    +G++L +                  +P   Q S  RK          + L +NQD
Sbjct: 278 NGFEIEGKVLEV---------------RGQIPDPTQISSTRKT---------DDLTVNQD 313

Query: 455 AVLGSVAAKLGVQKSDL-IDATDASAAVKQAL-AEAHVIGDVRKYFESKGMDLTKFEQFK 512
                          D+ +D   A    ++AL A+    G  R   +    D  K E  K
Sbjct: 314 -------------NEDIEMDIDTAEGGDEKALKADVSSDGGARAQNKFSSDDYVKTED-K 359

Query: 513 SPSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLL----PPAQTI-AVVQYRDATS 567
           S       ++L  N P  TT  +L DLF   GK++           +T+ A+V Y +   
Sbjct: 360 S------KIILCDNLPGATTEGDLYDLFETLGKVKTAGFINTDNAGETVSAIVIYNEQDD 413

Query: 568 ARAAFSKL 575
           A   + +L
Sbjct: 414 AEVCYGRL 421

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/196 (19%), Positives = 70/196 (35%), Gaps = 25/196 (12%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           SIFV NL +  T ++L + F   G  V A + T       ++    G G  EF + E+  
Sbjct: 108 SIFVGNLTYDCTPEDLKDFFSQVGKVVRADIIT-------SRGHHRGMGTVEFTSGEEVD 160

Query: 710 AVIDAMDGAVLDGHRIQLKLSH------------------RXXXXXXXXXXXXXXXXXII 751
             I   DGA L   +I ++  +                                    ++
Sbjct: 161 EAIRKFDGAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGYELM 220

Query: 752 VKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGV 811
           + NLP+ +  + +  +F  FG +    +       + G   V F   ++   A E   G 
Sbjct: 221 ILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEHFNGF 280

Query: 812 HLLGRRLVMQHAEEEP 827
            + G+ L ++    +P
Sbjct: 281 EIEGKVLEVRGQIPDP 296

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I V NL ++   + + + FS  G++    +        RG   VEF   +E + A+ +  
Sbjct: 109 IFVGNLTYDCTPEDLKDFFSQVGKVVRADIITSRGHH-RGMGTVEFTSGEEVDEAIRKFD 167

Query: 810 GVHLLGRRLVMQHAEEEPQ 828
           G +L+ R++ ++     P+
Sbjct: 168 GAYLMNRQIFVRQDNPPPE 186

>Scas_376.1
          Length = 404

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 83/189 (43%), Gaps = 15/189 (7%)

Query: 651 IFVKNLNFSTTGKELTEKF--KTFGGFV-------VAQVKTKPDPKNSNKTLSMGFGFAE 701
           +++ NL F TT +EL + F  KT    V       + +V       +  K  + GF + +
Sbjct: 129 VWIGNLTFDTTKEELIKLFTAKTRENEVGKVTEEDIVRVHMPLAHNDGKKIKNKGFCYMD 188

Query: 702 FKTREQALAVIDAMDGAVLDGHRIQLKLSH----RXXXXXXXXXXXXXXXXXIIVKNLPF 757
           FKT EQ  ++I  +  + L+G  + +K S     R                 + V NL F
Sbjct: 189 FKTNEQMESII-KLSESQLNGRNMLIKDSKSYEGRPDKNDLVSLSKNPPSRILFVGNLSF 247

Query: 758 EVERKQIFELFSSFGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQLQGVHLLGR 816
           +   + + + F   G++  +R+    D    +GFAF++F   + A NA++      +  R
Sbjct: 248 DTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDKTCRKIAAR 307

Query: 817 RLVMQHAEE 825
            + M++ E+
Sbjct: 308 PIRMEYGED 316

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 45/87 (51%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+ N+ +  T++  +K F   GE+ ++ +A    +GK KGFA++ F++   A NA  + 
Sbjct: 240 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDK 299

Query: 395 DKQIFQGRLLHILPGEQKKSHRLDEFD 421
             +    R + +  GE +   ++   D
Sbjct: 300 TCRKIAARPIRMEYGEDRSKRQVKRRD 326

>KLLA0F23650g 2210563..2211501 some similarities with sp|P53927
           Saccharomyces cerevisiae YNL110c singleton, hypothetical
           start
          Length = 312

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAY 391
           +G L++  +     E +  K F+ FG+L++V +A + +TG S+ +A++ + N  DA  A 
Sbjct: 182 SGILYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVAQ 241

Query: 392 VELDKQIFQGRLL--HILP 408
             ++  +  G LL   +LP
Sbjct: 242 ESMNNYLLMGHLLKVKVLP 260

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + +  LP   + +++ + FS FG LK VRL + K   ++R +AF+E++   +A  A E +
Sbjct: 185 LYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVAQESM 244

Query: 809 QGVHLLGRRL 818
               L+G  L
Sbjct: 245 NNYLLMGHLL 254

>Scas_666.11
          Length = 224

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 11/115 (9%)

Query: 339 NILYTAT------EDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYV 392
           +ILY +       E +  K F+ FG+L+EV +A + +TG S+ + ++ F N  DA  A  
Sbjct: 94  SILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQD 153

Query: 393 ELDKQIFQGRLLHI--LPGEQK--KSHRLDEFDLKNLPLKKQ-RSLKRKANASHD 442
            ++  +  G LL +  LP   K  K ++  +     + +KK  + LK +A+  H+
Sbjct: 154 AMNNYLVMGHLLQVRLLPKGAKIEKLYKYKKRAFTQMKIKKTAKELKERAHTKHE 208

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 54/108 (50%), Gaps = 13/108 (12%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V  LP     +++ + FS FG LK VRL + K   ++R + F+EF    +A  A + +
Sbjct: 96  LYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQDAM 155

Query: 809 QGV----HLLGRRLVMQHAEEEPQDAE-EQIARMTKKVRSQVTTREHA 851
                  HLL  RL+       P+ A+ E++ +  K+  +Q+  ++ A
Sbjct: 156 NNYLVMGHLLQVRLL-------PKGAKIEKLYKYKKRAFTQMKIKKTA 196

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 5/79 (6%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           ++V  L      +EL++ F  FG   + +V+   + K  N   S  +GF EF  ++ A  
Sbjct: 96  LYVSRLPQGFHERELSKYFSQFGD--LKEVRLARNKKTGN---SRHYGFIEFANKDDANI 150

Query: 711 VIDAMDGAVLDGHRIQLKL 729
             DAM+  ++ GH +Q++L
Sbjct: 151 AQDAMNNYLVMGHLLQVRL 169

>ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH]
           complement(734486..735007) [522 bp, 173 aa]
          Length = 173

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQL 808
           I    L  E+    I  +FS FG    ++L +  +   +RGF F+++   +    A++ L
Sbjct: 36  IHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNL 95

Query: 809 QGVHLLGRRLVMQHAEEEPQDAEEQIARMTKK 840
            GV+L GR L + H   EP+D +E   +  ++
Sbjct: 96  NGVNLCGRVLKVDHCFYEPRDEDEAYVKTVRE 127

 Score = 32.7 bits (73), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%)

Query: 345 TEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLL 404
           TE D   +F+ FG   ++ +  D  TG+S+GF ++ +++      A   L+     GR+L
Sbjct: 46  TEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVL 105

Query: 405 HI 406
            +
Sbjct: 106 KV 107

>Scas_635.7
          Length = 581

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 32/51 (62%)

Query: 334 RLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNP 384
           ++F+  + +  TED  +  F+ +G + E+ +  D  TG+S+GF ++ F+NP
Sbjct: 197 KMFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENP 247

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 11/90 (12%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAA--- 388
           TG++F+  I       +F   FA +G + +  + LD  TG+S+GF +V + + GDA    
Sbjct: 279 TGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQLMLDKDTGRSRGFGFVTYDS-GDAVDRV 337

Query: 389 --NAYVELDKQIFQGRLLHILPGEQKKSHR 416
             N Y+E     F+G+ + I   E + + R
Sbjct: 338 CQNKYIE-----FKGKQIEIKRAEPRHNQR 362

>AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH]
           complement(617434..618879) [1446 bp, 481 aa]
          Length = 481

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 108/277 (38%), Gaps = 28/277 (10%)

Query: 303 STEDPES-TEQQESKLDTTEEEKFIQKIEATG--RLFLRNILYTATEDDFRKLF-APFGE 358
           +T +P + T ++  +L+          I AT    LF+ ++  TATE     LF   F  
Sbjct: 129 TTRNPTNPTGKRNFRLNWASGATLQSDIPATPEFSLFVGDLSPTATEAHLLSLFQTKFKS 188

Query: 359 LEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHRLD 418
           ++ V V  D  TG S+ F +V F +  +   A  E++    QGR L +     +      
Sbjct: 189 VKTVRVMTDPITGASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVAYATPRN----- 243

Query: 419 EFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLGVQKSDLIDATDAS 478
                NL       L+++          +        +  S+   +GV     +DA    
Sbjct: 244 -----NL-------LQQQQAHPAPPAPPSPPAPPAQTLPDSLGLLVGVPSLAQLDAASLG 291

Query: 479 AAVKQALAEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSELAD 538
            A +Q L    ++G       S  + L    Q   P+D  +T + +       +  +L  
Sbjct: 292 RA-QQPL----LLGAAGSLVGSNSLPLAAPRQL--PADTANTTVFIGGLSNMISEGQLHA 344

Query: 539 LFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKL 575
           LF+PFG +  + +PP +    V++ +   A AA   +
Sbjct: 345 LFMPFGNILSVKVPPGRGCGFVRFENRMDAEAAIQGM 381

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 5/61 (8%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + +  L   +   Q+  LF  FG + SV++P       RG  FV F    +AE A++ +Q
Sbjct: 328 VFIGGLSNMISEGQLHALFMPFGNILSVKVPP-----GRGCGFVRFENRMDAEAAIQGMQ 382

Query: 810 G 810
           G
Sbjct: 383 G 383

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 11/79 (13%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++F+  L+   +  +L   F  FG   +  VK  P           G GF  F+ R  A 
Sbjct: 327 TVFIGGLSNMISEGQLHALFMPFGN--ILSVKVPP---------GRGCGFVRFENRMDAE 375

Query: 710 AVIDAMDGAVLDGHRIQLK 728
           A I  M G ++ G+ I+L 
Sbjct: 376 AAIQGMQGFIVGGNAIRLS 394

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 750 IIVKNLPFEVERKQIFELFSS-FGQLKSVR-LPKKFDKSARGFAFVEFLLPKEAENAMEQ 807
           + V +L        +  LF + F  +K+VR +      ++R F FV F   KE   A+ +
Sbjct: 164 LFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALAE 223

Query: 808 LQGVHLLGRRLVMQHA 823
           + GV   GR+L + +A
Sbjct: 224 MNGVWCQGRQLRVAYA 239

>ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH]
           (140625..141752) [1128 bp, 375 aa]
          Length = 375

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+ N+ +  T++  +K F   GE+ ++ +A    +GK KGFA+V F++   A  A  + 
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 395 DKQIFQGRLLHILPGEQK 412
             +   GR L +  GE +
Sbjct: 278 SCRAIAGRPLRMEYGEDR 295

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 83/191 (43%), Gaps = 19/191 (9%)

Query: 651 IFVKNLNFSTTGKELTEKF---KTFG---GFV----VAQVKTKPDPKNSNKTL-SMGFGF 699
           +++ N+ F TT +EL  +F   KT G   G V    + +V   P  KN  K + + GF +
Sbjct: 107 VWIGNMAFDTTQEEL-RRFVVSKTAGMEAGEVTDADIVRVNM-PLAKNDGKQIKNKGFAY 164

Query: 700 AEFKTREQALAVIDAMDGAVLDGHRIQLK----LSHRXXXXXXXXXXXXXXXXXIIVKNL 755
            +F T  Q  AVI  +  A L+G  + +K       R                 + V NL
Sbjct: 165 VDFATSAQMDAVI-GLSEAQLNGRNLLIKNAKSYDGRPAKNDLISMSKNPPSRILFVGNL 223

Query: 756 PFEVERKQIFELFSSFGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQLQGVHLL 814
            F+   + + + F   G++  +R+    D    +GFAFV+F     A  A+       + 
Sbjct: 224 SFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDRSCRAIA 283

Query: 815 GRRLVMQHAEE 825
           GR L M++ E+
Sbjct: 284 GRPLRMEYGED 294

>CAGL0E01947g 193225..194583 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 452

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 33/50 (66%)

Query: 334 RLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKN 383
           ++F+  + +  TED  R  F+ +G++EE+ +  D  TG+S+GF ++ F++
Sbjct: 123 KMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFES 172

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAY 391
           TG++F+  I       +F + FA +G + +  + LD  TG+S+GF ++ +  P DA +  
Sbjct: 205 TGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTP-DAVDKV 263

Query: 392 VELDKQIFQGRLLHI 406
            +     F+GR + I
Sbjct: 264 CQNKFIDFKGRKIEI 278

>ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH]
           (1024792..1025754) [963 bp, 320 aa]
          Length = 320

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 7/59 (11%)

Query: 752 VKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQG 810
           VK  P +VE  ++ E+FS +G LK V+L         GFAFVEF  P+ AE A++ + G
Sbjct: 41  VKPFPPDVEEHELDEIFSPYGALKEVKL-------MSGFAFVEFEKPESAEQAIKDVNG 92

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 2/63 (3%)

Query: 520 TVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKR 579
           T L VK FP      EL ++F P+G L+ + L      A V++    SA  A   ++ K 
Sbjct: 37  TRLHVKPFPPDVEEHELDEIFSPYGALKEVKL--MSGFAFVEFEKPESAEQAIKDVNGKM 94

Query: 580 FKD 582
           F D
Sbjct: 95  FAD 97

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 8/69 (11%)

Query: 331 ATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
           +T RL ++       E +  ++F+P+G L+EV +          GFA+V F+ P  A  A
Sbjct: 35  STTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLM--------SGFAFVEFEKPESAEQA 86

Query: 391 YVELDKQIF 399
             +++ ++F
Sbjct: 87  IKDVNGKMF 95

>YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein with
           weak similarity to RNA-binding proteins, contains one
           RNA recognition (RRM) domain [2007 bp, 668 aa]
          Length = 668

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSA-RGFAFVEFLLPKEAENAMEQL 808
           I++KN+PF ++++Q+ ++               FD    RG AF  F  P+E    +  L
Sbjct: 87  IVIKNIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIFRGLAFANFTTPEETTQVITSL 146

Query: 809 QGVHLLGRRLVMQHAEEEPQ 828
            G  + GR+L +++ +  PQ
Sbjct: 147 NGKEISGRKLKVEYKKMLPQ 166

>YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylated
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           [1605 bp, 534 aa]
          Length = 534

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 43/75 (57%), Gaps = 9/75 (12%)

Query: 310 TEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTR 369
           T+++ SK D ++E         + ++F+  + +  TED+ R+ F  +G + ++ +  D  
Sbjct: 145 TKEERSKADLSKE---------SCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPA 195

Query: 370 TGKSKGFAYVMFKNP 384
           TG+S+GF ++ F+ P
Sbjct: 196 TGRSRGFGFLSFEKP 210

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 330 EATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAAN 389
           + TG++F+  I       +F + F+ +G + +  + LD  TG+S+GF +V +    D+A+
Sbjct: 240 DKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTY----DSAD 295

Query: 390 A 390
           A
Sbjct: 296 A 296

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 12/61 (19%)

Query: 2   SRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRA-GESRRFAFVGF 60
            ++ + G+    TED L+++FGK             ++TD+KI+K+ A G SR F F+ F
Sbjct: 159 CKMFIGGLNWDTTEDNLREYFGKY-----------GTVTDLKIMKDPATGRSRGFGFLSF 207

Query: 61  K 61
           +
Sbjct: 208 E 208

>YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein
           required for ribosome biogenesis, contains three
           canonical RNA recognition motif (RRM) domains and one
           degenerate RNA recognition motif (RRM) domain [2058 bp,
           685 aa]
          Length = 685

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 15/89 (16%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKN----------- 383
           +F+RN+ Y ATE+     F+ FG ++     +D  TG +KG A+V FK+           
Sbjct: 292 VFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQYTYNECIKNA 351

Query: 384 PGDAANAYVELD----KQIFQGRLLHILP 408
           P   + + +  D    + +++GR+L I P
Sbjct: 352 PAAGSTSLLIGDDVMPEYVYEGRVLSITP 380

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/203 (18%), Positives = 78/203 (38%), Gaps = 35/203 (17%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV+++    T ++L + F  F     A +K     K++NK  S GFGF  F   +   
Sbjct: 27  TLFVRSIPQDVTDEQLADFFSNF-----APIKHAVVVKDTNKR-SRGFGFVSFAVEDDTK 80

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXX--------------------- 748
             +        +GH +++ ++ R                                     
Sbjct: 81  EALAKARKTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGED 140

Query: 749 -------XIIVKNLPFEV-ERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKE 800
                   +I++N+P+   +  ++ ++F  +G +    +P+K D    GFAFV       
Sbjct: 141 SMLKGKPKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISN 200

Query: 801 AENAMEQLQGVHLLGRRLVMQHA 823
              A+E  + + + GR++ +  A
Sbjct: 201 CRIALENTKDLKIDGRKVAVDFA 223

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 16/111 (14%)

Query: 298 EDNVESTEDPES--TEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAP 355
           E+ +E+ E P S  ++Q +  LD                LF+R+I    T++     F+ 
Sbjct: 2   EETIENVEVPSSNVSKQNDDGLDMKT-------------LFVRSIPQDVTDEQLADFFSN 48

Query: 356 FGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHI 406
           F  ++   V  DT   +S+GF +V F    D   A  +  K  F G +L +
Sbjct: 49  FAPIKHAVVVKDT-NKRSRGFGFVSFAVEDDTKEALAKARKTKFNGHILRV 98

>CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces
           cerevisiae YOR319w essential yeast splicing factor,
           hypothetical start
          Length = 211

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 46/81 (56%), Gaps = 2/81 (2%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V N+  +V ++ ++ELF+  GQ+K V+ PK K  +  +GFAF+EF    +A+  +  +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 809 -QGVHLLGRRLVMQHAEEEPQ 828
              V L  + L ++ + +  Q
Sbjct: 68  NNNVKLYQKVLKIRRSNQAVQ 88

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 83/186 (44%), Gaps = 17/186 (9%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +I+V N++   T + L E F   G     QVK    PK+       GF F EF +   A 
Sbjct: 7   TIYVGNIDTKVTKELLYELFTQVG-----QVKKVKYPKDKISQEYQGFAFIEFFSTADAD 61

Query: 710 AVIDAMDGAV-LDGHRIQLKLSHRXXXXXXXXX-----XXXXXXXXIIVKNLPFEVERKQ 763
            V++ M+  V L    ++++ S++                      + VK++   VE + 
Sbjct: 62  YVLNVMNNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRH 121

Query: 764 IFELFSSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVM 820
           + +LFS FG L   + P+ F  S    R  AF+ F     A+ A++ L G  ++ ++  +
Sbjct: 122 LTQLFSKFGPL--AKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKASL 178

Query: 821 QHAEEE 826
           ++A +E
Sbjct: 179 EYAFKE 184

>ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH]
           complement(408687..410267) [1581 bp, 526 aa]
          Length = 526

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 334 RLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMF 381
           ++F+  + +  TED+ R+ F+ +G + EV +  D  TG+S+GF ++ F
Sbjct: 164 KMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSF 211

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 333 GRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYV 392
           G++F+  I       +F + F+ +G + +  + LD  TG+S+GF ++ + +P DA +   
Sbjct: 247 GKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDSP-DAVDRVC 305

Query: 393 ELDKQIFQGRLLHI 406
           +     F+G+ + I
Sbjct: 306 QNKFIEFKGKRIEI 319

>ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH]
           complement(771971..773707) [1737 bp, 578 aa]
          Length = 578

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSA-RGFAFVEFLLPKEAENAMEQL 808
           I++KN+PF ++++Q+ E+ +             FD    RG AF  F   +E    ++ L
Sbjct: 51  IVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEETMQVVQHL 110

Query: 809 QGVHLLGRRLVMQHAEEEPQ 828
            G  + GRRL +++ +  PQ
Sbjct: 111 NGKEIGGRRLRVEYKKMLPQ 130

>YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein with
           possible role in protein translation, has one RNA
           recognition (RRM) domain [753 bp, 250 aa]
          Length = 250

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 8/97 (8%)

Query: 308 ESTEQQESKLDTTEEEKFIQKIEATGR-LFLRNILYTATEDDFRKLFAPFGELEEVHVAL 366
           E T Q   KL  ++EEK   ++EA  R +F+ NI    T +     F   G+++ + +  
Sbjct: 40  EGTPQVSQKL--SKEEKHAHQLEADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLY 97

Query: 367 DTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRL 403
           D  TG  KG+ Y+ F++P     AY E   Q+  G L
Sbjct: 98  DRNTGTPKGYGYIEFESP-----AYREKALQLNGGEL 129

>Scas_500.6
          Length = 621

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSA-RGFAFVEFLLPKEAENAMEQL 808
           I++KN+PF ++R+Q+ ++ +             FD    RG AF  F    E    +E L
Sbjct: 55  IVIKNIPFAIKREQLLDIMAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTDETTRVIECL 114

Query: 809 QGVHLLGRRLVMQHAEEEPQ 828
            G  + GR+L +++ +  PQ
Sbjct: 115 NGKEIGGRKLRVEYKKMLPQ 134

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 7/79 (8%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V+  PF+V+  ++ E+FS FG +K V++         GFAFVEF   + A  A++++ 
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKI-------LNGFAFVEFEESESAAKAIDEVN 129

Query: 810 GVHLLGRRLVMQHAEEEPQ 828
           G     + L + +++  PQ
Sbjct: 130 GKTFANQPLEVVYSKLPPQ 148

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 8/77 (10%)

Query: 331 ATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
           +T RLF+R   +   E +  ++F+PFG ++EV +          GFA+V F+    AA A
Sbjct: 73  STTRLFVRPFPFDVQESELNEIFSPFGPMKEVKIL--------NGFAFVEFEESESAAKA 124

Query: 391 YVELDKQIFQGRLLHIL 407
             E++ + F  + L ++
Sbjct: 125 IDEVNGKTFANQPLEVV 141

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 520 TVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKR 579
           T L V+ FPF    SEL ++F PFG ++ + +      A V++ ++ SA  A  +++ K 
Sbjct: 75  TRLFVRPFPFDVQESELNEIFSPFGPMKEVKI--LNGFAFVEFEESESAAKAIDEVNGKT 132

Query: 580 FKDGIL 585
           F +  L
Sbjct: 133 FANQPL 138

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 72/183 (39%), Gaps = 38/183 (20%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +FV+   F     EL E F  FG            P    K L+ GF F EF+  E A  
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFG------------PMKEVKILN-GFAFVEFEESESAAK 123

Query: 711 VIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELF-- 768
            ID ++G       +++  S                   +I++NLP  V  +++ +L   
Sbjct: 124 AIDEVNGKTFANQPLEVVYSK-----------LPPQRFRMILRNLPEGVAWQELKDLARE 172

Query: 769 ----SSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAE 824
               ++F  + +    ++FD    G   +EF   +  E A+E+L  +   G  + ++  +
Sbjct: 173 NNLETTFSSVNT----REFD----GTGALEFPTEEILEEALEKLNNIEFRGAVISVERDD 224

Query: 825 EEP 827
             P
Sbjct: 225 NPP 227

>Kwal_0.250
          Length = 216

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 66/163 (40%), Gaps = 26/163 (15%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           IF+ NL +ST+ + L + FK  G        T+ D K      S GFG   F+T ++A  
Sbjct: 62  IFIANLPYSTSWQSLKDLFKACGN------PTRADVKLDRNGRSKGFGTVIFETIDEART 115

Query: 711 VIDAMDGAVLDGHRIQLK----------------LSHRXXXXXXXXXXXXXXXXXIIVKN 754
            +D      L+G  ++LK                +S                   I V N
Sbjct: 116 ALDKFQHFDLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQTENASGEGHKSNTIYVDN 175

Query: 755 LPFEVERKQIFELFSSFGQLKSVRLPKKFDKSAR--GFAFVEF 795
           LP+   +  +++LF + G ++   L  K+D+  +  G A V +
Sbjct: 176 LPYATAQSDLYDLFETIGVVERAEL--KYDRKVKPTGAAIVSY 216

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 5/100 (5%)

Query: 307 PESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVAL 366
           P S   +ES       E+F    E    +F+ N+ Y+ +    + LF   G      V L
Sbjct: 38  PGSMRSEESGAKKLTLERFHPGYE----IFIANLPYSTSWQSLKDLFKACGNPTRADVKL 93

Query: 367 DTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHI 406
           D R G+SKGF  V+F+   +A  A  +      +GR+L +
Sbjct: 94  D-RNGRSKGFGTVIFETIDEARTALDKFQHFDLEGRILEL 132

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 8/92 (8%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSAR--GFAFVEFLLPKEAENAMEQ 807
           I + NLP+    + + +LF + G     R   K D++ R  GF  V F    EA  A+++
Sbjct: 62  IFIANLPYSTSWQSLKDLFKACGN--PTRADVKLDRNGRSKGFGTVIFETIDEARTALDK 119

Query: 808 LQGVHLLGRRLVMQHA----EEEPQDAEEQIA 835
            Q   L GR L ++      EEEP      ++
Sbjct: 120 FQHFDLEGRILELKRGYGPWEEEPSPVSADVS 151

>YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein
           important for the synthesis of 25S pre-rRNA [1380 bp,
           459 aa]
          Length = 459

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKN 383
           +F+ N+ +   E+   K F P G++E V +  D++T   KGFAYV FK+
Sbjct: 281 IFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKD 329

>Scas_316.1
          Length = 483

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 46/89 (51%), Gaps = 15/89 (16%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKN----------- 383
           +F+RN+ Y ATE+     F+ FG+++     +D  TG +KG A+V F++           
Sbjct: 244 IFVRNVPYDATEESLAAHFSKFGQVKYALPVIDRTTGLAKGTAFVAFRDHMTYKYCIDNA 303

Query: 384 PGDAANAYV----ELDKQIFQGRLLHILP 408
           P   + + +     L + +++GR+L I P
Sbjct: 304 PAAGSTSLLIGDDVLPEYVYEGRVLSISP 332

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 750 IIVKNLPFEV-ERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQL 808
           +I++N+P+   +  Q+ ++FS FG +    +PKK D    GFAFV          A+E  
Sbjct: 84  LIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLCGFAFVTMKKLSNCTIALENT 143

Query: 809 QGVHLLGRRLVMQHA 823
           + + + GR + +  A
Sbjct: 144 KDLKIDGRSVAVDFA 158

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS---ARGFAFVEF 795
           I V+N+P++   + +   FS FGQ+K   LP   D++   A+G AFV F
Sbjct: 244 IFVRNVPYDATEESLAAHFSKFGQVKYA-LP-VIDRTTGLAKGTAFVAF 290

>KLLA0B00847g complement(65983..66792) similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35 translation
           initiation factor eIF3 (p33 subunit) singleton, start by
           similarity
          Length = 269

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%)

Query: 350 RKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLH 405
           R+L  PFGE+  V V  +  TG+S+G AYV F+    AA A   L+ + F   +LH
Sbjct: 202 RELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQALKLLEGRGFMNFMLH 257

>YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           and a glutamine-rich region [2019 bp, 672 aa]
          Length = 672

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAP-FGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVE 393
           LF+ ++  TATE D   LF   F  ++ V V  D  TG S+ F +V F +  +   A +E
Sbjct: 194 LFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALIE 253

Query: 394 LDKQIFQGRLLHI 406
           +  + FQGR L +
Sbjct: 254 MSGKWFQGRALRV 266

>Kwal_47.18572
          Length = 363

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 12/97 (12%)

Query: 331 ATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
           +T RLF+R   +   + +  ++F PFG ++EV +          GFA+V F+    AA A
Sbjct: 80  STTRLFVRPFPFDVQDSELNEIFGPFGPMKEVKIL--------NGFAFVEFEEADSAARA 131

Query: 391 YVELDKQIFQGRLLHILPGE-QKKSHRLDEFDLKNLP 426
             E++ + F  + L ++  + Q   +R+    L+NLP
Sbjct: 132 IEEVNGKTFANQPLEVVYSKVQPPRYRM---ILRNLP 165

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 7/78 (8%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V+  PF+V+  ++ E+F  FG +K V++         GFAFVEF     A  A+E++ 
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKI-------LNGFAFVEFEEADSAARAIEEVN 136

Query: 810 GVHLLGRRLVMQHAEEEP 827
           G     + L + +++ +P
Sbjct: 137 GKTFANQPLEVVYSKVQP 154

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 520 TVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKR 579
           T L V+ FPF    SEL ++F PFG ++ + +      A V++ +A SA  A  +++ K 
Sbjct: 82  TRLFVRPFPFDVQDSELNEIFGPFGPMKEVKI--LNGFAFVEFEEADSAARAIEEVNGKT 139

Query: 580 FKDGIL 585
           F +  L
Sbjct: 140 FANQPL 145

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 72/183 (39%), Gaps = 38/183 (20%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +FV+   F     EL E F  FG            P    K L+ GF F EF+  + A  
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFG------------PMKEVKILN-GFAFVEFEEADSAAR 130

Query: 711 VIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELF-- 768
            I+ ++G       +++  S                   +I++NLP  V  +++ +L   
Sbjct: 131 AIEEVNGKTFANQPLEVVYS-----------KVQPPRYRMILRNLPDGVAWQELKDLARE 179

Query: 769 ----SSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAE 824
               ++F  + +    ++FD    G   +EF   +  E+A+++L  +   G  +  +  +
Sbjct: 180 NNLETTFSSVNT----REFD----GTGALEFPSEEILEDALQKLNNIEFRGSVITAERDD 231

Query: 825 EEP 827
             P
Sbjct: 232 NPP 234

>YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylated
           RNA-binding protein of nucleus and cytoplasm, contains
           three RNA recognition (RRM) domains and three
           Gln/Asn-rich regions [1362 bp, 453 aa]
          Length = 453

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 74/174 (42%), Gaps = 13/174 (7%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           ++V NL+ + T   L + F+  G   +A +K   D  N N    + + F E+     A  
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGG--PIANIKIMIDKNNKN----VNYAFVEYHQSHDANI 130

Query: 711 VIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSS 770
            +  ++G  ++ + +++  + +                 + V +L   V+ + +   F  
Sbjct: 131 ALQTLNGKQIENNIVKINWAFQSQQSSSDDTFN------LFVGDLNVNVDDETLRNAFKD 184

Query: 771 FGQLKSVRLPKKFDK-SARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHA 823
           F    S  +       S+RG+ FV F    +A+NAM+ +QG  L GR L +  A
Sbjct: 185 FPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWA 238

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAY 391
           T  LF+ ++     ++  R  F  F      HV  D +TG S+G+ +V F +  DA NA 
Sbjct: 161 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAM 220

Query: 392 VELDKQIFQGRLLHI 406
             +  Q   GR L I
Sbjct: 221 DSMQGQDLNGRPLRI 235

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV +LN +   + L   FK F  ++   V       +     S G+GF  F +++ A 
Sbjct: 163 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW-----DMQTGSSRGYGFVSFTSQDDAQ 217

Query: 710 AVIDAMDGAVLDGHRIQLKLSHR 732
             +D+M G  L+G  +++  + +
Sbjct: 218 NAMDSMQGQDLNGRPLRINWAAK 240

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 336 FLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELD 395
           ++ NI + ATE D   LF  FG +      LD +    KG  ++ +     AA   V L 
Sbjct: 344 YIGNIPHFATEADLIPLFQNFGFI------LDFKHYPEKGCCFIKYDTHEQAAVCIVALA 397

Query: 396 KQIFQGRLLHILPGEQKKS 414
              FQGR L    G+++ +
Sbjct: 398 NFPFQGRNLRTGWGKERSN 416

>KLLA0C05522g 494240..495862 some similarities with sp|P32831
           Saccharomyces cerevisiae YBR212w NGR1
           glucose-repressible RNA-binding protein, hypothetical
           start
          Length = 540

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 335 LFLRNILYTATEDDFRKLF-APFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVE 393
           LF+ ++   ATE D   LF   +  ++ V V  D  TG S+ F +V F N  +  NA +E
Sbjct: 161 LFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALIE 220

Query: 394 LDKQIFQGRLLHI 406
           ++   FQGR L +
Sbjct: 221 MNGVQFQGRQLRV 233

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V  L   +   Q+FELF  FG +  V++P       +   FV++    EAE A+  LQ
Sbjct: 447 VFVGGLNPNINELQLFELFKPFGTITDVKIPP-----GKQCGFVKYNERLEAEAAINGLQ 501

Query: 810 GVHLLGRRL 818
           G  ++G  +
Sbjct: 502 GFIIMGSPI 510

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 3/82 (3%)

Query: 756 PFEVERKQIFELFSS-FGQLKSVR-LPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHL 813
           PF  E   +  LF + +  +K+VR +      ++R F FV F    E  NA+ ++ GV  
Sbjct: 168 PFATE-ADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALIEMNGVQF 226

Query: 814 LGRRLVMQHAEEEPQDAEEQIA 835
            GR+L + +A      A++ ++
Sbjct: 227 QGRQLRVAYATPRNNVAQQHLS 248

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 11/78 (14%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV  LN +    +L E FK FG   +  VK  P  +          GF ++  R +A 
Sbjct: 446 TVFVGGLNPNINELQLFELFKPFG--TITDVKIPPGKQ---------CGFVKYNERLEAE 494

Query: 710 AVIDAMDGAVLDGHRIQL 727
           A I+ + G ++ G  I+L
Sbjct: 495 AAINGLQGFIIMGSPIRL 512

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 535 ELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKL 575
           +L +LF PFG +  + +PP +    V+Y +   A AA + L
Sbjct: 460 QLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAAINGL 500

>Kwal_33.14463
          Length = 393

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+ N+ +  T++  +K F   G++ ++ +A    TGK KGFA+V FK+     NA  + 
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 395 DKQIFQGRLLHILPGEQK 412
             +   GR L +  GE +
Sbjct: 297 TCRKIAGRPLRMEFGEDR 314

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 82/197 (41%), Gaps = 30/197 (15%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVK----------------TKPDPKNSNKTL- 693
           +++ NL+F T+ ++L         F VA+ K                  P  +N  K + 
Sbjct: 125 VWIGNLSFDTSKEDLCR-------FFVAKTKELDESCRIEESDIVRVNLPLAQNDGKQIK 177

Query: 694 SMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSH----RXXXXXXXXXXXXXXXXX 749
           + GF    FKT+EQ  AV+ A+  + L+G  + +K S     R                 
Sbjct: 178 NKGFAHMNFKTQEQMNAVV-ALSESHLNGRNLLIKDSSSFDGRPDKNDLISMSKNPPSRI 236

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQL 808
           + V NL F+   + + + F   G +  +R+    D    +GFAFV+F   +   NA++  
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 809 QGVHLLGRRLVMQHAEE 825
               + GR L M+  E+
Sbjct: 297 TCRKIAGRPLRMEFGED 313

>CAGL0L12672g complement(1359637..1361685) similar to sp|P37838
           Saccharomyces cerevisiae YPL043w nucleolar protein,
           start by similarity
          Length = 682

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 15/89 (16%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKN----------- 383
           +F+RN+ Y ATE+     F+ FG ++     +D  TG +KG A+V FK+           
Sbjct: 292 VFVRNVPYDATEESLFDHFSKFGPVKYALPVIDKNTGLAKGTAFVAFKDEKTYKYCVDNS 351

Query: 384 PGDAANAYV----ELDKQIFQGRLLHILP 408
           P   A + +     L + +++GR+L + P
Sbjct: 352 PQTGATSLLIGDDVLPEYVYEGRVLAVTP 380

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/204 (19%), Positives = 79/204 (38%), Gaps = 36/204 (17%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV+++  S T ++L + F  F     A V      K+ NK  S GFGF  F   +   
Sbjct: 23  TLFVRSIPESVTDEQLADFFSNFAPIRHAVV-----VKDVNKK-SRGFGFVSFAVEDDTK 76

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXX--------------------- 748
             +       LDG ++++ ++ R                                     
Sbjct: 77  IALKEARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDE 136

Query: 749 --------XIIVKNLPFEV-ERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPK 799
                    +I++N+P+   +  ++ ++F  +G +    +P+K D    GFAFV      
Sbjct: 137 SSLLKGKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKIS 196

Query: 800 EAENAMEQLQGVHLLGRRLVMQHA 823
             + A+E  + + + GR++ +  A
Sbjct: 197 NCKKALEDTKNLTIDGRKVAVDFA 220

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 53/98 (54%), Gaps = 7/98 (7%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V+++P  V  +Q+ + FS+F  ++   + K  +K +RGF FV F +  + + A+++ +
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEAR 83

Query: 810 GVHLLGRRLVM-------QHAEEEPQDAEEQIARMTKK 840
              L G +L +       +  + E + A+++I R + K
Sbjct: 84  KTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSK 121

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS---ARGFAFVEF 795
           + V+N+P++   + +F+ FS FG +K   LP   DK+   A+G AFV F
Sbjct: 292 VFVRNVPYDATEESLFDHFSKFGPVKYA-LP-VIDKNTGLAKGTAFVAF 338

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 11/89 (12%)

Query: 1  MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGF 60
          M  + V+ IP+ +T+++L D F       H             ++K+   +SR F FV F
Sbjct: 21 MKTLFVRSIPESVTDEQLADFFSNFAPIRH-----------AVVVKDVNKKSRGFGFVSF 69

Query: 61 KSEEDAFDAVNYFDQSFIDTSKIEVSMAK 89
            E+D   A+    ++ +D ++++V +A+
Sbjct: 70 AVEDDTKIALKEARKTKLDGAQLKVDIAR 98

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+R+I  + T++     F+ F  +    V  D    KS+GF +V F    D   A  E 
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDV-NKKSRGFGFVSFAVEDDTKIALKEA 82

Query: 395 DKQIFQGRLLHI 406
            K    G  L +
Sbjct: 83  RKTKLDGAQLKV 94

>Scas_717.41
          Length = 379

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 18/100 (18%)

Query: 331 ATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
           +T RLF+R   +   E +  ++F PFG ++EV +          GFA+V F+    AA A
Sbjct: 81  STTRLFVRPFPFDVQEAELNEIFTPFGPMKEVKIL--------NGFAFVEFEEADSAAKA 132

Query: 391 YVELDKQIFQGRLLHI----LPGEQKKSHRLDEFDLKNLP 426
             E++ + F  + L +    LP    K +RL    L+NLP
Sbjct: 133 IEEVNGKTFANQPLEVVYSKLP---VKRYRL---TLRNLP 166

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 7/61 (11%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V+  PF+V+  ++ E+F+ FG +K V++         GFAFVEF     A  A+E++ 
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKI-------LNGFAFVEFEEADSAAKAIEEVN 137

Query: 810 G 810
           G
Sbjct: 138 G 138

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 22/92 (23%)

Query: 520 TVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAA-------- 571
           T L V+ FPF    +EL ++F PFG ++ + +      A V++ +A SA  A        
Sbjct: 83  TRLFVRPFPFDVQEAELNEIFTPFGPMKEVKI--LNGFAFVEFEEADSAAKAIEEVNGKT 140

Query: 572 ---------FSKLSYKRFKDGILYLEKGPKNC 594
                    +SKL  KR++   L L   P+ C
Sbjct: 141 FANQPLEVVYSKLPVKRYR---LTLRNLPEGC 169

>CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I, hypothetical start
          Length = 280

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           ++L +I Y  TE+    L +  G +  + +  D++TGKSKG+A+V +++   +A+A   L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 395 DKQIFQGRLLHI 406
           +      RLL  
Sbjct: 78  NGYQLGSRLLKC 89

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 44/73 (60%), Gaps = 6/73 (8%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAME 806
           + + ++P++   +QI +L S+ G + S+++   FD     ++G+AFV++   + + +A+ 
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKM--MFDSQTGKSKGYAFVQYQDLESSASAVR 75

Query: 807 QLQGVHLLGRRLV 819
            L G + LG RL+
Sbjct: 76  NLNG-YQLGSRLL 87

>Scas_697.10
          Length = 610

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 82/205 (40%), Gaps = 31/205 (15%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++F+ +LN   T + L   F  +  FV A+V       +    +S+G G+  F  +E A 
Sbjct: 102 ALFIGDLNEDVTKETLESIFGVYPSFVSAKV-----CYDFQTNVSLGHGYLNFGDKEDAE 156

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVER----KQIF 765
             ID  +   L    I++  S R                 +   NLP E  R    ++ F
Sbjct: 157 KAIDDFNCMKLGDKVIRIMPSLRGKNTKKSIGTN------VFFTNLPDEDNRLFHSRKFF 210

Query: 766 ELFSSFGQLKSVRL-PKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVM---- 820
           E+F  FG++ S RL P K         F+ F   + A+  +++       G R+      
Sbjct: 211 EIFRQFGKILSCRLDPNK------NIGFISFEHEEVAKTVVKKYNNSMFFGNRITCGILS 264

Query: 821 -----QHAEEEPQDAEEQIARMTKK 840
                +   EE Q+  +Q +++ KK
Sbjct: 265 EDNSKKPIMEEKQEQAKQFSQLNKK 289

>Kwal_26.8458
          Length = 219

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 337 LRNILYTAT------EDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
           L  I+Y +       E +  K F+ FG+L EV +A + +TG S+ + +V F N  D+  A
Sbjct: 88  LSGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVA 147

Query: 391 YVELDKQIFQGRLLHIL 407
              +   +  G LL ++
Sbjct: 148 QETMHNYLLMGHLLQVV 164

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V  LP     +++ + FS FG L+ VRL + K   ++R + FVEF+  +++  A E +
Sbjct: 92  IYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQETM 151

Query: 809 QGVHLLGRRL 818
               L+G  L
Sbjct: 152 HNYLLMGHLL 161

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           I+V  L      +EL + F  FG   + +V+   + K  N   S  +GF EF  +E +  
Sbjct: 92  IYVSRLPKGFHERELAKYFSQFGD--LREVRLARNKKTGN---SRHYGFVEFVNKEDSFV 146

Query: 711 VIDAMDGAVLDGHRIQL 727
             + M   +L GH +Q+
Sbjct: 147 AQETMHNYLLMGHLLQV 163

>CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces
           cerevisiae YPL178w SAE1, start by similarity
          Length = 236

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLP-KKFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V NL F    +QI+ELFS  G +K + +   +F  +  GF F+ +  P+EA NA++ L
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAVKYL 107

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 13/56 (23%), Positives = 31/56 (55%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
           +++ N+ +  +E+   +LF+  G ++ + + LD       GF ++++  P +A NA
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNA 103

>KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces
           cerevisiae YPL043w NOP4 nucleolar protein, start by
           similarity
          Length = 685

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 45/89 (50%), Gaps = 15/89 (16%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKN----------- 383
           +F+RN+ Y AT++   + F  FG ++     +D  TG +KG A+V F++           
Sbjct: 298 IFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAFRSEDAYNDCLNNA 357

Query: 384 PGDAANAYVELD----KQIFQGRLLHILP 408
           P   + + +  D    + +++GR+L I P
Sbjct: 358 PATGSTSLLISDDVSPEYVYEGRVLAISP 386

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+R + + +T+++F   F+ F  ++   +  D   G S+GF +V F    D   A  + 
Sbjct: 17  LFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDG-EGASRGFGFVSFAVEDDTKTALNQA 75

Query: 395 DKQIFQGRLLHI 406
            K  F GRLL I
Sbjct: 76  RKTKFMGRLLRI 87

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V+ +PFE   ++    FS F  +K   + K  + ++RGF FV F +  + + A+ Q +
Sbjct: 17  LFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALNQAR 76

Query: 810 GVHLLGRRLVMQHA 823
               +GR L +  A
Sbjct: 77  KTKFMGRLLRIDIA 90

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 750 IIVKNLPFEV-ERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQL 808
           +I++N+P+   +  ++ ++F  +G +    +P+K D    GFAFV        + A+E  
Sbjct: 135 LIIRNMPWSCRDPTKLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIEGT 194

Query: 809 QGVHLLGRRLVMQHA 823
           + + + GR++ +  A
Sbjct: 195 KDLKIDGRKVAVDFA 209

>Sklu_1706.1 YFR023W, Contig c1706 1364-3382
          Length = 672

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 107/289 (37%), Gaps = 33/289 (11%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+ ++    TE   R  F  +  L  V + +D  + +S G+ Y+ F N  DA  A  E 
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 395 DKQIFQGRLLHILPGEQKKSHRLD---EFDLKNLPLKKQRSLKRKANASHDTFSWN---- 447
           +     G+ + I+P  +   +R +        NLPL+   +L     A +DTF       
Sbjct: 164 NYVPLFGKEVRIMPSLRNSFYRKNIGTNVFFSNLPLE---NLSLTTRAFYDTFKKYGKIL 220

Query: 448 SLYMNQDAVLGSVAA-KLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKY--FESKGMD 504
           S  +++   +G +   K    KS + D           +   H   +VRK   FE +   
Sbjct: 221 SCKLDRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSPEFEKRKSK 280

Query: 505 LTKFEQFKSPSDRDD----------------TVLLVKNFPFGTTHSELADLFLPFGKLQR 548
           L      K     DD                  + VKN P      ++ D F   G ++ 
Sbjct: 281 LDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFFSRIGPVKS 340

Query: 549 LLLPPA----QTIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKN 593
           +          + A V Y+  +    A  KL+ + FK   + + +  KN
Sbjct: 341 VFTSKVPKYNSSWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQKN 389

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I VKNLP       I + FS  G +KSV    K  K    +AFV +    +   A+E+L 
Sbjct: 314 IFVKNLPVNANEDDILDFFSRIGPVKSV-FTSKVPKYNSSWAFVTYKKGSDTSEAIEKLN 372

Query: 810 GVHLLGRRLVMQHAEEEPQ 828
           G     R++ +  A++  Q
Sbjct: 373 GEIFKHRKIEVARAQKNFQ 391

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 59/120 (49%), Gaps = 17/120 (14%)

Query: 311 EQQESKLD---------TTEEEKFIQKIEATGR------LFLRNILYTATEDDFRKLFAP 355
           E+++SKLD          T++E+ +Q++    +      +F++N+   A EDD    F+ 
Sbjct: 275 EKRKSKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFFSR 334

Query: 356 FGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSH 415
            G ++ V  +   +   S  +A+V +K   D + A  +L+ +IF+ R + +   ++   H
Sbjct: 335 IGPVKSVFTSKVPKYNSS--WAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQKNFQH 392

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 32/174 (18%), Positives = 68/174 (39%), Gaps = 19/174 (10%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++F+ +L+   T K L + F  +   V  ++      K S     +G+G+  F   E A 
Sbjct: 103 ALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRS-----LGYGYINFSNDEDAE 157

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFE---VERKQIFE 766
              +  +   L G  +++  S R                 +   NLP E   +  +  ++
Sbjct: 158 KATEEFNYVPLFGKEVRIMPSLR------NSFYRKNIGTNVFFSNLPLENLSLTTRAFYD 211

Query: 767 LFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVM 820
            F  +G++ S +L ++     +   F+ F     A++A++   G    G  ++ 
Sbjct: 212 TFKKYGKILSCKLDRR-----KNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMC 260

>KLLA0B00979g 77439..78467 some similarities with sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3 nucleolar protein
           singleton, hypothetical start
          Length = 342

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 6/82 (7%)

Query: 508 FEQFKSPSDRD----DTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYR 563
           +E F +  D D    DT L VK FP   T +E+ ++F PFG L+ + +      A V++ 
Sbjct: 36  YENFNNRVDDDEELSDTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKI--LNGFAFVEFE 93

Query: 564 DATSARAAFSKLSYKRFKDGIL 585
           +A SA  A   ++ K F D  L
Sbjct: 94  EAESASQAIQNVAGKMFADYPL 115

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 10/62 (16%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + VK  P +V   ++ E+F  FG LK +++         GFAFVEF   +EAE+A + +Q
Sbjct: 54  LFVKPFPPDVTDAEMKEIFEPFGALKEIKI-------LNGFAFVEF---EEAESASQAIQ 103

Query: 810 GV 811
            V
Sbjct: 104 NV 105

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 51/110 (46%), Gaps = 15/110 (13%)

Query: 298 EDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFG 357
           E   E+   P+S E   +++D  EE        +  RLF++      T+ + +++F PFG
Sbjct: 24  EKPYETAPPPQSYENFNNRVDDDEEL-------SDTRLFVKPFPPDVTDAEMKEIFEPFG 76

Query: 358 ELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHIL 407
            L+E+ +          GFA+V F+    A+ A   +  ++F    L ++
Sbjct: 77  ALKEIKIL--------NGFAFVEFEEAESASQAIQNVAGKMFADYPLEVV 118

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 73/183 (39%), Gaps = 38/183 (20%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +FVK      T  E+ E F+ FG   + ++K           +  GF F EF+  E A  
Sbjct: 54  LFVKPFPPDVTDAEMKEIFEPFGA--LKEIK-----------ILNGFAFVEFEEAESASQ 100

Query: 711 VIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELF-- 768
            I  + G +   + +++  S +                 +I++NLP     +++ +L   
Sbjct: 101 AIQNVAGKMFADYPLEVVFSKK-----------LKPRFRVIIRNLPEGCAWQELKDLARD 149

Query: 769 ----SSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAE 824
               ++F  + +    + FD    G   +EF   +  + A+E+L  +   G  L ++  E
Sbjct: 150 NQLETTFSSVNT----RDFD----GTGALEFPTEEILQEAIEKLNNIEFRGSVLAVEKDE 201

Query: 825 EEP 827
             P
Sbjct: 202 NPP 204

>KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4
           Ashbya gossypii Yib1, hypothetical start
          Length = 345

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 66/141 (46%), Gaps = 12/141 (8%)

Query: 277 EGTENTDPEGVTARPKSDIREEDNVESTEDPESTEQQESKLDT----------TEEEKFI 326
           E  +NT+ E   + P  +   ++  + +E  E+ EQ ES + T          +  E+  
Sbjct: 36  ENLDNTEAEKSESEPIPESNSQEESQDSEASENGEQDESNVKTNSGKKDHHHQSRAERLE 95

Query: 327 QKIEATGR-LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPG 385
           ++IE   R +F+ NI   AT +   + F   GE+  V +  +  TG  KG+AY+ F++  
Sbjct: 96  KQIELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFES-S 154

Query: 386 DAANAYVELDKQIFQGRLLHI 406
           D+    +EL      G  +++
Sbjct: 155 DSIPKALELKDSELHGETINV 175

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 10/63 (15%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V+  P +V+  ++ E+F  FG +K V++         GFAFVEF   +EAE+A + ++
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKI-------LNGFAFVEF---EEAESAAKAIE 176

Query: 810 GVH 812
            VH
Sbjct: 177 EVH 179

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 18/97 (18%)

Query: 334 RLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVE 393
           RLF+R       E +  ++F PFG ++EV +          GFA+V F+    AA A  E
Sbjct: 126 RLFVRPFPLDVQESELNEIFGPFGPMKEVKIL--------NGFAFVEFEEAESAAKAIEE 177

Query: 394 LDKQIFQGRLLHI----LPGEQKKSHRLDEFDLKNLP 426
           +  + F  + L +    LP    K +R+    +KNLP
Sbjct: 178 VHGKSFANQPLEVVYSKLPA---KRYRI---TMKNLP 208

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 519 DTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYK 578
           +T L V+ FP     SEL ++F PFG ++ + +      A V++ +A SA  A  ++  K
Sbjct: 124 NTRLFVRPFPLDVQESELNEIFGPFGPMKEVKI--LNGFAFVEFEEAESAAKAIEEVHGK 181

Query: 579 RFKDGIL 585
            F +  L
Sbjct: 182 SFANQPL 188

>CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces
           cerevisiae YCL011c GBP2 or sp|P38922 Saccharomyces
           cerevisiae YNL004w HRB1, hypothetical start
          Length = 419

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/201 (19%), Positives = 77/201 (38%), Gaps = 36/201 (17%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +F+ NL +S T + L + F+  G  + A ++            S GFG   + T+E+   
Sbjct: 224 VFIVNLPYSMTWQTLKDLFREAGDVIRADIEL------DRNGFSRGFGTVFYGTQEEMFN 277

Query: 711 VIDAMDGAVLDGHRIQLKLSHRXXXX--------------------------XXXXXXXX 744
            I+  +G  +DG  +Q++                                          
Sbjct: 278 AIERFNGFDVDGRILQVREGKNSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENVVGGG 337

Query: 745 XXXXXIIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSA--RGFAFVEFLLPKEAE 802
                I   NLP       +++LF + G+++   L  KFD+S    G A +E+   ++A+
Sbjct: 338 ERSTLIYCSNLPLTTATGDLYDLFETIGRVRHAEL--KFDESGAPTGIAVIEYENVEDAD 395

Query: 803 NAMEQLQGVHLLGRRLVMQHA 823
             +++L   +  G  L + +A
Sbjct: 396 FCIQRLNNYNYGGCDLDISYA 416

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I + NL F+   + + + F   G++    +     +  RG   VEF  P+  +NA+    
Sbjct: 121 IFIGNLSFDATPEDLHDFFGQAGEVLRADIITSRGRH-RGMGTVEFTSPEGVDNAIRDFN 179

Query: 810 GVHLLGRRLVMQHAEEEPQDAE 831
           GV  +GR L ++     P+  E
Sbjct: 180 GVEFMGRPLFVRQDNPPPEPME 201

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 73/182 (40%), Gaps = 22/182 (12%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           SIF+ NL+F  T ++L + F   G  + A + T       ++    G G  EF + E   
Sbjct: 120 SIFIGNLSFDATPEDLHDFFGQAGEVLRADIIT-------SRGRHRGMGTVEFTSPEGVD 172

Query: 710 AVIDAMDGAVLDGHRIQLK-----------LSHRXXXXXXXXXXXXXXXXXIIVKNLPFE 758
             I   +G    G  + ++           L                    + + NLP+ 
Sbjct: 173 NAIRDFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYS 232

Query: 759 VERKQIFELFSSFGQLKSVRLPKKFDKS--ARGFAFVEFLLPKEAENAMEQLQGVHLLGR 816
           +  + + +LF   G +  +R   + D++  +RGF  V +   +E  NA+E+  G  + GR
Sbjct: 233 MTWQTLKDLFREAGDV--IRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGR 290

Query: 817 RL 818
            L
Sbjct: 291 IL 292

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 56/138 (40%), Gaps = 16/138 (11%)

Query: 279 TENTDPEGVTARPKSDIREEDNVESTEDPESTEQQESKLDTTEE-----EKFIQKIEATG 333
            E T PEGV     + IR+ + VE    P    Q     +  E      E+F       G
Sbjct: 163 VEFTSPEGV----DNAIRDFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERF-NDYPPEG 217

Query: 334 R-----LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAA 388
           R     +F+ N+ Y+ T    + LF   G++    + LD R G S+GF  V +    +  
Sbjct: 218 RPPMFEVFIVNLPYSMTWQTLKDLFREAGDVIRADIELD-RNGFSRGFGTVFYGTQEEMF 276

Query: 389 NAYVELDKQIFQGRLLHI 406
           NA    +     GR+L +
Sbjct: 277 NAIERFNGFDVDGRILQV 294

>KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor
           singleton, start by similarity
          Length = 432

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 333 GR-LFLRNILYTATEDDFRKLFAPFGELEEVHVAL--DTRTGKSKGFAYVMFKNPGDAAN 389
           GR + ++N+    T DD  K+F  FG+ E+  +    +T  G+   +A++ FKN   A N
Sbjct: 206 GREIIVKNLPDDITIDDLIKMFNEFGDTEKARIVTGDETNPGRHSRYAFITFKNKASADN 265

Query: 390 AYVELDKQIFQGRLLHI 406
           A + L+  +  G+ LH+
Sbjct: 266 A-LSLNGAVMNGKPLHV 281

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 68/172 (39%), Gaps = 25/172 (14%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++ VKNL  +    ++   FKT G  +   V    D  +            EF + +QAL
Sbjct: 38  TVLVKNLPPNYNHHKVRRYFKTCGSILQIDVTDSTDGDSK-------LARIEFSSYDQAL 90

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFS 769
             +      +   H+I ++                     I V N P   +  ++  L S
Sbjct: 91  TAVSRTLKKI-GFHQITVE---------------QLTDSTIWVTNFPPGYDASKLRNLLS 134

Query: 770 SF--GQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLV 819
            +    + S+RLP     S R FA+V+ + P+ A+ A  +L G+ +   +LV
Sbjct: 135 QYIDSPILSIRLPSLAFNSRRRFAYVDLVSPEVAKKATNRLNGIEINNYKLV 186

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 68/147 (46%), Gaps = 11/147 (7%)

Query: 697 FGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLP 756
           F + +  + E A    + ++G  ++ +++  K+S+                  IIVKNLP
Sbjct: 157 FAYVDLVSPEVAKKATNRLNGIEINNYKLVAKISN-VNERTERTDNAISDGREIIVKNLP 215

Query: 757 FEVERKQIFELFSSFGQLKSVRLPKKFDKSARG----FAFVEFLLPKEAENAMEQLQGVH 812
            ++    + ++F+ FG  +  R+    D++  G    +AF+ F     A+NA+  L G  
Sbjct: 216 DDITIDDLIKMFNEFGDTEKARIVTG-DETNPGRHSRYAFITFKNKASADNAL-SLNGAV 273

Query: 813 LLGRRL----VMQHAEEEPQDAEEQIA 835
           + G+ L    VM+ A  E Q+ +  +A
Sbjct: 274 MNGKPLHVSKVMRKAYLERQEVKRLLA 300

>Kwal_26.7179
          Length = 456

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+ N+ +  TE++  K F   G++E V +  D++T   KGFAYV F++     N  + L
Sbjct: 295 VFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRD-FQTVNKALLL 353

Query: 395 DKQIFQ--GRLLHILPGEQ-KKSH 415
           D Q     GR L +   +  KK+H
Sbjct: 354 DGQKLNGTGRKLRVTRCKNMKKTH 377

>Kwal_26.7522
          Length = 262

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 39/70 (55%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           ++L +I Y  TE+    L +  G +  + +  D +TGKSKG+A+V +K+   +A+A   L
Sbjct: 14  VYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAVRNL 73

Query: 395 DKQIFQGRLL 404
           +      RLL
Sbjct: 74  NGYQLGNRLL 83

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 6/73 (8%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAME 806
           + + ++P++   +QI +L S+ G +  V L   FD     ++G+AFVE+   + + +A+ 
Sbjct: 14  VYLGSIPYDQTEEQILDLCSNVGPV--VNLKMMFDPQTGKSKGYAFVEYKDLEASASAVR 71

Query: 807 QLQGVHLLGRRLV 819
            L G   LG RL+
Sbjct: 72  NLNGYQ-LGNRLL 83

>Scas_671.4
          Length = 443

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 90/232 (38%), Gaps = 18/232 (7%)

Query: 599 PEGDETMVDEIVAQSTN------VKEARTTGDEIMQTATASKPEXXXXXXXXXXXXXSIF 652
           PE + T V E    ST       V EA   G++  +   +S                 ++
Sbjct: 27  PESESTPVTETAETSTEPESADPVSEAPAAGEQSAENQESSVVPASATQGGRETSDRVLY 86

Query: 653 VKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVI 712
           V NL+ S     L + F+  G   +  VK   D KN+N    + + F E+     A   +
Sbjct: 87  VGNLDKSINEDLLKQYFQVGGQ--ITDVKIMVDKKNNN----VNYAFIEYLKSHDANVAL 140

Query: 713 DAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSSFG 772
             ++G  ++G  +++  + +                 + V +L  +V+ + +   F  F 
Sbjct: 141 QTLNGIQIEGKTVRINWAFQSQQTTNSDDTFN-----LFVGDLNVDVDDETLSHAFDQFP 195

Query: 773 QLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHA 823
                 +        +RG+ FV F   ++A+ AM  +QG+ + GR + +  A
Sbjct: 196 SYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWA 247

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 33/75 (44%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAY 391
           T  LF+ ++     ++     F  F    + HV  D +TG+S+G+ +V F +   A  A 
Sbjct: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM 229

Query: 392 VELDKQIFQGRLLHI 406
             +      GR + I
Sbjct: 230 NVMQGMPINGRAVRI 244

>Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement
          Length = 207

 Score = 41.2 bits (95), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLP-KKFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V NL F    +QI+ELFS  G +K + +   +F  +  GF FV +  PKEA +A++ L
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNTPKEALSAVKYL 107

Query: 809 QGVHLLGRRL 818
               L  R +
Sbjct: 108 SDTKLDDRHI 117

 Score = 32.0 bits (71), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/81 (20%), Positives = 40/81 (49%)

Query: 326 IQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPG 385
           ++K  ++  +++ N+ +  +E+   +LF+  G ++ + + LD       GF +V++  P 
Sbjct: 39  LRKSMSSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNTPK 98

Query: 386 DAANAYVELDKQIFQGRLLHI 406
           +A +A   L       R + I
Sbjct: 99  EALSAVKYLSDTKLDDRHISI 119

>Kwal_55.21960
          Length = 597

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAY 391
           TG++F+  I       +F + F+ +G + +  + LD  TG+S+GF ++ +  P DA +  
Sbjct: 292 TGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGRSRGFGFITYDTP-DAVDRV 350

Query: 392 VELDKQIFQGRLLHI 406
            E     F+G+ + I
Sbjct: 351 CENKFIEFKGKRIEI 365

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 31/48 (64%)

Query: 334 RLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMF 381
           ++F+  + +  TED+ +  F+ +G++ ++ +  D  TG+S+GF ++ F
Sbjct: 210 KMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTF 257

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 13/71 (18%)

Query: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRA-GESRRFAFVG 59
           + ++ + G+    TED LKD+F K              +TD+KI+++ A G SR F F+ 
Sbjct: 208 ICKMFIGGLNWETTEDNLKDYFSKY-----------GQVTDLKIMRDNATGRSRGFGFLT 256

Query: 60  FKSEEDAFDAV 70
           F +E  + D V
Sbjct: 257 F-AEASSVDEV 266

>AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073)
           [933 bp, 310 aa]
          Length = 310

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +FV  LN  T   +L   F  FG      V +    ++ +   S+G+GF EF T+     
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFG-----HVNSVEIIRDRDSGRSLGYGFVEFATKAACEL 286

Query: 711 VIDAMDGAVLDGHRIQLKLS 730
               MDGA++D  R+ +  S
Sbjct: 287 AYTKMDGALIDDRRVHVDFS 306

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 348 DFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHI 406
           D   +FA FG +  V +  D  +G+S G+ +V F        AY ++D  +   R +H+
Sbjct: 245 DLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKMDGALIDDRRVHV 303

>Kwal_27.11096
          Length = 201

 Score = 41.2 bits (95), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLP-KKFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V NL F    +QI+ELFS  G +K + +   +F  +  GF FV +  P+EA NA++ L
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNAVKYL 107

Query: 809 QGVHLLGRRLVM 820
               L  R + +
Sbjct: 108 SDTKLDDRNISL 119

 Score = 31.6 bits (70), Expect = 2.2,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 32/59 (54%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
           +  +++ N+ +  +E+   +LF+  G ++ + + LD       GF +V++  P +A NA
Sbjct: 45  SATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNA 103

 Score = 30.8 bits (68), Expect = 3.7,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +I+V NL+F T+ +++ E F   G  V+ ++    D     K    GF F  + T E+AL
Sbjct: 47  TIYVGNLSFYTSEEQIYELFSKSG--VIKRIIMGLD---RFKFTPCGFCFVIYNTPEEAL 101

Query: 710 AVIDAMDGAVLDGHRIQLKL 729
             +  +    LD   I L L
Sbjct: 102 NAVKYLSDTKLDDRNISLDL 121

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1, hypothetical
           start
          Length = 416

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV +LN     + L   F+ F  F+ A V       +     S G+GF  F  +E+A 
Sbjct: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMW-----DMQTGRSRGYGFVSFSNQEEAQ 201

Query: 710 AVIDAMDGAVLDGHRIQLKLS 730
             +DAM G  L G +I++  +
Sbjct: 202 KAMDAMQGKDLSGRQIRINWA 222

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 71/174 (40%), Gaps = 12/174 (6%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           ++V NL+ S T   L + F+  G   +  VK   D KN      + + F E+     A  
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGG--PIQNVKIIEDMKNE----YVNYAFVEYIRSHDANV 113

Query: 711 VIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSS 770
            +  ++G  L+   +++  +                   + V +L  +V+ + +   F  
Sbjct: 114 ALQTLNGVQLENKTLKINWAFETQQAAENDDTFN-----LFVGDLNVDVDDETLAGTFRE 168

Query: 771 FGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHA 823
           F       +        +RG+ FV F   +EA+ AM+ +QG  L GR++ +  A
Sbjct: 169 FPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAY 391
           T  LF+ ++     ++     F  F    + HV  D +TG+S+G+ +V F N  +A  A 
Sbjct: 145 TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAM 204

Query: 392 VELDKQIFQGRLLHI 406
             +  +   GR + I
Sbjct: 205 DAMQGKDLSGRQIRI 219

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V NL   +    + + F + G +++V++ +        +AFVE++   +A  A++ L 
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119

Query: 810 GVHLLGRRLVMQHAEEEPQDAE 831
           GV L  + L +  A E  Q AE
Sbjct: 120 GVQLENKTLKINWAFETQQAAE 141

>AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH]
           (1162117..1163397) [1281 bp, 426 aa]
          Length = 426

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 94/220 (42%), Gaps = 21/220 (9%)

Query: 591 PKNCFSREPE------GDETMVDEIVAQSTNVKEAR---TTGDEIMQTATAS-KPEXXXX 640
           PKN  +R+ E      G+   VD I+ +  + K AR   T+ +E++   T S K      
Sbjct: 40  PKNFNNRKIERFFHQCGEIRCVDTIMVKEKDAKIARIEFTSYNEVLAALTMSLKTVGCKE 99

Query: 641 XXXXXXXXXSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFA 700
                    +++V N      G+EL   F+  G F    V+      N+ +     F + 
Sbjct: 100 IVVEAMQGCTLWVTNFPPRYDGRELRRFFEDLG-FQCLSVRLPSLRYNAGRR----FAYV 154

Query: 701 EFKTREQALAVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPF-EV 759
           +  + + A A  + ++G  LDG+ + +KLS                   ++++ L F +V
Sbjct: 155 DLPSPQSADAAANTLNGMDLDGYNLVVKLSD-PESRAQRSDAGTIEKREVLIRGLDFIKV 213

Query: 760 ERKQIFELFSSFGQLKSVRLPKKFD----KSARGFAFVEF 795
             +++  L   FG+++ + +P   D    +  RGFAFV +
Sbjct: 214 TIEKLQGLVEPFGEVEKLIMPPSSDSADGRHNRGFAFVTY 253

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFG-QLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V N P   + +++   F   G Q  SVRLP     + R FA+V+   P+ A+ A   L
Sbjct: 110 LWVTNFPPRYDGRELRRFFEDLGFQCLSVRLPSLRYNAGRRFAYVDLPSPQSADAAANTL 169

Query: 809 QGVHLLGRRLVMQHAEEE 826
            G+ L G  LV++ ++ E
Sbjct: 170 NGMDLDGYNLVVKLSDPE 187

>Kwal_56.24709
          Length = 828

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%)

Query: 333 GRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYV 392
           G L++R I    T DD   +F+ FG +  + +  D+ +G S G+ ++ +     A+    
Sbjct: 241 GNLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIK 300

Query: 393 ELDKQIFQGRLLHI 406
           EL+  +  G  L I
Sbjct: 301 ELNGNLMNGSALFI 314

 Score = 37.4 bits (85), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 56/122 (45%), Gaps = 20/122 (16%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVAL------------------DTRTGKSKGF 376
           L+++++  +  ++DF + +  FGE+    +                    +   G SKG+
Sbjct: 612 LYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSKGY 671

Query: 377 AYVMFKNPGDAANAYVELDK-QIFQGRLLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKR 435
            +V FKNP DA+ A +  D+ Q+ +   L++    QK++  +   D  ++     RS  R
Sbjct: 672 GFVCFKNPLDASRAMMITDRYQVDENHTLYV-SFAQKRAKSISNADSISVANGNSRSASR 730

Query: 436 KA 437
           K+
Sbjct: 731 KS 732

>AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH]
           (736609..737409) [801 bp, 266 aa]
          Length = 266

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           ++L +I Y  TE     L +  G +  + +  D +TGKSKG+A++ FK+   +++A   L
Sbjct: 13  VYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAVRNL 72

Query: 395 DKQIFQGRLLHILPGEQKKSHRLDEFDLKN 424
           +      R L    G        +E+ L N
Sbjct: 73  NGYALGNRTLKC--GYTTGGGISEEYSLSN 100

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAME 806
           + + ++P++   +QI +L S+ G +  +++   FD     ++G+AF+EF     + +A+ 
Sbjct: 13  VYLGSIPYDQTEQQILDLCSNVGPVTGLKM--MFDPQTGKSKGYAFIEFKDLATSSSAVR 70

Query: 807 QLQGVHLLGRRL 818
            L G  L  R L
Sbjct: 71  NLNGYALGNRTL 82

>Scas_720.2
          Length = 245

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLP-KKFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V NL F    +QI+ELFS  G +K + +   +F  +  GF FV +   +EA NA++ L
Sbjct: 49  IYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNALKYL 108

Query: 809 QGVHLLGRRLVM 820
               L  + + +
Sbjct: 109 SDTKLDDKHITI 120

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 31/56 (55%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
           +++ N+ +  +E+   +LF+  G ++ + + LD       GF +V++ N  +A NA
Sbjct: 49  IYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNA 104

>Kwal_33.14810
          Length = 574

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSA-RGFAFVEFLLPKEAENAMEQL 808
           I++KN+PF ++++Q+ ++ +             FD    RG AF  F    E    +  L
Sbjct: 33  IVIKNIPFAIKKEQLLDVIAKMNLPLPYAFNYHFDNGVFRGLAFANFATTDETTQVVHML 92

Query: 809 QGVHLLGRRLVMQHAEEEPQ 828
            G  + GR+L +++ +  PQ
Sbjct: 93  NGKEIGGRKLRVEYKKMLPQ 112

>Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement
          Length = 281

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 344 ATEDDFRK-LFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGR 402
           A E   R+ L  PFG + +V V  +T TG+S+G +Y+ F+    A  A   LD + F   
Sbjct: 209 ADESTIRQELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETALNFLDGRGFMNL 268

Query: 403 LLH 405
           +LH
Sbjct: 269 ILH 271

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I +KNLP    R  I   FS  G +KS+ L     K    +AFV +    ++E A+++  
Sbjct: 305 IFIKNLPTITTRDDILNFFSEVGPIKSIYLSNA-TKVKYLWAFVTYKNSSDSEKAIKRYN 363

Query: 810 GVHLLGRRLVMQHAEEEPQDAEEQ 833
             +  G++L++  A    QD EE+
Sbjct: 364 NFYFRGKKLLVTRA----QDKEER 383

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 66/306 (21%), Positives = 121/306 (39%), Gaps = 50/306 (16%)

Query: 312 QQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTG 371
            +  KL + E +K +        LF+ ++  T TE+  + +F  +       V LD+ T 
Sbjct: 77  HKNGKLKSFESKKLVP-------LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTK 129

Query: 372 KSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHRLD---EFDLKNLPLK 428
           KS G  Y+ F++  +A  A  EL+     G+ + I+P  +  + R +        NLPL 
Sbjct: 130 KSLGHGYLNFEDKEEAEKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLN 189

Query: 429 KQRSLKRKANASHDTFSWN----SLYMNQDAVLGSVAAKLGVQKSDLIDATDASAAV-KQ 483
                 R     +DTFS      S  ++    +G V  +      ++I   + ++   K+
Sbjct: 190 NPLLTTR---VFYDTFSRYGKILSCKLDSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKK 246

Query: 484 ALAEAHVIGDVRKY--FE----------------------SKGMDLTKFEQFKSPSDRDD 519
            L   H   +VR    FE                      SKG D    ++ K+      
Sbjct: 247 ILCGIHFDKEVRSVPNFETQKSRLDAETIIEKEQSLNEKHSKGND----KESKNIYSSSQ 302

Query: 520 TVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTI----AVVQYRDATSARAAFSKL 575
             + +KN P  TT  ++ + F   G ++ + L  A  +    A V Y++++ +  A  + 
Sbjct: 303 NSIFIKNLPTITTRDDILNFFSEVGPIKSIYLSNATKVKYLWAFVTYKNSSDSEKAIKRY 362

Query: 576 SYKRFK 581
           +   F+
Sbjct: 363 NNFYFR 368

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 74/173 (42%), Gaps = 19/173 (10%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +F+ +L+ + T + L   FK +  FV A+V      K S     +G G+  F+ +E+A  
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKS-----LGHGYLNFEDKEEAEK 147

Query: 711 VIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFE---VERKQIFEL 767
            ++ ++   ++G  I++  S R                 +   NLP     +  +  ++ 
Sbjct: 148 AMEELNYTKVNGKEIRIMPSLR------NTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDT 201

Query: 768 FSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVM 820
           FS +G++ S +L      S +   FV F   K A N ++        G++++ 
Sbjct: 202 FSRYGKILSCKL-----DSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILC 249

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F++N+    T DD    F+  G ++ ++++  T+      +A+V +KN  D+  A    
Sbjct: 305 IFIKNLPTITTRDDILNFFSEVGPIKSIYLSNATKV--KYLWAFVTYKNSSDSEKAIKRY 362

Query: 395 DKQIFQGRLLHILPGEQK 412
           +   F+G+ L +   + K
Sbjct: 363 NNFYFRGKKLLVTRAQDK 380

>KLLA0E19943g 1766853..1768631 weakly similar to sp|P34217
           Saccharomyces cerevisiae YBL051c singleton, hypothetical
           start
          Length = 592

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSA-RGFAFVEFLLPKEAENAMEQL 808
           I++KN+PF ++++Q+ E+ +             FD    RG AF  F   +E    ++ L
Sbjct: 39  IVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEETTTVVQSL 98

Query: 809 QGVHLLGRRLVMQHAEEEPQ 828
            G  + GR+L +++ +  PQ
Sbjct: 99  NGKEIGGRKLRVEYKKMLPQ 118

>AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH]
           complement(345624..346280) [657 bp, 218 aa]
          Length = 218

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLP-KKFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V NL F    +Q++ELFS  G ++ + +   +F  +  GF F+ +  P+EA  A++ L
Sbjct: 48  IYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQEALAALKYL 107

Query: 809 QGVHLLGRRLVM 820
               L  R + +
Sbjct: 108 SKTKLDDREITI 119

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 41/81 (50%)

Query: 326 IQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPG 385
           ++K   +  +++ N+ +  +E+   +LF+  G +E++ + LD       GF +++++ P 
Sbjct: 39  LRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQ 98

Query: 386 DAANAYVELDKQIFQGRLLHI 406
           +A  A   L K     R + I
Sbjct: 99  EALAALKYLSKTKLDDREITI 119

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +I+V NL+F T+ ++L E F   G   + ++    D     K    GF F  ++T ++AL
Sbjct: 47  TIYVGNLSFYTSEEQLYELFSKCGS--IEKIIMGLD---RFKFTPCGFCFIIYQTPQEAL 101

Query: 710 AVIDAMDGAVLDGHRIQLKL 729
           A +  +    LD   I + L
Sbjct: 102 AALKYLSKTKLDDREITIDL 121

>YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of
           nuclear cap-binding protein complex [627 bp, 208 aa]
          Length = 208

 Score = 40.0 bits (92), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLP-KKFDKSARGFAFVEFLLPKEAENAMEQL 808
           I V NL F    +QI+ELFS  G +K + +   +F  +  GF F+ +  P EA NA++ L
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALKYL 107

Query: 809 QGVHL 813
               L
Sbjct: 108 SDTKL 112

 Score = 30.4 bits (67), Expect = 5.2,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 31/56 (55%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
           +++ N+ +  +E+   +LF+  G ++ + + LD       GF ++++  P +A NA
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNA 103

>KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I singleton, hypothetical start
          Length = 258

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           ++L +I Y  TE     L    G +  + +  D  TGKSKG+A++ FK+   +A+A   L
Sbjct: 10  VYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAVRNL 69

Query: 395 DKQIFQGRLL 404
           +      R L
Sbjct: 70  NGYTLGSRSL 79

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 40/72 (55%), Gaps = 5/72 (6%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAME 806
           + + ++P++   +QI +L  + G + ++++   FD +   ++G+AF+EF     + +A+ 
Sbjct: 10  VYLGSIPYDQTEQQILDLCQTIGPVTAMKM--MFDPTTGKSKGYAFIEFKDLATSASAVR 67

Query: 807 QLQGVHLLGRRL 818
            L G  L  R L
Sbjct: 68  NLNGYTLGSRSL 79

>Kwal_0.370
          Length = 560

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 63/149 (42%), Gaps = 19/149 (12%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           S+F+ +L+ + T K L + F+ F   +  ++       +S   +S+G+G+  F + + A 
Sbjct: 16  SLFIGDLDPNVTEKMLNDTFRVFPSLISVKICV-----DSETGISLGYGYLNFYSSKDAE 70

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFE---VERKQIFE 766
             I+      L G  +++  S R                 +   NLP E   +  +  +E
Sbjct: 71  TAIETFSYVNLFGREVRIMPSMR------NSYFRKNIGTNVFFSNLPLEQPALTTRVFYE 124

Query: 767 LFSSFGQLKSVRLPKKFDKSARGFAFVEF 795
            F  +G++ S +L ++     +   FV F
Sbjct: 125 TFREYGKVLSCKLDRR-----KNIGFVYF 148

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I VKNLPF +  + +   FS  G +KSV    K +     + FV +    +   A++ L 
Sbjct: 227 IHVKNLPFNICNEDLLNYFSRIGPVKSV-FTSKLEAYRSSWGFVTYKKGCDTRKALDSLN 285

Query: 810 GVHLLGRRLVMQHA 823
           G   + RRL +  A
Sbjct: 286 GAIFMDRRLEVNKA 299

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 112/307 (36%), Gaps = 56/307 (18%)

Query: 327 QKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGD 386
           QK+ +   LF+ ++    TE      F  F  L  V + +D+ TG S G+ Y+ F +  D
Sbjct: 12  QKVSS---LFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKD 68

Query: 387 AANAYVELDKQIFQGRLLHILPGEQKKSHRLD---EFDLKNLPLKKQRSLKRKANASHDT 443
           A  A          GR + I+P  +    R +        NLPL++     R     ++T
Sbjct: 69  AETAIETFSYVNLFGREVRIMPSMRNSYFRKNIGTNVFFSNLPLEQPALTTR---VFYET 125

Query: 444 FSWNSLYMNQDAVLGSV-AAKLGVQKSDLIDATDASAAVKQALAEA-------------- 488
           F             G V + KL  +K+      ++ AA ++A+A                
Sbjct: 126 FR----------EYGKVLSCKLDRRKNIGFVYFESDAAARKAIASYNNKEYYGNIVTCGL 175

Query: 489 HVIGDVRKY--FESKGMDLTKFEQFKSPSDRDDTVLL----------------VKNFPFG 530
           H   D+R+   FE +   L      K     ++ V L                VKN PF 
Sbjct: 176 HFDKDIRRSPEFEKRRSRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSIHVKNLPFN 235

Query: 531 TTHSELADLFLPFGKLQRLLLPPAQ----TIAVVQYRDATSARAAFSKLSYKRFKDGILY 586
             + +L + F   G ++ +     +    +   V Y+     R A   L+   F D  L 
Sbjct: 236 ICNEDLLNYFSRIGPVKSVFTSKLEAYRSSWGFVTYKKGCDTRKALDSLNGAIFMDRRLE 295

Query: 587 LEKGPKN 593
           + K  KN
Sbjct: 296 VNKALKN 302

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQL 808
           + + +L   V  K + + F  F  L SV++    +   + G+ ++ F   K+AE A+E  
Sbjct: 17  LFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIETF 76

Query: 809 QGVHLLGR 816
             V+L GR
Sbjct: 77  SYVNLFGR 84

>Kwal_55.20903
          Length = 147

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I ++++P ++    + + F   G +  + +  K  KS  G+A+VEF     AE A+E L 
Sbjct: 61  IFLRDIPSDISLPSLEDHFRDMGSICRITMISKQRKSGTGYAYVEFATKASAERALE-LD 119

Query: 810 GVHLLGRRL 818
           G  L G +L
Sbjct: 120 GSILRGHKL 128

>ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH]
           complement(287620..288234) [615 bp, 204 aa]
          Length = 204

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 2/89 (2%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V NL  +V ++ ++ELF     +  +R PK K  +  +GFAFVE     + + A++ L
Sbjct: 9   VYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFAIKSL 68

Query: 809 QG-VHLLGRRLVMQHAEEEPQDAEEQIAR 836
              V L G+ L ++   E  +++    AR
Sbjct: 69  NNTVSLFGKVLKVRRTLENAKNSAPVFAR 97

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 80/188 (42%), Gaps = 16/188 (8%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +++V NL+   + + L E F       VA V     PK+  K    GF F E  +     
Sbjct: 8   TVYVGNLDPQVSKELLYELFVQ-----VAPVSRIRYPKDKVKQEHQGFAFVELFSEADCD 62

Query: 710 AVIDAMDGAV-LDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELF 768
             I +++  V L G  +++    R                 + VKNL   ++  Q+ +LF
Sbjct: 63  FAIKSLNNTVSLFGKVLKV----RRTLENAKNSAPVFARAKLFVKNLDSTIDAVQLQKLF 118

Query: 769 SSFGQLKSVRLPKKF---DKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEE 825
             FG L   + P+ F   D + R  A+V F   + ++ A+E+L    +  + + + +A +
Sbjct: 119 GKFGPL--AKPPQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISIDYAFK 175

Query: 826 EPQDAEEQ 833
           E +  E+ 
Sbjct: 176 EGKAGEKH 183

>CAGL0D05236g 499006..500337 weakly similar to sp|P43607
           Saccharomyces cerevisiae YFR032c, hypothetical start
          Length = 443

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 7/82 (8%)

Query: 331 ATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDT------RTGKSKGFAYVMFKNP 384
           +  R+++ N+ Y+++E+D R+    F     V +   T         +S G AYV F + 
Sbjct: 2   SVSRIYIANVSYSSSEEDLREFLKDFN-FSSVLIPCHTVRRFRRNEARSFGIAYVDFTSS 60

Query: 385 GDAANAYVELDKQIFQGRLLHI 406
            +A  A  EL+ + F GR+L +
Sbjct: 61  EEAVRAVEELNGKEFGGRVLRV 82

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 9/86 (10%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLP----KKFDKS-AR--GFAFVEFLLPKEAE 802
           I + N+ +    + + E    F    SV +P    ++F ++ AR  G A+V+F   +EA 
Sbjct: 6   IYIANVSYSSSEEDLREFLKDF-NFSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEEAV 64

Query: 803 NAMEQLQGVHLLGRRL-VMQHAEEEP 827
            A+E+L G    GR L V  H   +P
Sbjct: 65  RAVEELNGKEFGGRVLRVRTHNPYQP 90

>Kwal_14.1851
          Length = 535

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 118/301 (39%), Gaps = 45/301 (14%)

Query: 316 KLDTTEEEKFIQKIEATG--RLFLRNILYTATEDDFRKLFAP-FGELEEVHVALDTRTGK 372
           +L+       +  I +T    LF+ ++  TATE     LF   F  ++ V V  D  TG 
Sbjct: 155 RLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGA 214

Query: 373 SKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHI------------LPGEQKKSHRLDEF 420
           S+ F +V F +  +   A VE++    QGR L +            L     +S + D+F
Sbjct: 215 SRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYATPRNNVMWQLTQNSHQSQQNDQF 274

Query: 421 DLKN--LPLKKQRSLKRKANASHDTFSWN--SLYMNQDAVLG------------SVAAKL 464
            L+N  LP  + RS  +  +  H     N   ++ +Q A LG            + A   
Sbjct: 275 -LQNDQLPHFQHRSQVQSHHQHHPRHHLNLSQIHQHQHASLGFGSEPAAPSQYQTSAPAF 333

Query: 465 GVQKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTK------FEQFKSP---- 514
                 +  +  + A +    A + V  ++  +  S   D++         Q  +P    
Sbjct: 334 HPNNYQMTQSNYSQAPLLMKTANSLVNNNLINFPAS---DVSSDHVPAFMAQPTAPRSAF 390

Query: 515 SDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSK 574
           ++ ++T + +       +  +L  LF PFG +  + +PP +    V+Y     A AA   
Sbjct: 391 TNPNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKGCGFVKYAYRIDAEAAIQG 450

Query: 575 L 575
           +
Sbjct: 451 M 451

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + +  L  ++  +Q+  LFS FG + +V++P       +G  FV++    +AE A++ +Q
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAIINVKIPP-----GKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 810 GVHLLGRRL 818
           G  + G  +
Sbjct: 453 GFIVGGNPI 461

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 11/80 (13%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++F+  L    + ++L   F  FG  +   VK  P           G GF ++  R  A 
Sbjct: 397 TVFIGGLTSQISERQLHSLFSPFGAII--NVKIPP---------GKGCGFVKYAYRIDAE 445

Query: 710 AVIDAMDGAVLDGHRIQLKL 729
           A I  M G ++ G+ I+L  
Sbjct: 446 AAIQGMQGFIVGGNPIRLSW 465

>AEL217W [2289] [Homologous to ScYGR250C - SH]
           complement(225217..227721) [2505 bp, 834 aa]
          Length = 834

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%)

Query: 333 GRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYV 392
           G L++R I    + DD   +F+ FG +  + + +D  T +S G+ ++ +     AA    
Sbjct: 217 GNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIK 276

Query: 393 ELDKQIFQGRLLHI 406
           EL+  +  G  L I
Sbjct: 277 ELNGNLMNGSPLFI 290

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 17/88 (19%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHV--------------AL-DTRTGKSKGFAYV 379
           L++++I  +  ++D    ++ +GE+    +              AL D   G S+G+ +V
Sbjct: 601 LYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRGYGFV 660

Query: 380 MFKNPGDAANAYVELDKQIFQGRLLHIL 407
            FKNP DA+ A +  D+  FQ    H+L
Sbjct: 661 CFKNPLDASRAMMATDR--FQVGTNHVL 686

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 60/141 (42%), Gaps = 27/141 (19%)

Query: 312 QQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTG 371
           QQE +L  T             RLF+R       E +  ++F PFG ++EV +       
Sbjct: 97  QQEGELSNT-------------RLFVRPFPLDVQESELNEIFGPFGAMKEVKIL------ 137

Query: 372 KSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHRLDEFDLKNLP----L 427
              GFA+V F+    A+ A  E++ + F  + L ++    K   +     LKNLP     
Sbjct: 138 --NGFAFVEFEEAESASKAIEEVNGKTFANQPLEVM--FSKMPVKRFRITLKNLPEGCSW 193

Query: 428 KKQRSLKRKANASHDTFSWNS 448
           ++ + L R+ N      S NS
Sbjct: 194 QELKDLARENNLETTFSSVNS 214

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 7/61 (11%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V+  P +V+  ++ E+F  FG +K V++         GFAFVEF   + A  A+E++ 
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKI-------LNGFAFVEFEEAESASKAIEEVN 159

Query: 810 G 810
           G
Sbjct: 160 G 160

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 22/93 (23%)

Query: 519 DTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAA------- 571
           +T L V+ FP     SEL ++F PFG ++ + +      A V++ +A SA  A       
Sbjct: 104 NTRLFVRPFPLDVQESELNEIFGPFGAMKEVKI--LNGFAFVEFEEAESASKAIEEVNGK 161

Query: 572 ----------FSKLSYKRFKDGILYLEKGPKNC 594
                     FSK+  KRF+   + L+  P+ C
Sbjct: 162 TFANQPLEVMFSKMPVKRFR---ITLKNLPEGC 191

>CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces
           cerevisiae YIL061c SNP1 U1 small nuclear
           ribonucleoprotein, hypothetical start
          Length = 299

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 44/77 (57%), Gaps = 9/77 (11%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENA----- 804
           + V  LP++ +  Q+ ++F+ +G++  VR+ +     +RG+AFV F   KE ++A     
Sbjct: 117 VFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLF---KETDSARVCTR 173

Query: 805 -MEQLQGVHLLGRRLVM 820
            +   +G+ + GRR ++
Sbjct: 174 DIGVHRGIQINGRRCIV 190

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFK 382
           +F+  + Y   E   +K+FA +GE+  V V  D +  KS+G+A+V+FK
Sbjct: 117 VFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRD-KQNKSRGYAFVLFK 163

>Scas_643.16
          Length = 448

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFK 382
           +F+ N+ +   E++    F   GE+E V +  D +T   KGFAYV FK
Sbjct: 277 IFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFK 324

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFK 703
           SIFV NL+F    + L   FK+ G   +  V+   DPK +   +  GF + +FK
Sbjct: 276 SIFVGNLDFEEDEENLWNHFKSCGE--IEYVRIIRDPKTN---MGKGFAYVQFK 324

>Sklu_905.1 YMR268C, Contig c905 196-1743
          Length = 515

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 86/193 (44%), Gaps = 11/193 (5%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +++V N   ++T + L   F  +GG V++ V+      +SN+     F + +F + ++A 
Sbjct: 184 TLWVTNFAPNSTVETLKALFSQYGGSVLS-VRLPSLKFDSNRR----FAYIDFASSDEAN 238

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFS 769
             +  ++    DG+ + +K S+                   I K   ++V   ++ +L  
Sbjct: 239 TAMSKLNNTSHDGYILVVKKSNPHEKSKRTDAATLEKREIFIRKLDFYKVSLSKLTKLVE 298

Query: 770 SFGQLKSVRLPKKFD-----KSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAE 824
            +G ++ V +P   D     K   GFAFV +   + A+ A+E    V   GR L +  A+
Sbjct: 299 KYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKALELNMSV-FEGRVLAVSIAD 357

Query: 825 EEPQDAEEQIARM 837
            +P    +++ R+
Sbjct: 358 RKPYLERQEVKRI 370

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 335 LFLRNI-LYTATEDDFRKLFAPFGELEEVHVALDTRTGKSK----GFAYVMFKNPGDAAN 389
           +F+R +  Y  +     KL   +G +E V +     +  S     GFA+V + N   A  
Sbjct: 278 IFIRKLDFYKVSLSKLTKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQK 337

Query: 390 AYVELDKQIFQGRLLHILPGEQK 412
           A +EL+  +F+GR+L +   ++K
Sbjct: 338 A-LELNMSVFEGRVLAVSIADRK 359

>Scas_598.1
          Length = 516

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 334 RLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFK 382
           +LF+  + +  TED  +  F+ +G + ++ +  D  TG+S+GF ++ F+
Sbjct: 201 KLFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFE 249

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 76/181 (41%), Gaps = 28/181 (15%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +F+  LN+ TT  +L + F  +G  V  ++      K++    S GFGF  F+       
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIM-----KDNATGRSRGFGFLTFELSSSVDE 256

Query: 711 VIDA---MDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFEL 767
           V+     +DG V+D  R   +                     I V  +  +V  K+  E 
Sbjct: 257 VVKTQHILDGKVIDPKRAIPR-------------EEQDKTGKIFVGGIGPDVRPKEFEEF 303

Query: 768 FSSFG-----QLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQH 822
           F+ +G     QL  + L K   +S RGF F+ +    EA + + Q + +   G+++ ++ 
Sbjct: 304 FAQWGTIIDAQLMLLMLDKDTGRS-RGFGFITYDS-SEAVDRVCQNKYIDFKGKQIEIKR 361

Query: 823 A 823
           A
Sbjct: 362 A 362

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 12/62 (19%)

Query: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRA-GESRRFAFVG 59
             ++ + G+    TEDKLKD+F K             ++ D+KI+K+ A G SR F F+ 
Sbjct: 199 CCKLFIGGLNWETTEDKLKDYFSKY-----------GNVVDLKIMKDNATGRSRGFGFLT 247

Query: 60  FK 61
           F+
Sbjct: 248 FE 249

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVAL---DTRTGKSKGFAYVMFKNPGDAA 388
           TG++F+  I       +F + FA +G + +  + L   D  TG+S+GF ++ +    D++
Sbjct: 283 TGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLLMLDKDTGRSRGFGFITY----DSS 338

Query: 389 NAY--VELDKQI-FQGRLLHI 406
            A   V  +K I F+G+ + I
Sbjct: 339 EAVDRVCQNKYIDFKGKQIEI 359

>CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor,
           hypothetical start
          Length = 381

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 58/124 (46%), Gaps = 10/124 (8%)

Query: 688 NSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXX 747
           NSN+     F + +    E     I  ++G  ++G+++ +K S+                
Sbjct: 138 NSNRR----FAYVDLPNMESLDKAIQLLNGKDINGYKLVVKKSN-PENRDKRSDAPVLER 192

Query: 748 XXIIVKNLPFEVERKQ-IFELFSSFGQLKSVRLPKK----FDKSARGFAFVEFLLPKEAE 802
             II++NLP  +  K  + ++F  +G +  +R+PKK          G AFV +  P++A+
Sbjct: 193 REIIIRNLPKTMLVKDTLLDIFKKYGAIDDLRIPKKQLEMLSDLNHGCAFVVYTNPEDAK 252

Query: 803 NAME 806
           +A+E
Sbjct: 253 SALE 256

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLK-SVRLPKKFDKSARGFAFVEFLLPKEAENAMEQL 808
           + + N P   +++ I  +F     +  +VRLP     S R FA+V+    +  + A++ L
Sbjct: 102 VWMTNYPPTFQQRDIRNIFKDHKIVALNVRLPSLRFNSNRRFAYVDLPNMESLDKAIQLL 161

Query: 809 QGVHLLGRRLVMQHAEEEPQD 829
            G  + G +LV++ +  E +D
Sbjct: 162 NGKDINGYKLVVKKSNPENRD 182

>Kwal_55.20414
          Length = 284

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGF-VVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           I+V NL+FSTT +EL+E  K +    V+   +T    +NS     +G G+A+F++ + A 
Sbjct: 19  IYVSNLDFSTTEEELSEFLKEYNVVSVLIPSQTIRGFRNST-VRPLGIGYADFQSAQDAQ 77

Query: 710 AVIDAMDGAVLDGHRIQLKL 729
                ++G  L   ++++K+
Sbjct: 78  NAAQNLNGKQLKDRKLKIKI 97

>ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH]
           complement(854587..855867) [1281 bp, 426 aa]
          Length = 426

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+ N+ +  +E+   K F   G +E V +  D +T   KGFAYV F +      A +  
Sbjct: 261 VFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKALLLN 320

Query: 395 DKQ--IFQGRLLHI 406
           DK+  + +GR L +
Sbjct: 321 DKKMAVGKGRKLRV 334

>Kwal_55.20972
          Length = 135

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQL 808
           I V  L  ++    I  +FS +G    ++L +  +   ++GFA++++   +    A++ L
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 809 QGVHLLGRRLVMQHAEEEPQDAEEQIARMTKK 840
            GV + GR + + H    P+D +   AR  +K
Sbjct: 96  NGVKIAGRSIRVDHTMFTPRDDDYDYARAVEK 127

 Score = 32.0 bits (71), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 50/108 (46%), Gaps = 2/108 (1%)

Query: 299 DNVESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGE 358
           + + S ++    E ++  L  T    F  K +A   +F+  +    TE D   +F+ +G 
Sbjct: 2   NQIRSIQNLSFRELEQGILSPTASWHFEYKDQAY--IFVGGLHKDLTEGDILTIFSQYGI 59

Query: 359 LEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHI 406
             ++ +  D  +G+SKGFAY+ +++      A   L+     GR + +
Sbjct: 60  PVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNLNGVKIAGRSIRV 107

>Kwal_27.12337
          Length = 209

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V N+  +V R+ ++ELF     +  +R PK K  ++ +GFAFVEF   ++ E A + L
Sbjct: 12  VYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKCL 71

Query: 809 -QGVHLLGRRLVMQHA 823
              + L  R L ++ A
Sbjct: 72  NNSLRLYDRTLKVRKA 87

>Scas_621.16
          Length = 314

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           ++L +I Y  TE+    L    G +  + +  D +TGKSKG+A++ FK+   +A+A   L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 395 DKQIFQGRLL 404
           +      R L
Sbjct: 106 NGYQLGSRFL 115

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAME 806
           + + ++P++   +QI +L ++ G +  + L   FD     ++G+AF+EF   + + +A+ 
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPV--INLKMMFDPQTGKSKGYAFIEFKDLETSASAIR 103

Query: 807 QLQGVHLLGRRL 818
            L G  L  R L
Sbjct: 104 NLNGYQLGSRFL 115

>ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH]
           complement(1034093..1034902) [810 bp, 269 aa]
          Length = 269

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 350 RKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHI 406
           +KL +PF  +  V V  +  TG+S+G AYV F +  DA  A   L  + F   +L +
Sbjct: 206 QKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHGRGFMNLILQV 262

>YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component of
           pre-mRNA cleavage and polyadenylation factor I (CFI),
           involved in poly(A) site choice, interacts with Rna14p,
           Pap1p, and Pcf11p, contains one RNA recognition (RRM)
           domain [891 bp, 296 aa]
          Length = 296

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           ++L +I Y  TE+    L +  G +  + +  D +TG+SKG+A++ F++   +A+A   L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 395 DKQIFQGRLL 404
           +      R L
Sbjct: 80  NGYQLGSRFL 89

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAME 806
           + + ++P++   +QI +L S+ G +  + L   FD     ++G+AF+EF   + + +A+ 
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPV--INLKMMFDPQTGRSKGYAFIEFRDLESSASAVR 77

Query: 807 QLQGVHLLGRRL 818
            L G  L  R L
Sbjct: 78  NLNGYQLGSRFL 89

>Scas_665.4
          Length = 219

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V N+  +V ++Q++ELF     +  +R PK K  +  +G+AF+EF   K+ +  ++ +
Sbjct: 12  VYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQVM 71

Query: 809 QG-VHLLGRRLVMQHAEEEP 827
              V L  R L ++ + + P
Sbjct: 72  NNTVALYDRFLKVRQSVQNP 91

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 77/189 (40%), Gaps = 20/189 (10%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +++V N++   T ++L E F       V+ +     PK+    +  G+ F EF T +   
Sbjct: 11  TVYVGNIDPKVTKEQLYELF-----IQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQ 65

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRX----------XXXXXXXXXXXXXXXXIIVKNLPFEV 759
            VI  M+  V    R  LK+                              + VKNL   +
Sbjct: 66  YVIQVMNNTVALYDRF-LKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESI 124

Query: 760 ERKQIFELFSSFGQLKSVRLPKKFDKSARGF--AFVEFLLPKEAENAMEQLQGVHLLGRR 817
           E  Q+ +LF  FG L   + P+ F  S      A++ F   + ++ A+ +L    ++ +R
Sbjct: 125 ENPQLIKLFQKFGPL--FKDPEIFFLSNGKLRCAYIYFKFYENSDMAIAKLNNELIVNKR 182

Query: 818 LVMQHAEEE 826
           + + +A +E
Sbjct: 183 INVDYAFKE 191

>Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement
          Length = 257

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYV 392
           ++L +I Y  TE+    L +  G +  + +  D +TGKSKG+A+V +K+  +A+N+ V
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDL-EASNSAV 71

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 41/72 (56%), Gaps = 5/72 (6%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAME 806
           + + ++P++   +QI +L S+ G + ++++   FD     ++G+AFVE+   + + +A+ 
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKM--MFDPQTGKSKGYAFVEYKDLEASNSAVR 72

Query: 807 QLQGVHLLGRRL 818
            L G  L  R L
Sbjct: 73  NLNGYQLGNRFL 84

>AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C
           (GBP2) - SH] complement(309542..310555) [1014 bp, 337
           aa]
          Length = 337

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           IFV NL +S + + L + FK     + A V    D        S GFG     TRE  +A
Sbjct: 109 IFVANLPYSISWQTLKDMFKECSEVIHADVSVDAD------GYSRGFGTVYVTTRENQIA 162

Query: 711 VIDAMDGAVLDGHRIQLK 728
            I+  +G  L+G  ++++
Sbjct: 163 AIERWNGYELEGRILEVR 180

 Score = 36.6 bits (83), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 34/74 (45%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I  +N+P       +++LF + G++    L    + +  G +  EF    +A+  +E+L 
Sbjct: 261 IYCENMPLATAESDLYDLFETAGKVLRANLQYDSEGNPTGSSVCEFETVADAQECIERLN 320

Query: 810 GVHLLGRRLVMQHA 823
             H  G  L M +A
Sbjct: 321 NYHYGGCDLKMSYA 334

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 42/220 (19%), Positives = 82/220 (37%), Gaps = 41/220 (18%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+ N+ Y+ +    + +F    E+    V++D   G S+GF  V      +   A    
Sbjct: 109 IFVANLPYSISWQTLKDMFKECSEVIHADVSVDA-DGYSRGFGTVYVTTRENQIAAIERW 167

Query: 395 DKQIFQGRLLHILPG---EQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYM 451
           +    +GR+L +  G   +   + R D +  K +P                ++ ++  Y 
Sbjct: 168 NGYELEGRILEVREGKGTDVGSAGRGDSYVPKQIP----------------SYDYDGEYR 211

Query: 452 NQDAVLGSVAAKLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTKFEQF 511
             +             +++L  + +AS +V          G     +E       +F   
Sbjct: 212 GTEV------------RAELPHSENASVSVS---------GKASPEYEQYTPSDVEFTSK 250

Query: 512 KSPSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLL 551
            +P    + ++  +N P  T  S+L DLF   GK+ R  L
Sbjct: 251 AAPGGAKNRIIYCENMPLATAESDLYDLFETAGKVLRANL 290

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 2/72 (2%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+ N+ Y  T +D R+LF   G +  V   + T  G  +G   V + N  D   A    
Sbjct: 9   VFIGNLTYDTTPEDLRQLFGEVGHV--VRADIITSRGHHRGMGTVEYTNAQDVDEAIRRF 66

Query: 395 DKQIFQGRLLHI 406
           +   F  R L +
Sbjct: 67  NGMDFMHRELFV 78

>KLLA0C08019g complement(704199..705104) some similarities with
           sp|Q00916 Saccharomyces cerevisiae YIL061c SNP1 U1 small
           nuclear ribonucleoprotein singleton, hypothetical start
          Length = 301

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+  + Y   E + +K F  +G++E   +  D + GKS+G+ +V F +  D+   + EL
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRD-QDGKSRGYGFVQFTSYEDSKQCFREL 175

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQL- 808
           + V  L + V+  ++ + F  +G ++S R+ +  D  +RG+ FV+F   ++++    +L 
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFRELG 176

Query: 809 --QGVHLLGRRLVM 820
             +G+ ++GR  ++
Sbjct: 177 VRKGIEIMGRTSIV 190

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 59/136 (43%), Gaps = 8/136 (5%)

Query: 685 DPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXX 744
           +P  S+   + G+ F EF  +      + A +  +  G R+ +  ++             
Sbjct: 93  NPNKSHAVNNSGYCFVEFPNQ------MAASNALMKSGLRVPMDSNYALKLNWASFATAP 146

Query: 745 XXXXXIIVKNLPFEVERKQIFELFSS--FGQLKSVRLPKKFDKSARGFAFVEFLLPKEAE 802
                + V +L   V   Q+FELF S     L +  +  +F   ++G+ FV+F+   E +
Sbjct: 147 GSEFTLFVGDLAPNVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQ 206

Query: 803 NAMEQLQGVHLLGRRL 818
            A+ ++QG  L GR +
Sbjct: 207 RALVEMQGTFLNGRAI 222

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%)

Query: 515 SDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSK 574
           +D ++T + +       T  EL   F PFG++  + +P  +    VQY D  SA  A SK
Sbjct: 311 TDPNNTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKGCGFVQYVDRISAETAISK 370

Query: 575 L 575
           +
Sbjct: 371 M 371

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 5/69 (7%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + +  L   +   ++   F  FGQ+  V++P       +G  FV+++    AE A+ ++Q
Sbjct: 318 VFIGGLSTLITEDELRSYFQPFGQIVYVKIPV-----GKGCGFVQYVDRISAETAISKMQ 372

Query: 810 GVHLLGRRL 818
           G  +   R+
Sbjct: 373 GFPIGNSRI 381

>AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH]
           (1446842..1447978) [1137 bp, 378 aa]
          Length = 378

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV +LN     + L+  FK F  F+ A V       +     S G+GF  F  +E+A 
Sbjct: 123 NLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMW-----DMQSGRSRGYGFVSFGEQEEAQ 177

Query: 710 AVIDAMDGAVLDGHRIQLKLS 730
             +DA  G  L+G  I++  +
Sbjct: 178 KAMDAKQGFNLNGRAIRVNWA 198

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 74/182 (40%), Gaps = 14/182 (7%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           ++V NL+ +     L + F+  G   +A VK   D  N        + F E++    A  
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGG--PIANVKVLVDKNNEEAN----YAFVEYRQPRDANV 90

Query: 711 VIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSS 770
               +DG  ++ + I++  + +                 + V +L  +V+ + +   F  
Sbjct: 91  AFQTLDGKQIENNVIKINWAFQSQQVSSDDTFN------LFVGDLNVDVDDETLSSTFKE 144

Query: 771 FGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQLQGVHLLGRRL-VMQHAEEEPQ 828
           F       +        +RG+ FV F   +EA+ AM+  QG +L GR + V   A+ E Q
Sbjct: 145 FPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAKRESQ 204

Query: 829 DA 830
            A
Sbjct: 205 HA 206

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 25/50 (50%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMF 381
           T  LF+ ++     ++     F  F    + HV  D ++G+S+G+ +V F
Sbjct: 121 TFNLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMWDMQSGRSRGYGFVSF 170

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           L++ N+  T  E   ++ F   G +  V V +D +  +   +A+V ++ P DA  A+  L
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYRQPRDANVAFQTL 95

Query: 395 DKQIFQGRLLHI 406
           D +  +  ++ I
Sbjct: 96  DGKQIENNVIKI 107

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 11/85 (12%)

Query: 4   VIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFKSE 63
           + V  + K + E  LK +F            +   + +VK+L ++  E   +AFV ++  
Sbjct: 37  LYVGNLDKTINEATLKQYF-----------QVGGPIANVKVLVDKNNEEANYAFVEYRQP 85

Query: 64  EDAFDAVNYFDQSFIDTSKIEVSMA 88
            DA  A    D   I+ + I+++ A
Sbjct: 86  RDANVAFQTLDGKQIENNVIKINWA 110

>Kwal_33.13496
          Length = 330

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%)

Query: 348 DFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHI 406
           D   +F+ FG +E+V +  D  TG S  + ++ F N      AY +++  +   R +H+
Sbjct: 262 DLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKMEGVLIDDRRIHV 320

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +F+  LN  T  K+L   F  FG   + +V+   D +      S+ +GF EF  +    A
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFG--TIEKVEIVRDKETGA---SLHYGFIEFTNKSSCEA 303

Query: 711 VIDAMDGAVLDGHRIQLKLS 730
               M+G ++D  RI +   
Sbjct: 304 AYSKMEGVLIDDRRIHVDFC 323

>ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH]
           (708437..709411) [975 bp, 324 aa]
          Length = 324

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 8/97 (8%)

Query: 320 TEEEKFIQKIEATGR-LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAY 378
           +++ K  +++E   R +F+ +I   AT +   + F   G +  + +  + +TG+ KG+AY
Sbjct: 69  SKDRKHAKQVELDSRSVFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAY 128

Query: 379 VMFKNPGDAANAYVELDKQIFQGRLLHI------LPG 409
           + F++      A ++LD   F G  + +      LPG
Sbjct: 129 IQFESISSVEKA-LQLDGSSFNGNTISVAKKRTNLPG 164

>Kwal_27.11447
          Length = 439

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 66/169 (39%), Gaps = 13/169 (7%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           ++V NL+ + T   L + F+  G   +A VK   D  N        + F EF     A  
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQVGG--AIANVKILMDKNNKEAN----YAFVEFHQPHDASV 117

Query: 711 VIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSS 770
               +DG  ++ H I++  + +                 + V +L  +V+ + +   F  
Sbjct: 118 AFQTLDGKQIENHVIKINYAFQSQQVSSEDTFN------LFVGDLNVDVDDETLANTFKH 171

Query: 771 FGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQLQGVHLLGRRL 818
                   +        +RG+ FV F    +A+ AME+ QG  + GR +
Sbjct: 172 VPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAI 220

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 57/135 (42%), Gaps = 24/135 (17%)

Query: 295 IREEDNVESTEDPESTEQQESKLDT-TEEEKFIQKIEATGR------------------- 334
           + EE      E PE  EQQ +   + TE E+  Q+ +  G+                   
Sbjct: 1   MAEETPETRPEQPEIAEQQGTAGSSQTEAEQPSQEPQTAGKAAEPAVTPANATRGGRETS 60

Query: 335 ---LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAY 391
              L++ N+    TED  ++ F   G +  V + +D +  K   +A+V F  P DA+ A+
Sbjct: 61  DRILYVGNLDLAVTEDMLKQYFQVGGAIANVKILMD-KNNKEANYAFVEFHQPHDASVAF 119

Query: 392 VELDKQIFQGRLLHI 406
             LD +  +  ++ I
Sbjct: 120 QTLDGKQIENHVIKI 134

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 11/76 (14%)

Query: 13  LTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFKSEEDAFDAVNY 72
           +TED LK +F            +  ++ +VKIL ++  +   +AFV F    DA  A   
Sbjct: 73  VTEDMLKQYF-----------QVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQT 121

Query: 73  FDQSFIDTSKIEVSMA 88
            D   I+   I+++ A
Sbjct: 122 LDGKQIENHVIKINYA 137

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%)

Query: 330 EATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAAN 389
           E T  LF+ ++     ++     F       + HV  D +TG+S+G+ +V F     A  
Sbjct: 146 EDTFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQK 205

Query: 390 AYVELDKQIFQGRLLHI 406
           A  E    +  GR + I
Sbjct: 206 AMEEKQGTVVNGRAIRI 222

>CAGL0F01023g complement(108155..109345) similar to tr|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, hypothetical
           start
          Length = 396

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMF 381
           +F+ N+ +   E+   K F   G +E V +  D +T   KGFAYV F
Sbjct: 230 VFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQF 276

>CAGL0E03630g complement(335091..337331) weakly similar to sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation,
           hypothetical start
          Length = 746

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 59/118 (50%), Gaps = 13/118 (11%)

Query: 751 IVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQG 810
           +  +LP +     + + F ++GQL  V++ +  D   R +AFV+++  K+A++A++   G
Sbjct: 102 LASSLPDDQLCMNVTKHFQNYGQLVGVKVLR--DDHNRPYAFVQYINDKDAKHALKNASG 159

Query: 811 VHLLGRRLVMQHAE---------EEPQDAEEQI--ARMTKKVRSQVTTREHAALRNGG 857
             L GR+L  + A+          +P +  E I       K+   V  ++ +++R GG
Sbjct: 160 TVLNGRKLRCEAAKVNRTLLLINSKPIEYTEVIDFCNNFGKLEVLVPGKQSSSIRQGG 217

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 9/71 (12%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           SIFV  L+ STT + L ++F T G      V +KP         +  F F E++T + A 
Sbjct: 377 SIFVGQLDLSTTKEILVKRFSTHGKIRNIDVVSKP---------TTVFAFIEYETEQAAA 427

Query: 710 AVIDAMDGAVL 720
           A +D  + ++L
Sbjct: 428 AALDKENHSIL 438

>ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH]
           complement(1238223..1239923) [1701 bp, 566 aa]
          Length = 566

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 79/172 (45%), Gaps = 16/172 (9%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           +++ +L+ S T  ++ + + T G   V QVK     KNS+   + G+ F EF +    LA
Sbjct: 54  LYMGDLDPSWTEGDIKQIWATLGEANV-QVKLI---KNSSGGGNSGYCFVEFPSN---LA 106

Query: 711 VIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELF-S 769
             +A+   +  G  I +  S                   I V +L   V   Q+FELF S
Sbjct: 107 ATNAL---LKTGLPIPVDASRTLKLNWASFATTPGSEFSIFVGDLAPNVTESQLFELFIS 163

Query: 770 SFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAMEQLQGVHLLGRRL 818
            +    + ++   FD+    ++G+ FV+F    E + ++ ++QGV L GR +
Sbjct: 164 RYSSTLNAKI--VFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAI 213

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%)

Query: 515 SDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSK 574
           +D ++T + +       T  EL   F PFG++  + +P  +    VQY D +SA  A +K
Sbjct: 277 ADPNNTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAK 336

Query: 575 L 575
           +
Sbjct: 337 M 337

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + +  L   V   ++   F  FGQ+  V++P       +G  FV+++    AENA+ ++Q
Sbjct: 284 VFIGGLSSLVTEDELRAYFQPFGQIVYVKIPV-----GKGCGFVQYVDRSSAENAIAKMQ 338

Query: 810 GVHLLGRRLVMQHAEEEPQDA 830
           G  +   R+ +       Q A
Sbjct: 339 GFPIGNSRVRLSWGRSAKQTA 359

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+  +    TED+ R  F PFG++  V + +       KG  +V + +   A NA  ++
Sbjct: 284 VFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVG------KGCGFVQYVDRSSAENAIAKM 337

>Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement
          Length = 309

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGF-VVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +++ NL+F TT  ELT     +    V+   +T    +NS +   +G  +A+F++ ++A 
Sbjct: 24  VYISNLSFDTTEDELTGYLLEYNVLSVLIPSQTIRGFRNS-RVRPLGIAYADFESADKAK 82

Query: 710 AVIDAMDGAVLDGHRIQLK 728
             I+A++G V +   ++LK
Sbjct: 83  EAIEALNGKVFNNRTLRLK 101

>KLLA0E08745g 782800..784227 some similarities with sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1 major
           polyadenylated RNA-binding protein of nucleus and
           cytoplasm, hypothetical start
          Length = 475

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 76/184 (41%), Gaps = 14/184 (7%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           ++V NL  S     L + F+  G   ++ VK  PD KNS +     + F E+     A  
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQIGGS--ISSVKIIPD-KNSQEC---NYAFVEYFEPHDANV 152

Query: 711 VIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFELFSS 770
               ++G  ++G  +++  + +                 + V +L  +V+   +   F  
Sbjct: 153 AYQTLNGKEVEGKVLKINWAFQSQQVNSDETFN------LFVGDLNVDVDDATLAGTFKE 206

Query: 771 FGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEE-EPQ 828
           F       +        +RG+ FV F    +A+ AME  QG  L GR L +  A + EPQ
Sbjct: 207 FPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQ 266

Query: 829 DAEE 832
            +++
Sbjct: 267 QSQQ 270

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 5/83 (6%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           ++FV +LN       L   FK F  F+ A V       +     S G+GF  F  ++QA 
Sbjct: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW-----DMQSGRSRGYGFVSFGEQDQAQ 239

Query: 710 AVIDAMDGAVLDGHRIQLKLSHR 732
             ++   G  L+G  +++  + +
Sbjct: 240 VAMETKQGFELNGRALRINWASK 262

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 332 TGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAY 391
           T  LF+ ++     +      F  F    + HV  D ++G+S+G+ +V F   G+   A 
Sbjct: 183 TFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSF---GEQDQAQ 239

Query: 392 VELD-KQIFQ--GRLLHI 406
           V ++ KQ F+  GR L I
Sbjct: 240 VAMETKQGFELNGRALRI 257

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           L++ N+  +  +D  ++ F   G +  V +  D +  +   +A+V +  P DA  AY  L
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPD-KNSQECNYAFVEYFEPHDANVAYQTL 157

Query: 395 DKQIFQGRLLHI 406
           + +  +G++L I
Sbjct: 158 NGKEVEGKVLKI 169

>Kwal_56.23945
          Length = 806

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 9/60 (15%)

Query: 326 IQKIEATGRLFLRNI-LYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNP 384
           IQ I    RLF+ N+ L    +DD  ++F+P+G + ++++           F ++ + NP
Sbjct: 355 IQNIPPKSRLFIGNLPLKNVAKDDLFRIFSPYGHIYQINI--------KNAFGFIQYDNP 406

>YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein
           with weak similarity to S. pombe poly(A)-binding protein
           (SP:P31209), has one RNA recognition (RRM) domain [870
           bp, 289 aa]
          Length = 289

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 4/83 (4%)

Query: 651 IFVKNLNFSTTGKELTEKFKTFGGFVVA----QVKTKPDPKNSNKTLSMGFGFAEFKTRE 706
           +++ NL F+ + ++L      +G   V      V+      NSN    +G  FA+F    
Sbjct: 20  VYISNLPFTASERDLHAFLNNYGASSVLIPTQTVRRFSKRHNSNPRKPLGIAFAQFANNT 79

Query: 707 QALAVIDAMDGAVLDGHRIQLKL 729
            AL  I  ++G V    ++ LKL
Sbjct: 80  LALKAIQDLNGTVFQNQKLFLKL 102

>AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH]
           (639306..641444) [2139 bp, 712 aa]
          Length = 712

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 764 IFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHA 823
           + E F  +G+L  V++ +  D S R +AFV++    +A+ A++Q QG  L GR +  + A
Sbjct: 181 VTEAFKKYGELSMVKVLR--DPSNRPYAFVQYTNDNDAKRALKQAQGTLLNGRTIRCEKA 238

Query: 824 E 824
           +
Sbjct: 239 K 239

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I V  L   V ++++ + FS  G+++ V L  K D + + FAF+++   +    A+E+  
Sbjct: 382 IFVSQLDPSVTKEKLTQRFSKHGKVEDVNLIFK-DNNTKVFAFIKYETEEATATALEREN 440

Query: 810 GVHLLGRRLVMQHAE 824
               L R + +Q+ E
Sbjct: 441 HASFLNRTMHVQYRE 455

>CAGL0I05082g complement(473462..475276) some similarities with
           sp|P34217 Saccharomyces cerevisiae YBL051c, hypothetical
           start
          Length = 604

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 9/84 (10%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKF-----DKSARGFAFVEFLLPKEAENA 804
           I++KN+PF ++R+Q+ +  +S      + LP  F     + + RG AF  +    +    
Sbjct: 68  IVIKNIPFALKREQLLDFMTSL----DLPLPYAFNYHFDNGTFRGLAFANYNSEVDTAKV 123

Query: 805 MEQLQGVHLLGRRLVMQHAEEEPQ 828
           + +L    + GR L +++ +  PQ
Sbjct: 124 VNELNEKEVGGRNLRVEYKKVLPQ 147

>YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated
           protein, essential for meiotic recombination, suppressor
           of mitochondrial splicing defects, has 3 RNA recognition
           (RRM) domains [1572 bp, 523 aa]
          Length = 523

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%)

Query: 515 SDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSK 574
           +D ++T + +       T  EL   F PFG +  + +P  +    VQY D  SA AA + 
Sbjct: 308 TDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAG 367

Query: 575 L 575
           +
Sbjct: 368 M 368

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 750 IIVKNLPFEVERKQIFELF----SSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAM 805
           I V +L   V   Q+FELF    +S    K V    +    ++G+ FV+F    E + A+
Sbjct: 165 IFVGDLAPNVTESQLFELFINRYASTSHAKIVH--DQVTGMSKGYGFVKFTNSDEQQLAL 222

Query: 806 EQLQGVHLLGRRL 818
            ++QGV L GR +
Sbjct: 223 SEMQGVFLNGRAI 235

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 35/82 (42%), Gaps = 1/82 (1%)

Query: 335 LFLRNILYTATEDDFRKLFAP-FGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVE 393
           +F+ ++    TE    +LF   +       +  D  TG SKG+ +V F N  +   A  E
Sbjct: 165 IFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSE 224

Query: 394 LDKQIFQGRLLHILPGEQKKSH 415
           +      GR + + P   ++ H
Sbjct: 225 MQGVFLNGRAIKVGPTSGQQQH 246

>CAGL0J02200g complement(215042..215476) similar to sp|P40561
           Saccharomyces cerevisiae YIR001c SGN1, hypothetical
           start
          Length = 144

 Score = 35.4 bits (80), Expect = 0.069,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 6/97 (6%)

Query: 286 GVTARPKSDIREEDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATG-RLFLRNILYTA 344
            ++ +  S+I E  NV S      T Q  S+L  T E+K   ++EA    +++ NI    
Sbjct: 2   AISPQKISEIFENLNVSSNN---VTTQSNSRL--TREQKHALQLEADACSIYIGNISLDT 56

Query: 345 TEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMF 381
           T ++  + F   G ++ + +  D  TG S G+AYV F
Sbjct: 57  TPEEIDEHFKSCGVIKRITMLYDKNTGPSIGYAYVEF 93

 Score = 29.6 bits (65), Expect = 6.2,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           SI++ N++  TT +E+ E FK+ G  V+ ++    D    N   S+G+ + EF + +   
Sbjct: 46  SIYIGNISLDTTPEEIDEHFKSCG--VIKRITMLYD---KNTGPSIGYAYVEFDSIDSRD 100

Query: 710 AVIDAMDGAVLDGHRIQLK 728
             +D  +G  L  H I ++
Sbjct: 101 KALD-FNGTNLRQHVISVE 118

>Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement
          Length = 188

 Score = 35.8 bits (81), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           I   +L  E+    I  +FS +G    ++L + K  + ++GF ++++   +    A++ L
Sbjct: 36  IYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNL 95

Query: 809 QGVHLLGRRLVMQHAEEEPQDAEEQIA 835
            G  + GR + + HA   P+D + Q A
Sbjct: 96  NGATIAGRTIKVDHAFYTPRDDDWQYA 122

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 30/62 (48%)

Query: 345 TEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLL 404
           TE D   +F+ +G   ++ +  D  T +SKGF Y+ +++      A   L+     GR +
Sbjct: 46  TEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTI 105

Query: 405 HI 406
            +
Sbjct: 106 KV 107

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 10/77 (12%)

Query: 656 LNFSTTGKELTEK-----FKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALA 710
           + F +  KELTE      F  +G  +   +K   D +      S GFG+ +++ +   + 
Sbjct: 36  IYFGSLNKELTEGDILTIFSQYG--IPVDIKLVRDKETRE---SKGFGYLKYEDQRSTVL 90

Query: 711 VIDAMDGAVLDGHRIQL 727
            +D ++GA + G  I++
Sbjct: 91  AVDNLNGATIAGRTIKV 107

>YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in
           splicing and spliceosome assembly, has a role in sodium
           tolerance [447 bp, 148 aa]
          Length = 148

 Score = 35.0 bits (79), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +++ N+    TE D   +F+ +G   +V ++ D  TG+S+GFAY+ +++      A   L
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 395 DKQIFQGRLLHI 406
           +     GR L I
Sbjct: 93  NGFKIGGRALKI 104

>Scas_714.59
          Length = 233

 Score = 35.8 bits (81), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 344 ATEDDFRK-LFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGR 402
           A E++ R+ L  PF  +++  V  +  TG+SKG A+V F +   A  A   LD + F   
Sbjct: 161 ADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKALHFLDGRGFMNL 220

Query: 403 LLHI 406
           +L +
Sbjct: 221 ILRV 224

>Kwal_30.12890
          Length = 280

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 344 ATEDDFR-KLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGR 402
           A E+  R +L  PFG + +V V  +  TG+S+G AYV F+    A  A   L+ + F   
Sbjct: 208 ADENTLRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNGRGFMNL 267

Query: 403 LLH 405
           +L+
Sbjct: 268 ILN 270

>KLLA0F18216g 1677731..1679857 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 708

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 768 FSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHA 823
           F+ +G++ SV++ +  D + R +AFV++    EA NA+ Q QG  L  R +  + A
Sbjct: 144 FAKYGKIVSVKVLR--DPANRPYAFVQYASDDEALNALSQAQGTTLNNRNIRCERA 197

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQ 807
           I +  L F+V +  + E FS +G++ +  L  K  +  + FAF+++  P  A  A+E+
Sbjct: 325 IFIGQLNFKVTKPLLLERFSKYGEIDNCNLIHK-QEQLKCFAFIKYKTPASAAKALER 381

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           +F+  + +  T+    + F+ +GE++  +  L  +  + K FA++ +K P  AA A    
Sbjct: 325 IFIGQLNFKVTKPLLLERFSKYGEIDNCN--LIHKQEQLKCFAFIKYKTPASAAKALERE 382

Query: 395 DKQIFQGRLLHILPGEQKKSHR 416
           +  IF  ++LH+   E   S R
Sbjct: 383 NHSIFVEKILHVQIREVSNSRR 404

>Scas_607.10
          Length = 605

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 51/113 (45%), Gaps = 6/113 (5%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394
           LF+  +    TE+    +F+ +  L  + +  D+ + KS  + Y+ F +  +A  A  + 
Sbjct: 94  LFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVDDF 153

Query: 395 DKQIFQGRLLHILPGEQKKSHRLD---EFDLKNLPLKKQRSLKRKANASHDTF 444
           +  I  G  + ++P  +   +R +        NLPL+ +    R   A +DTF
Sbjct: 154 NYTILFGNEIKMMPSLRNTIYRKNIGTNVFFANLPLENKHLTTR---AFYDTF 203

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 1/75 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           I VKNLPF+V  ++I + FS  G +KSV       K    +AF+ +    +   A     
Sbjct: 304 IFVKNLPFDVPDEEILDHFSKLGPVKSV-FSSNVTKYKSSWAFITYKKQTDTIRATNHFN 362

Query: 810 GVHLLGRRLVMQHAE 824
                G+ + +  A+
Sbjct: 363 NTKFQGKTITVSRAK 377

>CAGL0H04675g complement(447256..448080) highly similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35, start by
           similarity
          Length = 274

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 344 ATEDDFR-KLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGR 402
           A E+  R +L  PF  +++V V  +  TG+S+G A+V F N   A  A   LD + F   
Sbjct: 200 ADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAEKALHFLDGRGFMNL 259

Query: 403 LLHI 406
           +L +
Sbjct: 260 ILRV 263

>CAGL0H02123g complement(188454..190121) similar to sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 555

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%)

Query: 515 SDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSK 574
           +D ++T + V       T  EL   F PFG +  + +P  +    VQY + +SA  A +K
Sbjct: 322 TDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAETAITK 381

Query: 575 L 575
           +
Sbjct: 382 M 382

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 335 LFLRNILYTATEDDFRKLFA-PFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVE 393
           +F+ ++  + TE     LF   +       V  D  TG SKG+ +V FK+  D   A VE
Sbjct: 192 IFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVE 251

Query: 394 LDKQIFQGRLLHI 406
           +      GR + I
Sbjct: 252 MQGCFLNGRAIKI 264

>Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement
          Length = 284

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 52/112 (46%), Gaps = 8/112 (7%)

Query: 320 TEEEKFIQKIEATGR-LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAY 378
           + E++  ++IE   R +F+ NI  + T +     F   G ++ V +  +  TG  KG+AY
Sbjct: 69  SREDRQARQIELDSRSIFVGNISPSTTPESLEAHFEDAGVIKRVTILYNKHTGAPKGYAY 128

Query: 379 VMFKNPGDAANAYVELDKQIFQGRLLHI------LPGEQKKSHRLDEFDLKN 424
           + F++  D+       D+  F G+ + +       PG  K+ +    F  +N
Sbjct: 129 IEFESK-DSVEKGSAFDQSDFNGKTITVAKKRTNFPGFNKRFNYQKHFFYQN 179

>Kwal_55.20154
          Length = 522

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%)

Query: 515 SDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSK 574
           +D ++T + +       T  EL   F PFG +  + +P  +    VQY D  SA  A +K
Sbjct: 268 TDPNNTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGKGCGFVQYVDRLSAETAIAK 327

Query: 575 L 575
           +
Sbjct: 328 M 328

 Score = 33.5 bits (75), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 60/129 (46%), Gaps = 16/129 (12%)

Query: 696 GFGFAEFKTREQALAVIDAMDGAVLD--GHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVK 753
           G+ F EF +   A   +   +G V+   G+RI LKL+                   + V 
Sbjct: 89  GYCFVEFPSHTNASNAL-LKNGLVIPNTGNRI-LKLN------WASFATTPGNEYSVFVG 140

Query: 754 NLPFEVERKQIFELF-SSFGQLKSVRLPKKFDKS---ARGFAFVEFLLPKEAENAMEQLQ 809
           ++   V   Q+FELF S +    + ++   FD+    ++G+ FV+F    E + ++ ++Q
Sbjct: 141 DVAPNVTEAQLFELFISRYASTLNAKI--VFDQMTGVSKGYGFVKFGQESEQQRSLLEMQ 198

Query: 810 GVHLLGRRL 818
           GV L GR +
Sbjct: 199 GVFLNGRAI 207

>CAGL0A03117g join(315979..316263,317561..317974) highly similar to
           sp|Q12159 Saccharomyces cerevisiae YDR381w YRA1
          Length = 232

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 12/100 (12%)

Query: 2   SRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFK 61
           +RV V+G+P+ + +D +++ F  ++  + +          V +  N  G+S   A V F+
Sbjct: 78  ARVTVEGLPRDIKQDAVREFFQSQVGGVQR----------VLLSYNERGQSTGMANVTFR 127

Query: 62  SEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMR 101
           + E A  AV  F  + ID  K  + +     DP V QP R
Sbjct: 128 NGELAKKAVAQFSGAPIDGGKSRLRL-NIVVDPTV-QPAR 165

>YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein
           with three RNA recognition motif (RRM) domains, has
           similarity to human 64K polyadenylation factor [2346 bp,
           781 aa]
          Length = 781

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 19/80 (23%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVAL-------------------DTRTGKSKG 375
           L++++I  + T++D    +  FGE+  V V                     D   G S+G
Sbjct: 542 LYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSSRG 601

Query: 376 FAYVMFKNPGDAANAYVELD 395
           + +V F++P DAA A +  D
Sbjct: 602 YGFVSFESPLDAAKAILNTD 621

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 14/82 (17%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKN-----SNKT---------LSM 695
           +++VK++  S T ++L + +K+FG  +  +V T    KN     SN +          S 
Sbjct: 541 NLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSSR 600

Query: 696 GFGFAEFKTREQALAVIDAMDG 717
           G+GF  F++   A   I   DG
Sbjct: 601 GYGFVSFESPLDAAKAILNTDG 622

>KLLA0B10472g complement(914512..915108) similar to sgd|S0006099
           Saccharomyces cerevisiae YPL178w SAE1 small subunit of
           the nuclear cap-binding protein complex CBC, start by
           similarity
          Length = 198

 Score = 35.0 bits (79), Expect = 0.15,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLP-KKFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V NL F    +QI+ELFS  G +K + +   +F  +  GF F+ F   ++A N+++ L
Sbjct: 49  VYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPCGFCFIIFDKMEDALNSIKYL 108

Query: 809 QGVHLLGRRLVM 820
               L  R + +
Sbjct: 109 GDTKLDDRHITI 120

 Score = 30.8 bits (68), Expect = 3.2,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 49/97 (50%)

Query: 294 DIREEDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLF 353
           +I+ + + +  + P     ++++ D     + ++K   +  +++ N+ +  +E+   +LF
Sbjct: 8   EIKYDHSCDRLDKPSRYLIRKARRDPDSGLQQLRKSMKSCTVYVGNLSFYTSEEQIYELF 67

Query: 354 APFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390
           +  G ++++ + LD       GF +++F    DA N+
Sbjct: 68  SKCGTIKKIIMGLDRFKFTPCGFCFIIFDKMEDALNS 104

>KLLA0D13420g complement(1157491..1157991) some similarities with
           sp|P40565 Saccharomyces cerevisiae YIR005w IST3
           singleton, hypothetical start
          Length = 166

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%)

Query: 345 TEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLL 404
           TE D   +F+ +G   ++ +  D  TGKSKGF ++ +++      A   L+     GRL+
Sbjct: 46  TEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLI 105

Query: 405 HI 406
            +
Sbjct: 106 RV 107

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 754 NLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQLQGVH 812
            +  E+    I  +FS +G    ++L + +    ++GF F+++   +    A++ L G  
Sbjct: 40  GMHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAK 99

Query: 813 LLGRRLVMQHAEEEPQDAE 831
           + GR + + HA   P+  E
Sbjct: 100 VCGRLIRVDHAFYRPRSDE 118

>YDR429C (TIF35) [1252] chr4 complement(1324465..1325289)
           Translation initiation factor eIF3, p33 subunit,
           contains an RRM (RNA recognition motif) domain [825 bp,
           274 aa]
          Length = 274

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 344 ATEDDFRK-LFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGR 402
           A E+  R+ L  PF  +  V V  +  TGKS+G A+V F +   A  A   LD + +   
Sbjct: 202 ADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNL 261

Query: 403 LLHI 406
           +L +
Sbjct: 262 ILRV 265

>Scas_622.8
          Length = 287

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 25/106 (23%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKK-----------FDKSA-RGFAFVEFL- 796
           + V NLP+   ++++ ELF +  +L  V LPK+           F ++  RG AF+ F  
Sbjct: 174 LYVNNLPYSATKEELAELFGTKPEL--VVLPKRRMRDETTKKVVFSETLNRGIAFITFEN 231

Query: 797 LPKEAENAMEQLQGVHLLGRRLVM----------QHAEEEPQDAEE 832
           L  +  +  E+ QG  L  R LV+          +H EE   DAEE
Sbjct: 232 LSGDIADKREEFQGKTLEERELVVDVAVVKPKREEHVEEAHPDAEE 277

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 8/59 (13%)

Query: 516 DRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSK 574
           +R    L V N P+  T  ELA+L   FG    L++ P +     + RD T+ +  FS+
Sbjct: 168 ERSKDTLYVNNLPYSATKEELAEL---FGTKPELVVLPKR-----RMRDETTKKVVFSE 218

>Sklu_2085.2 YOR319W, Contig c2085 3158-3787
          Length = 209

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + + N+   V +  ++ELF     +  +R P+ K   + +G+AF+EF   ++A+  ++ +
Sbjct: 12  LYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVKVM 71

Query: 809 QG-VHLLGRRLVMQHA 823
              V L  R L ++ A
Sbjct: 72  NNTVQLYNRTLKVRRA 87

>CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces
           cerevisiae YPL190c NAB3 polyadenylated RNA-binding
           protein, hypothetical start
          Length = 775

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 8/73 (10%)

Query: 750 IIVKNLPFE-VERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQL 808
           + + NLP + V ++ +F LFS FG +  + +          F F+++  PK    A+E  
Sbjct: 332 LFIGNLPLKNVSKQDLFRLFSPFGHILQINI-------KNAFGFIQYDNPKSVRAAIECE 384

Query: 809 QGVHLLGRRLVMQ 821
                 G++L+++
Sbjct: 385 SQEINFGKKLILE 397

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 10/73 (13%)

Query: 326 IQKIEATGRLFLRNI-LYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNP 384
           +  I    RLF+ N+ L   ++ D  +LF+PFG + ++++           F ++ + NP
Sbjct: 323 MHSIPPKSRLFIGNLPLKNVSKQDLFRLFSPFGHILQINIK--------NAFGFIQYDNP 374

Query: 385 GDAANAYVELDKQ 397
             +  A +E + Q
Sbjct: 375 -KSVRAAIECESQ 386

>KLLA0E02706g join(256959..257213,258450..258863) similar to
           sp|Q12159 Saccharomyces cerevisiae YDR381w YRA1 RNA
           annealing protein singleton, start by similarity
          Length = 222

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 10/86 (11%)

Query: 2   SRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFK 61
           +RV V+G+P+ + +D +K+ F  ++  + K            +  N  G S   A + FK
Sbjct: 68  TRVNVEGLPRDINQDAVKEFFNHQVGGVQK----------ALLSYNERGNSTGMATITFK 117

Query: 62  SEEDAFDAVNYFDQSFIDTSKIEVSM 87
           + E A  AV  F  + ID  K ++ +
Sbjct: 118 NAEQANLAVKKFHNAPIDGGKSKLRL 143

>Scas_241.1
          Length = 186

 Score = 33.9 bits (76), Expect = 0.30,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 29/61 (47%)

Query: 515 SDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSK 574
           +D ++T + +       +  +L   F PFG +  + +P  +    VQY D  SA  A SK
Sbjct: 21  TDPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGKGCGFVQYVDRLSAELAISK 80

Query: 575 L 575
           +
Sbjct: 81  M 81

>YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for
           sporulation and formation of meiotic spindle, has two
           RNA recognition motif (RRM) domains [2142 bp, 713 aa]
          Length = 713

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 764 IFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHA 823
           + E F  +G L  V++ +  D + R +AFV++    +A++A+ + QG  L GRRL  + A
Sbjct: 113 VTENFKKYGDLARVKVLR--DNANRPYAFVQYNNDHDAKHALIRAQGTLLNGRRLRCEPA 170

Query: 824 E 824
           +
Sbjct: 171 K 171

>CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces
           cerevisiae YBR212w Negative growth regulatory protein,
           hypothetical start
          Length = 802

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V  L   V+ +Q+ ++F  FG + S+++P       +   FV+F    +AE A++ LQ
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKIPP-----GKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 810 GVHLL 814
           G  L+
Sbjct: 524 GFVLV 528

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 750 IIVKNLPFEVERKQIFELFSS-FGQLKSVR-LPKKFDKSARGFAFVEFLLPKEAENAMEQ 807
           + V +L        +  LF + F  +K+VR +      ++R F FV F   +E   A+ +
Sbjct: 236 LFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIE 295

Query: 808 LQGVHLLGRRLVMQHA 823
           + GVH  GR L + +A
Sbjct: 296 MNGVHFQGRTLRVAYA 311

>YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein and
           pre-mRNA splicing factor with similarity to human SAP49,
           has 2 RNA recognition (RRM) domains [642 bp, 213 aa]
          Length = 213

 Score = 33.9 bits (76), Expect = 0.36,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           + V N+   + ++Q++ELF     +  ++ PK K  ++ +G+AF+EF    +A+ A++ +
Sbjct: 11  VYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIM 70

Query: 809 QGVHLLGRRLV 819
                L  RL+
Sbjct: 71  NNTVRLYDRLI 81

 Score = 30.4 bits (67), Expect = 4.7,   Method: Composition-based stats.
 Identities = 42/185 (22%), Positives = 80/185 (43%), Gaps = 16/185 (8%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709
           +++V N++   T ++L E F       V ++K    PK+       G+ F EF  +  A 
Sbjct: 10  TVYVGNIDPRITKEQLYELFIQINP--VLRIKY---PKDKVLQAYQGYAFIEFYNQGDAQ 64

Query: 710 AVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXII------VKNLPFEVERKQ 763
             I  M+  V    R+ +K+                    I+      +KNL   ++  Q
Sbjct: 65  YAIKIMNNTVRLYDRL-IKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQ 123

Query: 764 IFELFSSFGQLKSVRLPKKFDKSARGF--AFVEFLLPKEAENAMEQLQGVHLLGRRLVMQ 821
           + ++F+ FG+L  +R P+ F  S      A+V F   ++A+ A++ L    +   R+ + 
Sbjct: 124 LVKIFNKFGKL--IREPEIFYLSNGKLKCAYVYFEDFEKADLAIKSLNNQLVANNRITVD 181

Query: 822 HAEEE 826
           +A +E
Sbjct: 182 YAFKE 186

>Scas_530.4
          Length = 684

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 764 IFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHA 823
           + + F  FG++  V++ +  D++ R +AFV++    +A  A+++  G  L GRRL  + A
Sbjct: 161 VTDYFKKFGEIIRVKVLR--DQANRPYAFVQYTNDNDANVALKEAHGSILNGRRLRCERA 218

>CAGL0J01914g complement(189309..189818) similar to sp|P40565
           Saccharomyces cerevisiae YIR005w IST3, hypothetical
           start
          Length = 169

 Score = 33.1 bits (74), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 4/94 (4%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808
           I +  L  ++    +  +FS +G    V L + K    ++GFAF+++   +    A++ L
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 809 QGVHLLGRRLVMQHAEEEPQDAEEQIARMTKKVR 842
            G+ + GR++ + H    P+D    I   T+ VR
Sbjct: 96  NGITVAGRQIKVDHIFFTPRD---DIPEYTEAVR 126

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 40/85 (47%)

Query: 322 EEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMF 381
           E  + Q+ +    +F+  +    TE D   +F+ +G   +V +  D  T +SKGFA++ +
Sbjct: 23  EHSWHQEYKDQAYIFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKY 82

Query: 382 KNPGDAANAYVELDKQIFQGRLLHI 406
           ++      A   L+     GR + +
Sbjct: 83  EDQRSTILAVDNLNGITVAGRQIKV 107

>CAGL0F08217g complement(814508..816544) similar to sp|P53316
           Saccharomyces cerevisiae YGR250c, hypothetical start
          Length = 678

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 35/85 (41%), Gaps = 16/85 (18%)

Query: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVAL----------------DTRTGKSKGFAY 378
           ++++++    ++ D    + PFG +    +                  D   G S+G+ +
Sbjct: 442 IYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGYGF 501

Query: 379 VMFKNPGDAANAYVELDKQIFQGRL 403
           V F NP DAA A +  D    +G +
Sbjct: 502 VYFANPLDAAYAILSTDGYYLEGAI 526

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 45/93 (48%), Gaps = 11/93 (11%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKT----KPDPKNSNKT-------LSMGFG 698
           +I+VK++    + K+L   ++ FG  +  ++ T      + K++N +       +S G+G
Sbjct: 441 NIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGYG 500

Query: 699 FAEFKTREQALAVIDAMDGAVLDGHRIQLKLSH 731
           F  F     A   I + DG  L+G   +L +S+
Sbjct: 501 FVYFANPLDAAYAILSTDGYYLEGAIQKLSVSY 533

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + +  +P  +    + E F  FG + S+++   FD    G  F+ F+L  EA   +  + 
Sbjct: 141 LFIGGIPKNMSLNTLMETFDKFGTISSLKI--LFDNKNVGIGFLSFMLGSEAAECIRCMN 198

Query: 810 GVHL 813
           G  +
Sbjct: 199 GTKI 202

>KLLA0D05016g complement(431592..432380) similar to sp|P25555
           Saccharomyces cerevisiae YCL011c GBP2 potential
           telomere-associated protein, start by similarity
          Length = 262

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 30/69 (43%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           + V  LPF V  +++ ++F   G +    +    D  +RGF  V     ++  +A+    
Sbjct: 64  VFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIRHWT 123

Query: 810 GVHLLGRRL 818
           G    GR L
Sbjct: 124 GTEYKGRVL 132

>YHL034C (SBP1) [2252] chr8 complement(33191..34075) Single-stranded
           nucleic acid-binding protein associated with small
           nucleolar RNAs (snoRNAs), contains two RNA recognition
           (RRM) domains, one of them highly degenerate [885 bp,
           294 aa]
          Length = 294

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 329 IEATGRLFLRNILYTATEDDFRKLFA-PFGELEEVHVALDTRTG---KSKGFAYVMFKNP 384
           I+    +F+ N+ +  TEDD ++LF   FG+   V + +   T     +   A V F   
Sbjct: 33  IDPEDTIFIGNVAHECTEDDLKQLFVEEFGDEVSVEIPIKEHTDGHIPASKHALVKFPTK 92

Query: 385 GDAANAYVELDKQIFQGRLLHI 406
            D  N     D ++ + R +HI
Sbjct: 93  IDFDNIKENYDTKVVKDREIHI 114

>Scas_645.14
          Length = 717

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 696 GFGFAEFKTREQALAVIDAMDGAVLDGHRI 725
           G+GF    + EQAL VI  +DG    G+R+
Sbjct: 350 GYGFVNLGSHEQALKVIQTLDGLEWKGNRL 379

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 61/155 (39%), Gaps = 27/155 (17%)

Query: 695 MGFGFAEFKTREQALAVIDAMDGAVLDG------HRIQLKLSHRXXXXXXXXXXXXXXXX 748
           +G+GF  F    QA   I+  +G +++G      + ++ K   R                
Sbjct: 231 IGYGFISFVLGSQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFK 290

Query: 749 XIIVKNLPFEVE-----------RKQIFELFSSFGQLKSVRLPKK-------FDKSA--R 788
            I + NLP  +            + ++ E+  S  Q+ S   P+         +KS+  +
Sbjct: 291 CIFIGNLPTTLTDLTIDLILDKIKTELSEVLPSL-QILSYYFPQSKNVNNNINNKSSPLK 349

Query: 789 GFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHA 823
           G+ FV     ++A   ++ L G+   G RLV+  A
Sbjct: 350 GYGFVNLGSHEQALKVIQTLDGLEWKGNRLVVNKA 384

>YDR381W (YRA1) [1208] chr4 (1236546..1236830,1237597..1237992)
           Protein with RNA:RNA annealing activity, involved in
           mRNA packaging for export from the nucleus, contains one
           RNA recognition (RRM) domain [681 bp, 226 aa]
          Length = 226

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 10/85 (11%)

Query: 3   RVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFKS 62
           +V V+G+P+ + +D +++ F  ++  + +          V +  N  G+S   A + FK+
Sbjct: 79  KVNVEGLPRDIKQDAVREFFASQVGGVQR----------VLLSYNERGQSTGMANITFKN 128

Query: 63  EEDAFDAVNYFDQSFIDTSKIEVSM 87
            E A  AV  F+ S ID  +  + +
Sbjct: 129 GELARRAVERFNGSPIDGGRSRLRL 153

>YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA
           splicing factor, responsible for reannealing U4 and U6
           snRNAs to recycle snRNPs for subsequent splicing
           reactions, has 3 RNA recognition (RRM) domains [1335 bp,
           444 aa]
          Length = 444

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 68/173 (39%), Gaps = 28/173 (16%)

Query: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFA--EFKTREQ 707
           ++ VKNL  S    ++ + FK  G  +   V           +L   F FA  EF   + 
Sbjct: 42  TVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVA---------DSLKKNFRFARIEFARYDG 92

Query: 708 ALAVIDAMDGAVLDGHRIQLKLSHRXXXXXXXXXXXXXXXXXIIVKNLPFEVERKQIFEL 767
           ALA I      V     I   +SH                  + + N P    ++ I +L
Sbjct: 93  ALAAITKTHKVVGQNEII---VSH-------------LTECTLWMTNFPPSYTQRNIRDL 136

Query: 768 FSSFGQLK-SVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLV 819
                 +  S+RLP     ++R FA+++    ++A   +E+L G+ + G  LV
Sbjct: 137 LQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLV 189

>ADL371C [1370] [Homologous to ScYBR119W (MUD1) - SH]
           (55727..56570,56628..56638) [855 bp, 284 aa]
          Length = 284

 Score = 32.7 bits (73), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 521 VLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKL 575
           VLLV++ P   T  EL D+F    KL ++ L   + +A V Y D  SA A  +KL
Sbjct: 214 VLLVQDLPTDITEQELVDIFA-NDKLLQVRLVQVRQLAFVDYADVQSATAVKNKL 267

>AFR149C [3341] [Homologous to ScYDR381W (YRA1) - SH]
           (705111..705524,706055..706303) [663 bp, 220 aa]
          Length = 220

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 10/81 (12%)

Query: 2   SRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFK 61
           ++V V+G+P+ + ED ++D F   +  + +          V +  N  G S   A + F 
Sbjct: 66  TKVNVEGLPRDIKEDAVRDFFRSSVGGLQR----------VLLSYNERGNSTGMATLTFA 115

Query: 62  SEEDAFDAVNYFDQSFIDTSK 82
           + E A +AV  F+ + ID  K
Sbjct: 116 NAEKAREAVKKFNGAPIDGGK 136

>Scas_709.2*
          Length = 171

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 36/64 (56%)

Query: 320 TEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYV 379
           T E+ +  + +    +++  +    TE D   +F+ +G   ++ +  D +TG+SKGFA++
Sbjct: 21  TTEQSWHYQYKDQAYIYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFL 80

Query: 380 MFKN 383
            +++
Sbjct: 81  KYED 84

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKS-ARGFAFVEFLLPKEAENAMEQL 808
           I +  L  E+    I  +FS +G    + L        ++GFAF+++   +    A++ L
Sbjct: 36  IYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 809 QGVHLLGRRLVMQHAEEEPQDAE 831
            GV +    + + H   EP+D +
Sbjct: 96  NGVKVGSNTIQVDHTFYEPRDEQ 118

>KLLA0B11594g complement(1018044..1018388) some similarities with
           sp|P40567 Saccharomyces cerevisiae YIR009w MSL1 U2
           snRNA-associated protein with singleton, hypothetical
           start
          Length = 114

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 8/80 (10%)

Query: 750 IIVKNLPFEVE----RKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAM 805
           + VKNL  +++    R+ ++ LF+++G++  V +  K     RG AF+ F    EA  A+
Sbjct: 34  VYVKNLNDQIKIQTVRESLYMLFATYGEVIKVSMTPK----QRGQAFITFKSVDEANLAL 89

Query: 806 EQLQGVHLLGRRLVMQHAEE 825
             L+      + LV+Q +++
Sbjct: 90  LSLKDELFFNKPLVLQFSKQ 109

>KLLA0C07194g 624694..625587 no similarity, hypothetical start
          Length = 297

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 518 DDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQY 562
           D   + V  FP GT  +ELA  F   G+L R+ +PP      + Y
Sbjct: 3   DRNTVHVSGFPAGTRANELAPQFENVGRLVRIDIPPLGRFKSIPY 47

>KLLA0E00484g complement(45755..46483) similar to sp|P10080
           Saccharomyces cerevisiae YHL034c SBP1 single-strand
           nucleic acid binding protein singleton, start by
           similarity
          Length = 242

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 12/72 (16%)

Query: 516 DRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKL 575
           +R    L V N P+ TT +E+A     FG  +  ++ P +     + +D T+ R  FS  
Sbjct: 131 ERSKDTLYVNNIPYHTTKAEIASF---FGTTEESVILPMR-----RMKDTTTKRVFFS-- 180

Query: 576 SYKRFKDGILYL 587
             ++F  GI ++
Sbjct: 181 --RKFNRGIAFV 190

>CAGL0J05566g complement(528304..530745) highly similar to sp|P40850
           Saccharomyces cerevisiae YNL085w MKT1, start by
           similarity
          Length = 813

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 529 FGTTHSELADLFLPFGK-LQRLLLPPAQTIAVVQYRD 564
           FG TH EL D+ +  G  LQ + LPP Q   V Q  D
Sbjct: 251 FGITHEELVDISMAVGNDLQPVTLPPLQIYPVPQLFD 287

>KLLA0B09658g complement(837873..838901) similar to sgd|S0006331
           Saccharomyces cerevisiae YPR127w, hypothetical start
          Length = 342

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 158 SAQVTSWDNLGGAVQAANDAQNTVSSDAPQGNSLLAQALAMKTGEPSGNFKVQ 210
           SA++ S     G V   N+    + + +P G  LL  ALA  +  P+G+F++Q
Sbjct: 194 SAEILS----NGIVDTCNELGLPIVAYSPLGRGLLTGALAKSSDIPAGDFRIQ 242

>Scas_157.1
          Length = 232

 Score = 32.0 bits (71), Expect = 1.7,   Method: Composition-based stats.
 Identities = 34/136 (25%), Positives = 59/136 (43%), Gaps = 13/136 (9%)

Query: 688 NSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGH-RIQLKLSHRXXXXXXXXXXXXXX 746
           NSN  ++ G+ F EF + E     +   +G V+ G  + +LKL+                
Sbjct: 82  NSNLGVNQGYCFVEFPSMEHGNNAL-LKNGIVIPGFPQRRLKLNW-----ASAGANGNNS 135

Query: 747 XXXIIVKNLPFEVERKQIFELFSSFGQLKSVRLPK----KFDKSARGFAFVEFLLPKEAE 802
              + V +L   V   Q+FELF   G+  S    K    +    ++ + FV+F    + +
Sbjct: 136 GFSVFVGDLSPNVTEAQLFELF--IGRYPSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQ 193

Query: 803 NAMEQLQGVHLLGRRL 818
             + ++QGV L GR +
Sbjct: 194 RVLVEMQGVFLNGRSI 209

>KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181
           Saccharomyces cerevisiae YOR319w HSH49 essential yeast
           splicing factor, start by similarity
          Length = 203

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 4/79 (5%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKF--DKSARGFAFVEFLLPKEAENAMEQ 807
           + VKNL   ++  Q+  +F  FG+L  +R P+ F         A+V F   K ++ A++Q
Sbjct: 97  LFVKNLDESIDVPQLSNIFKIFGKL--LRKPEVFYLQNGTLRCAYVWFTTFKHSDEALQQ 154

Query: 808 LQGVHLLGRRLVMQHAEEE 826
           L   +L  + + + +A ++
Sbjct: 155 LNETNLANKLIYIDYAYKD 173

>Kwal_23.3928
          Length = 407

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 521 VLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSA 568
           +LLV+N P G ++SE+ DLF   G ++ + L   + +A V+Y   ++A
Sbjct: 337 ILLVQNLPSGVSNSEVVDLFRDEGFVE-VRLVGVRNLAFVEYETISNA 383

>KLLA0B08976g complement(786122..787039) weakly similar to sp|P32605
           Saccharomyces cerevisiae YBR119w MUD1 U1 snRNP-specific
           A protein singleton, start by similarity
          Length = 305

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQ 809
           ++V+NLP +V ++++ +LF S G  K VRL      S R   FVE+     A   +E L 
Sbjct: 235 LLVQNLPKDVTQQELEKLFVSDG-FKEVRLV-----SVRNLCFVEYDSTANATKVVETLG 288

Query: 810 GVH 812
             H
Sbjct: 289 HDH 291

>YOR361C (PRT1) [5138] chr15 complement(1015357..1017648)
           Translation initiation factor eIF3 beta subunit (p90),
           has an RNA recognition (RRM) domain [2292 bp, 763 aa]
          Length = 763

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 12/112 (10%)

Query: 314 ESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKS 373
           E +   TEE  F Q I   G   + +      +     LF+  G++  +   +D  TGK+
Sbjct: 64  EEQYKVTEEFNFDQYIVVNGAPVIPSAKVPVLKKALTSLFSKAGKVVNMEFPIDEATGKT 123

Query: 374 KGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHRLDEFDLKNL 425
           KGF +V   +  DA         + F G+ L +        HRL  + +K++
Sbjct: 124 KGFLFVECGSMNDAKKII-----KSFHGKRLDL-------KHRLFLYTMKDV 163

>Scas_683.32
          Length = 272

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 7/65 (10%)

Query: 750 IIVKNLPFEVE-------RKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAE 802
           + V N P EVE       ++QI   F   G++  VRL +   K   G   VEF   +E E
Sbjct: 122 LAVMNFPVEVEGDDISELQEQIESFFDKLGKVNQVRLRRDHKKKFNGNVLVEFESLEECE 181

Query: 803 NAMEQ 807
           N +++
Sbjct: 182 NFLKK 186

>Kwal_23.3650
          Length = 299

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 89/237 (37%), Gaps = 53/237 (22%)

Query: 320 TEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDT-RTGKS--KGF 376
           +EE + I   E T  +F+ N+     E+D +K+F      E+V V + + ++G+S  + +
Sbjct: 25  SEESRTIVDPETT--IFIGNVARDCAEEDLKKIFE-----EDVEVEIPSVKSGRSFKQRY 77

Query: 377 AYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKRK 436
           A+V F    D      + DK + + R ++I     +++   +E D K    +K R+ + K
Sbjct: 78  AFVKFPQKIDFDAIKSKYDKTVIKERGIYI-----RRAQTEEERDAK----RKARAERPK 128

Query: 437 ANASHDTFSWNSLYMNQDAVLGSVAAKLGVQKSDLIDATDASAAVKQALAEAHVIGDVRK 496
              +    S      N  A                 DA D   A     A        R 
Sbjct: 129 KVPAAAAASTPETSANGTA-----------------DAADKKPARSAIPAPPKKQERTRA 171

Query: 497 YFESKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPP 553
             ES               +R    L V N P+  T  ELAD    FG    L++ P
Sbjct: 172 PLES--------------MERSTDTLYVNNVPYFATKEELADF---FGTTPELVVLP 211

>Scas_611.12
          Length = 102

 Score = 29.3 bits (64), Expect = 4.4,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 345 TEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDK 396
           TED  RKLF  +GE+E+++          K   ++ F N    +NA + LDK
Sbjct: 33  TEDSLRKLFRQYGEVEQINFL------PEKNCCFINFTN---ISNAILALDK 75

>Kwal_55.21039
          Length = 119

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 761 RKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVM 820
           R+ +F LFS++G++  + + K+     RG AF+      EA  A+  L      G+ L +
Sbjct: 52  RENLFLLFSTYGEVLQIDMSKRI----RGQAFIVLKTVDEANIALISLNNEPFFGKDLHI 107

Query: 821 QHAEEE 826
           Q ++++
Sbjct: 108 QFSKKD 113

>KLLA0C08041g complement(705516..707240) gi|24741192|emb|CAD56154.1
           Kluyveromyces lactis CCr4/NOT complex/transcription
           factor subunit, start by similarity
          Length = 574

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 696 GFG-FAEFKTREQALAVIDAMDGAVLDGHRIQ 726
           G+G +  F  ++ A   I A+DG  +DGH+++
Sbjct: 200 GYGIYVTFSRKDDAAKCIQAIDGIYIDGHQVK 231

>Scas_632.7*
          Length = 229

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 3   RVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFKS 62
           +V V+G+P+ + +D +++ F  ++  + +          V +  N  G+S   A + F++
Sbjct: 78  KVNVEGLPRDIKQDAVREFFASQVGGVQR----------VLLSYNERGQSTGMANITFRN 127

Query: 63  EEDAFDAVNYFDQSFIDTSK 82
            + A  AV  F+ + ID  +
Sbjct: 128 AQQAKVAVTKFNGAPIDGGR 147

>KLLA0D16049g complement(1352380..1353657) some similarities with
           sp|P43607 Saccharomyces cerevisiae YFR032c singleton,
           hypothetical start
          Length = 425

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 333 GRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSK-----GFAYVMFKNPGDA 387
            R+++ N+ + A+E+   +    +  +  +  +   R  K+K     G AY  F N  DA
Sbjct: 5   ARVYISNLSFEASENQLYEYLQDYNVISVLIPSQTVRGLKNKAVRPFGIAYAEFSNEEDA 64

Query: 388 ANAYVELDKQIFQGRLLHI 406
                EL+ ++F  R L++
Sbjct: 65  NKVIQELNGKLFMERHLNL 83

>YBL035C (POL12) [159] chr2 complement(151458..153575) DNA
           polymerase alpha 86 kDa subunit, B subunit of polymerase
           alpha-primase complex [2118 bp, 705 aa]
          Length = 705

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 8/113 (7%)

Query: 524 VKNFP-FGTTHSELADLFLP-FGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKRFK 581
           + NFP F T    L +LFL  F  + + + P  QT+ +   +DA S  AA+ + S  R  
Sbjct: 448 LPNFPQFKTQPKTLDELFLKLFTPILKTISPHIQTVLIPSTKDAISNHAAYPQASLIR-- 505

Query: 582 DGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATASK 634
              L L   PK  F          ++EI    +NV   +   + I    T+S+
Sbjct: 506 -KALQL---PKRNFKCMANPSSFQINEIYFGCSNVDTFKDLKEVIKGGTTSSR 554

>Kwal_23.6233
          Length = 342

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 172 QAANDAQNTVSSDAPQGN--SLLAQALAMKTGEPSGNFKVQENESD 215
           QA ND Q+ V    P GN   +LA   A K G P     +  NE+D
Sbjct: 89  QATNDTQSKVKFVVPSGNFGDILAGYYAKKMGLPVERLVIATNEND 134

>AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,
           218 aa]
          Length = 218

 Score = 29.6 bits (65), Expect = 9.7,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 28/59 (47%)

Query: 752 VKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQG 810
           V   P E   + +   F + G++  + +P       R FAFV+F   +E   A+E+L G
Sbjct: 9   VSGFPAETRARDMAPDFEAVGKIVRIDIPPMRPFQDRPFAFVKFETHEECVRAVEELDG 67

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,406,462
Number of extensions: 1152937
Number of successful extensions: 7107
Number of sequences better than 10.0: 353
Number of HSP's gapped: 6815
Number of HSP's successfully gapped: 702
Length of query: 864
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 754
Effective length of database: 12,788,129
Effective search space: 9642249266
Effective search space used: 9642249266
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)