Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.39721100108454660.0
Sklu_1989.21104108946310.0
YGR094W (VAS1)1104106944620.0
CAGL0G03091g1105104144230.0
KLLA0D14971g1091106243940.0
Scas_705.211061103943800.0
AAR034W1098105943030.0
Scas_716.31*101996232400.0
Scas_97.1*26125211151e-144
CAGL0G03311g10728364513e-45
Scas_599.1310718514485e-45
YBL076C (ILS1)10728674317e-43
KLLA0E20625g10738904192e-41
Kwal_27.1081110998964147e-41
AER394W10728213923e-38
CAGL0L12606g9829323682e-35
Scas_568.310018223583e-34
AGL247C9889543308e-31
Kwal_27.118279858183219e-30
YPL040C (ISM1)10028703092e-28
KLLA0D11858g9908073041e-27
KLLA0E05269g8753912394e-20
YLR382C (NAM2)8948332271e-18
Kwal_26.93748846202252e-18
AER043C8734622092e-16
CAGL0H05049g9078212002e-15
Scas_719.59398501823e-13
AAL088W110458990.002
KLLA0D06105g1095122950.006
Scas_650.7111951900.019
CAGL0J03652g109351890.026
Sklu_2298.2109651880.038
YPL160W (CDC60)109051870.043
YGR171C (MSM1)57549850.072
Scas_620.7576254810.18
AAL133W56751800.24
Kwal_33.15315583144800.31
CAGL0I08723g58451760.92
Kwal_26.8831916127751.2
Sklu_2399.6574145731.8
ACL093C101087732.1
KLLA0F14971g56818722.4
Sklu_2208.435659712.6
AER107W63623695.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3972
         (1084 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3972                                                         2110   0.0  
Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement       1788   0.0  
YGR094W (VAS1) [2054] chr7 (672188..675502) Valyl-tRNA synthetas...  1723   0.0  
CAGL0G03091g 286259..289576 highly similar to sp|P07806 Saccharo...  1708   0.0  
KLLA0D14971g 1263323..1266598 highly similar to sp|P07806 Saccha...  1697   0.0  
Scas_705.21                                                          1691   0.0  
AAR034W [220] [Homologous to ScYGR094W (VAS1) - SH] complement(4...  1662   0.0  
Scas_716.31*                                                         1252   0.0  
Scas_97.1*                                                            434   e-144
CAGL0G03311g 315470..318688 highly similar to sp|P09436 Saccharo...   178   3e-45
Scas_599.13                                                           177   5e-45
YBL076C (ILS1) [123] chr2 complement(81041..84259) Isoleucyl-tRN...   170   7e-43
KLLA0E20625g 1825036..1828257 highly similar to sp|P09436 Saccha...   166   2e-41
Kwal_27.10811                                                         164   7e-41
AER394W [2894] [Homologous to ScYBL076C (ILS1) - SH] complement(...   155   3e-38
CAGL0L12606g 1353211..1356159 similar to sp|P48526 Saccharomyces...   146   2e-35
Scas_568.3                                                            142   3e-34
AGL247C [4065] [Homologous to ScYPL040C (ISM1) - SH] (237045..24...   131   8e-31
Kwal_27.11827                                                         128   9e-30
YPL040C (ISM1) [5399] chr16 complement(475988..478996) Isoleucyl...   123   2e-28
KLLA0D11858g complement(1010259..1013231) similar to sp|P48526 S...   121   1e-27
KLLA0E05269g 476546..479173 similar to sp|P11325 Saccharomyces c...    97   4e-20
YLR382C (NAM2) [3761] chr12 complement(882067..884751) Leucyl-tR...    92   1e-18
Kwal_26.9374                                                           91   2e-18
AER043C [2548] [Homologous to ScYLR382C (NAM2) - SH] (711416..71...    85   2e-16
CAGL0H05049g complement(483870..486593) similar to sp|P11325 Sac...    82   2e-15
Scas_719.5                                                             75   3e-13
AAL088W [99] [Homologous to ScYPL160W (CDC60) - SH] complement(1...    43   0.002
KLLA0D06105g complement(522480..525767) highly similar to sp|P26...    41   0.006
Scas_650.7                                                             39   0.019
CAGL0J03652g 346614..349895 highly similar to sp|P26637 Saccharo...    39   0.026
Sklu_2298.2 YPL160W, Contig c2298 4548-7838                            39   0.038
YPL160W (CDC60) [5287] chr16 (246989..250261) Leucyl-tRNA synthe...    38   0.043
YGR171C (MSM1) [2124] chr7 complement(840827..842554) Methionyl-...    37   0.072
Scas_620.7                                                             36   0.18 
AAL133W [54] [Homologous to ScYGR171C (MSM1) - SH] complement(11...    35   0.24 
Kwal_33.15315                                                          35   0.31 
CAGL0I08723g 849045..850799 similar to sp|P22438 Saccharomyces c...    34   0.92 
Kwal_26.8831                                                           33   1.2  
Sklu_2399.6 YGR171C, Contig c2399 15064-16788                          33   1.8  
ACL093C [956] [Homologous to ScYIR023W (DAL81) - SH] (178239..18...    33   2.1  
KLLA0F14971g complement(1386169..1387875) similar to sp|P22438 S...    32   2.4  
Sklu_2208.4 YDR322W, Contig c2208 7462-8532                            32   2.6  
AER107W [2612] [Homologous to ScYLR424W - SH] complement(838830....    31   5.2  

>Kwal_23.3972
          Length = 1100

 Score = 2110 bits (5466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1033/1084 (95%), Positives = 1033/1084 (95%)

Query: 1    MYKSFARFVVPSVRYSVPQARNKLPFVGRSASIRLASTWNSIMSSEQLPPVDPKTGEIII 60
            MYKSFARFVVPSVRYSVPQARNKLPFVGRSASIRLASTWNSIMSSEQLPPVDPKTGEIII
Sbjct: 1    MYKSFARFVVPSVRYSVPQARNKLPFVGRSASIRLASTWNSIMSSEQLPPVDPKTGEIII 60

Query: 61   NPLKEDGSEKTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVVPIPE 120
            NPLKEDGSEKTP                                         VVVPIPE
Sbjct: 61   NPLKEDGSEKTPKEIEKERKKAEKLLKFAAKQAKKAEAASKQAAAPKKEKKKKVVVPIPE 120

Query: 121  FVDKTAAGEKKILVSLEDPALKAYNPANVESSWYDWWVKSGFFEPEFTKEGEIKPEGLFC 180
            FVDKTAAGEKKILVSLEDPALKAYNPANVESSWYDWWVKSGFFEPEFTKEGEIKPEGLFC
Sbjct: 121  FVDKTAAGEKKILVSLEDPALKAYNPANVESSWYDWWVKSGFFEPEFTKEGEIKPEGLFC 180

Query: 181  IPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWA 240
            IPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWA
Sbjct: 181  IPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWA 240

Query: 241  KEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEA 300
            KEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEA
Sbjct: 241  KEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEA 300

Query: 301  FVRLHEKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSF 360
            FVRLHEKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSF
Sbjct: 301  FVRLHEKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSF 360

Query: 361  AYPVVDSDEKLIVATTRPETMFGDTGVAVHPDDPRYKHLHGKFVQHPFLPRKIPIFCDSE 420
            AYPVVDSDEKLIVATTRPETMFGDTGVAVHPDDPRYKHLHGKFVQHPFLPRKIPIFCDSE
Sbjct: 361  AYPVVDSDEKLIVATTRPETMFGDTGVAVHPDDPRYKHLHGKFVQHPFLPRKIPIFCDSE 420

Query: 421  AVDMNFGTGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDARK 480
            AVDMNFGTGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDARK
Sbjct: 421  AVDMNFGTGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDARK 480

Query: 481  NVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRI 540
            NVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRI
Sbjct: 481  NVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRI 540

Query: 541  TITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDNDQIDGEYWVSGRNLX 600
            TITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDNDQIDGEYWVSGRNL 
Sbjct: 541  TITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDNDQIDGEYWVSGRNLE 600

Query: 601  XXXXXXXXXFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDKTKDLSQFYPFSMLETGW 660
                     FPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDKTKDLSQFYPFSMLETGW
Sbjct: 601  EAEAKAAKKFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDKTKDLSQFYPFSMLETGW 660

Query: 661  DILFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLE 720
            DILFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLE
Sbjct: 661  DILFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLE 720

Query: 721  DLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRV 780
            DLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRV
Sbjct: 721  DLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRV 780

Query: 781  EGYRKFCNKIYQATKFALIRLGEDYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALD 840
            EGYRKFCNKIYQATKFALIRLGEDYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALD
Sbjct: 781  EGYRKFCNKIYQATKFALIRLGEDYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALD 840

Query: 841  KRDFLTSTSGIYEFWYLVCDVYIENSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFM 900
            KRDFLTSTSGIYEFWYLVCDVYIENSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFM
Sbjct: 841  KRDFLTSTSGIYEFWYLVCDVYIENSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFM 900

Query: 901  PFISEEMWQRLPKRTSEQSPTIVKASYPVYRKDFDNQKAGEEYELILDTIKEARSLLAQY 960
            PFISEEMWQRLPKRTSEQSPTIVKASYPVYRKDFDNQKAGEEYELILDTIKEARSLLAQY
Sbjct: 901  PFISEEMWQRLPKRTSEQSPTIVKASYPVYRKDFDNQKAGEEYELILDTIKEARSLLAQY 960

Query: 961  GILKNGKVFIESSSDAFFDTAVTQKDSIVSLIKAIDEVTVVKNVSEIPEGAVLQAVTPEV 1020
            GILKNGKVFIESSSDAFFDTAVTQKDSIVSLIKAIDEVTVVKNVSEIPEGAVLQAVTPEV
Sbjct: 961  GILKNGKVFIESSSDAFFDTAVTQKDSIVSLIKAIDEVTVVKNVSEIPEGAVLQAVTPEV 1020

Query: 1021 NVHVLVKGHVDIESEISKTEGKLEKAQKTKEGIDKIMNSKDYEEKANEQAKASNLARLQN 1080
            NVHVLVKGHVDIESEISKTEGKLEKAQKTKEGIDKIMNSKDYEEKANEQAKASNLARLQN
Sbjct: 1021 NVHVLVKGHVDIESEISKTEGKLEKAQKTKEGIDKIMNSKDYEEKANEQAKASNLARLQN 1080

Query: 1081 TLAE 1084
            TLAE
Sbjct: 1081 TLAE 1084

>Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement
          Length = 1104

 Score = 1788 bits (4631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 855/1089 (78%), Positives = 943/1089 (86%), Gaps = 6/1089 (0%)

Query: 1    MYKSFARFVVPSVRYSVPQARNKLPFVGRSASI---RLASTWNSIMSSEQ--LPPVDPKT 55
            MYK   +   PS R S+P    K   V RS SI   R  ST  + M ++Q  LPPVDPKT
Sbjct: 1    MYKWLFKAYKPSSRISIPPVLLKRQ-VYRSTSILTHRSYSTNKNKMGADQQNLPPVDPKT 59

Query: 56   GEIIINPLKEDGSEKTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVV 115
            GEIIINPLKEDG+ KTP                                          V
Sbjct: 60   GEIIINPLKEDGTAKTPKEIEKERKKAEKLLKFAAKQAKKAAATKTASTAPKKEKKKKEV 119

Query: 116  VPIPEFVDKTAAGEKKILVSLEDPALKAYNPANVESSWYDWWVKSGFFEPEFTKEGEIKP 175
             PIPEFVDKT  GEKKILVSL+DPALKAYNPANVESSWY+WWVKSG FEPEFTK+G++KP
Sbjct: 120  EPIPEFVDKTVPGEKKILVSLDDPALKAYNPANVESSWYEWWVKSGLFEPEFTKDGKVKP 179

Query: 176  EGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVE 235
            EGLFCIPAPPPNVTGALHIGH LTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVE
Sbjct: 180  EGLFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVE 239

Query: 236  KQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTK 295
            KQ+WAKEKKTRHDYGRE FV K+WEWKE+YH RIK QI KLGASYDW REAFTL P+L+ 
Sbjct: 240  KQIWAKEKKTRHDYGREEFVGKVWEWKEEYHGRIKGQIKKLGASYDWKREAFTLDPKLST 299

Query: 296  SVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFG 355
            +VTEAFVRLHE+G+IYRA+RL+NWSVKLNTAISNLEVENKD+KARTLLSVPGYDEKVEFG
Sbjct: 300  AVTEAFVRLHEEGIIYRASRLINWSVKLNTAISNLEVENKDVKARTLLSVPGYDEKVEFG 359

Query: 356  VLTSFAYPVVDSDEKLIVATTRPETMFGDTGVAVHPDDPRYKHLHGKFVQHPFLPRKIPI 415
            VLTSFAY VVDSDEKLI+ATTRPETMFGDT +AVHP+DPRYKHLHGKFVQHPFLPRK+PI
Sbjct: 360  VLTSFAYQVVDSDEKLIIATTRPETMFGDTAIAVHPEDPRYKHLHGKFVQHPFLPRKLPI 419

Query: 416  FCDSEAVDMNFGTGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLNENCGPEWAGMKR 475
             CDSEAVDM FGTGAVK+TPAHDQNDYNTGKRHNLEFIN+LTD GLLNENCGPEW GMKR
Sbjct: 420  VCDSEAVDMEFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNENCGPEWCGMKR 479

Query: 476  FDARKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAV 535
            FDARK V+E LK  GLYIGQEDNEMTIP CSRSGD+IEPLLKPQWWVSQ++MA++AIKAV
Sbjct: 480  FDARKKVVEELKNAGLYIGQEDNEMTIPICSRSGDIIEPLLKPQWWVSQTEMAKEAIKAV 539

Query: 536  KDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDNDQIDGEYWVS 595
            ++G ITITPKSSE+EYFHWLENIQDWCISRQLWWGHRCPVYFV IEG+DND+ DG+YWVS
Sbjct: 540  RNGDITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVKIEGEDNDKNDGKYWVS 599

Query: 596  GRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDKTKDLSQFYPFSM 655
            GR            F   KYTL+QDEDVLDTWFSSGLWPFSTLGWP+KT D+  FYPFSM
Sbjct: 600  GRTTEEAEEKAAKAFSGKKYTLEQDEDVLDTWFSSGLWPFSTLGWPEKTPDMENFYPFSM 659

Query: 656  LETGWDILFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVC 715
            LETGWDILFFWVSRMILLGL+LTG IPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDV+ 
Sbjct: 660  LETGWDILFFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVIG 719

Query: 716  GIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINL 775
            GIKLEDLHAKLL GNLDPREVEKAK GQKESYPNGIPQCGTDALRFALCAYTTGGRDINL
Sbjct: 720  GIKLEDLHAKLLLGNLDPREVEKAKTGQKESYPNGIPQCGTDALRFALCAYTTGGRDINL 779

Query: 776  DILRVEGYRKFCNKIYQATKFALIRLGEDYQPPSMEKLSGNESLVEKWILNKMTNYAKSI 835
            DILRVEGYRKFCNKIYQATKFAL+RLG+DYQPP+ EKLSG ESLVE+WIL+K+TNY+K++
Sbjct: 780  DILRVEGYRKFCNKIYQATKFALMRLGDDYQPPAEEKLSGKESLVEQWILHKLTNYSKTV 839

Query: 836  NEALDKRDFLTSTSGIYEFWYLVCDVYIENSKYLITEGTDAEKKSAKDTLYILIDNALRL 895
            NEALDKRDFL STS IYEFWYL+CD+YIENSK+LI EG++ EKKSA+DTLYIL+DNAL++
Sbjct: 840  NEALDKRDFLNSTSAIYEFWYLICDIYIENSKHLINEGSEVEKKSARDTLYILLDNALKM 899

Query: 896  IHPFMPFISEEMWQRLPKRTSEQSPTIVKASYPVYRKDFDNQKAGEEYELILDTIKEARS 955
            IHPFMPFISEEMWQ LPKR SE SP+IVKASYPVY+ +FDN+KA  +YE +LD  KEARS
Sbjct: 900  IHPFMPFISEEMWQHLPKRVSEVSPSIVKASYPVYKAEFDNEKAATDYEFVLDVTKEARS 959

Query: 956  LLAQYGILKNGKVFIESSSDAFFDTAVTQKDSIVSLIKAIDEVTVVKNVSEIPEGAVLQA 1015
            LLAQY ILKNGKVFIE+++D+ F TA +QKDS+VSLIKAIDEVTVV++ S++PEGAVLQA
Sbjct: 960  LLAQYSILKNGKVFIETNNDSLFKTAASQKDSVVSLIKAIDEVTVVRSASDVPEGAVLQA 1019

Query: 1016 VTPEVNVHVLVKGHVDIESEISKTEGKLEKAQKTKEGIDKIMNSKDYEEKANEQAKASNL 1075
            VTPEVNVHVLVKGHVDI++EISKT+ KLEKAQK+K+GI+KI+NSKDYE KANEQAK SN 
Sbjct: 1020 VTPEVNVHVLVKGHVDIDAEISKTQKKLEKAQKSKQGIEKIINSKDYEAKANEQAKESNK 1079

Query: 1076 ARLQNTLAE 1084
             +L+NT AE
Sbjct: 1080 IKLENTAAE 1088

>YGR094W (VAS1) [2054] chr7 (672188..675502) Valyl-tRNA synthetase
            (mitochondrial and cytoplasmic forms are coded from the
            same gene), member of class I family of aminoacyl-tRNA
            synthetases [3315 bp, 1104 aa]
          Length = 1104

 Score = 1723 bits (4462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 823/1069 (76%), Positives = 931/1069 (87%), Gaps = 7/1069 (0%)

Query: 21   RNKLPFVGRSASIRLASTWNSI----MSS-EQLPPVDPKTGEIIINPLKEDGSEKTPXXX 75
            R  LP   ++ S++ + T N +    MS  + LPPVDPKTGE+IINPLKEDGS KTP   
Sbjct: 22   RRSLPLC-QNFSLKKSLTHNQVRFFKMSDLDNLPPVDPKTGEVIINPLKEDGSPKTPKEI 80

Query: 76   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVVPIPEFVDKTAAGEKKILVS 135
                                                  V  PIPEF+DKT  GEKKILVS
Sbjct: 81   EKEKKKAEKLLKFAAKQAKKNAAATTGASQKKPKKKKEVE-PIPEFIDKTVPGEKKILVS 139

Query: 136  LEDPALKAYNPANVESSWYDWWVKSGFFEPEFTKEGEIKPEGLFCIPAPPPNVTGALHIG 195
            L+DPALKAYNPANVESSWYDWW+K+G FEPEFT +G++KPEG+FCIPAPPPNVTGALHIG
Sbjct: 140  LDDPALKAYNPANVESSWYDWWIKTGVFEPEFTADGKVKPEGVFCIPAPPPNVTGALHIG 199

Query: 196  HGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWAKEKKTRHDYGREAFV 255
            H LTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQ+WAK++KTRHDYGREAFV
Sbjct: 200  HALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWAKDRKTRHDYGREAFV 259

Query: 256  EKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRLHEKGVIYRANR 315
             K+WEWKE+YH RIKNQI KLGASYDWSREAFTLSPELTKSV EAFVRLH++GVIYRA+R
Sbjct: 260  GKVWEWKEEYHSRIKNQIQKLGASYDWSREAFTLSPELTKSVEEAFVRLHDEGVIYRASR 319

Query: 316  LVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLIVAT 375
            LVNWSVKLNTAISNLEVENKD+K+RTLLSVPGYDEKVEFGVLTSFAYPV+ SDEKLI+AT
Sbjct: 320  LVNWSVKLNTAISNLEVENKDVKSRTLLSVPGYDEKVEFGVLTSFAYPVIGSDEKLIIAT 379

Query: 376  TRPETMFGDTGVAVHPDDPRYKHLHGKFVQHPFLPRKIPIFCDSEAVDMNFGTGAVKMTP 435
            TRPET+FGDT VAVHPDD RYKHLHGKF+QHPFLPRKIPI  D EAVDM FGTGAVK+TP
Sbjct: 380  TRPETIFGDTAVAVHPDDDRYKHLHGKFIQHPFLPRKIPIITDKEAVDMEFGTGAVKITP 439

Query: 436  AHDQNDYNTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDARKNVIEALKQKGLYIGQ 495
            AHDQNDYNTGKRHNLEFIN+LTD GLLNE CGPEW GMKRFDARK VIE LK+K LY+GQ
Sbjct: 440  AHDQNDYNTGKRHNLEFINILTDDGLLNEECGPEWQGMKRFDARKKVIEQLKEKNLYVGQ 499

Query: 496  EDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRITITPKSSEAEYFHWL 555
            EDNEMTIPTCSRSGD+IEPLLKPQWWVSQS+MA+ AIK V+DG+ITITPKSSEAEYFHWL
Sbjct: 500  EDNEMTIPTCSRSGDIIEPLLKPQWWVSQSEMAKDAIKVVRDGQITITPKSSEAEYFHWL 559

Query: 556  ENIQDWCISRQLWWGHRCPVYFVDIEGQDNDQIDGEYWVSGRNLXXXXXXXXXXFPNAKY 615
             NIQDWCISRQLWWGHRCPVYF++IEG+++D+IDG+YWV+GR++          +PN+K+
Sbjct: 560  GNIQDWCISRQLWWGHRCPVYFINIEGEEHDRIDGDYWVAGRSMEEAEKKAAAKYPNSKF 619

Query: 616  TLKQDEDVLDTWFSSGLWPFSTLGWPDKTKDLSQFYPFSMLETGWDILFFWVSRMILLGL 675
            TL+QDEDVLDTWFSSGLWPFSTLGWP+KTKD+  FYPFSMLETGWDILFFWV+RMILLGL
Sbjct: 620  TLEQDEDVLDTWFSSGLWPFSTLGWPEKTKDMETFYPFSMLETGWDILFFWVTRMILLGL 679

Query: 676  ELTGEIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPRE 735
            +LTG +PFKEVFCHSLVRDAQGRKMSKSLGNV+DPLDV+ GIKL+DLHAKLL GNLDPRE
Sbjct: 680  KLTGSVPFKEVFCHSLVRDAQGRKMSKSLGNVIDPLDVITGIKLDDLHAKLLQGNLDPRE 739

Query: 736  VEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATK 795
            VEKAK GQKESYPNGIPQCGTDA+RFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATK
Sbjct: 740  VEKAKIGQKESYPNGIPQCGTDAMRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATK 799

Query: 796  FALIRLGEDYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYEFW 855
            FAL+RLG+DYQPP+ E LSGNESLVEKWIL+K+T  +K +NEALDKRDFLTSTS IYEFW
Sbjct: 800  FALMRLGDDYQPPATEGLSGNESLVEKWILHKLTETSKIVNEALDKRDFLTSTSSIYEFW 859

Query: 856  YLVCDVYIENSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRLPKRT 915
            YL+CDVYIENSKYLI EG+  EKKSAKDTLYIL+DNAL+LIHPFMPFISEEMWQRLPKR+
Sbjct: 860  YLICDVYIENSKYLIQEGSAIEKKSAKDTLYILLDNALKLIHPFMPFISEEMWQRLPKRS 919

Query: 916  SEQSPTIVKASYPVYRKDFDNQKAGEEYELILDTIKEARSLLAQYGILKNGKVFIESSSD 975
            +E++ +IVKASYPVY  ++D+ K+   Y+L+L+  KEARSLL++Y ILKNGKVF+ES+ +
Sbjct: 920  TEKAASIVKASYPVYVSEYDDVKSANAYDLVLNITKEARSLLSEYNILKNGKVFVESNHE 979

Query: 976  AFFDTAVTQKDSIVSLIKAIDEVTVVKNVSEIPEGAVLQAVTPEVNVHVLVKGHVDIESE 1035
             +F TA  QKDSIVSLIKAIDEVTVV++ SEIPEG VLQ+V PEVNVH+LVKGHVDI++E
Sbjct: 980  EYFKTAEDQKDSIVSLIKAIDEVTVVRDASEIPEGCVLQSVNPEVNVHLLVKGHVDIDAE 1039

Query: 1036 ISKTEGKLEKAQKTKEGIDKIMNSKDYEEKANEQAKASNLARLQNTLAE 1084
            I+K + KLEKA+K+K GI++ +NSKDYE KAN QAK +N ++L NT+AE
Sbjct: 1040 IAKVQKKLEKAKKSKNGIEQTINSKDYETKANTQAKEANKSKLDNTVAE 1088

>CAGL0G03091g 286259..289576 highly similar to sp|P07806 Saccharomyces
            cerevisiae YGR094w VAS1 valyl-tRNA synthetase,
            hypothetical start
          Length = 1105

 Score = 1708 bits (4423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 806/1041 (77%), Positives = 905/1041 (86%), Gaps = 2/1041 (0%)

Query: 46   EQLPPVDPKTGEIIINPLKEDGSEKTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XX 103
            + LPPVDPKTGE+IINPLKEDG+EKTP                                 
Sbjct: 49   DNLPPVDPKTGEVIINPLKEDGTEKTPKEIEKEKKKAEKLLKFAAKQAKKKAASNAGGNS 108

Query: 104  XXXXXXXXXXVVVPIPEFVDKTAAGEKKILVSLEDPALKAYNPANVESSWYDWWVKSGFF 163
                       V PIP FVD T  GEKKILVSL+DPALKAYNPANVESSWYDWWVKSG F
Sbjct: 109  EKKEKKKAKKEVEPIPAFVDATVPGEKKILVSLDDPALKAYNPANVESSWYDWWVKSGAF 168

Query: 164  EPEFTKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGF 223
            +PEFT +G++KPEGLFCIPAPPPNVTGALHIGH LTIAIQDSLIRYNRMKGKTVLFLPGF
Sbjct: 169  DPEFTADGKVKPEGLFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGF 228

Query: 224  DHAGIATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWS 283
            DHAGIATQSVVEKQ+WAKEKKTRHD+GR  FVEK+WEWKE+YH+RIKNQI  LGASYDW+
Sbjct: 229  DHAGIATQSVVEKQLWAKEKKTRHDFGRTKFVEKVWEWKEEYHQRIKNQIKFLGASYDWN 288

Query: 284  REAFTLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLL 343
            REAFTL P+L+KSV EAFVRLH+ G IYRA RLVNWSVKLNTAISNLEVENKD+K RTLL
Sbjct: 289  REAFTLDPQLSKSVVEAFVRLHDDGTIYRAARLVNWSVKLNTAISNLEVENKDVKGRTLL 348

Query: 344  SVPGYDEKVEFGVLTSFAYPVVDSDEKLIVATTRPETMFGDTGVAVHPDDPRYKHLHGKF 403
            SVP YDEKVEFGVLTSFAYPV DSDEKL++ATTRPET+FGDT +AVHPDD RYKHLHGKF
Sbjct: 349  SVPNYDEKVEFGVLTSFAYPVADSDEKLVIATTRPETIFGDTAIAVHPDDARYKHLHGKF 408

Query: 404  VQHPFLPRKIPIFCDSEAVDMNFGTGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLN 463
            VQHPFLPRK+PI CDSEAVDM FGTGAVK+TPAHDQNDYNTGKRHNLEFIN+LTD GLLN
Sbjct: 409  VQHPFLPRKLPIICDSEAVDMEFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLN 468

Query: 464  ENCGPEWAGMKRFDARKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVS 523
            ENCGPEW GMKRFDARK VIE +K+  LYIGQEDNEMTIPTCSRSGD+IEPLLKPQWWV+
Sbjct: 469  ENCGPEWQGMKRFDARKKVIEDMKKLNLYIGQEDNEMTIPTCSRSGDIIEPLLKPQWWVA 528

Query: 524  QSQMAEKAIKAVKDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQ 583
            Q +MA+ AIKAVK+G I I PKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYF+DIEGQ
Sbjct: 529  QGEMAKDAIKAVKNGEIKIAPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFIDIEGQ 588

Query: 584  DNDQIDGEYWVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDK 643
            +ND+ DG YWV+GR+L          FP+AK+TL QDEDVLDTWFSSGLWPFSTLGWPDK
Sbjct: 589  ENDRNDGNYWVAGRDLAEAETKAKAKFPDAKFTLHQDEDVLDTWFSSGLWPFSTLGWPDK 648

Query: 644  TKDLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKS 703
            TKD+  FYPFSMLETGWDILFFWV+RMILLG++LTG +PF EVFCHSLVRDAQGRKMSKS
Sbjct: 649  TKDMEDFYPFSMLETGWDILFFWVTRMILLGIKLTGSVPFNEVFCHSLVRDAQGRKMSKS 708

Query: 704  LGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFAL 763
            LGNVVDPLDV+ GIKLEDLHAKLL GNLDPREVEKAK GQKESYPNGIPQCGTDA+RFAL
Sbjct: 709  LGNVVDPLDVITGIKLEDLHAKLLMGNLDPREVEKAKLGQKESYPNGIPQCGTDAMRFAL 768

Query: 764  CAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALIRLGEDYQPPSMEKLSGNESLVEKW 823
            CAYTTGGRDINLDILRVEGYRKFCNKIYQATKFAL+RLG+DY PP+ E LSGNESLVEKW
Sbjct: 769  CAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYVPPAKEGLSGNESLVEKW 828

Query: 824  ILNKMTNYAKSINEALDKRDFLTSTSGIYEFWYLVCDVYIENSKYLITEGTDAEKKSAKD 883
            IL+K+T  ++++N+AL+KRDFLTSTS IYEFWYL+CDVYIENSK+LI EG+D EKKSA+D
Sbjct: 829  ILHKLTKTSQTVNDALEKRDFLTSTSAIYEFWYLICDVYIENSKHLIQEGSDLEKKSARD 888

Query: 884  TLYILIDNALRLIHPFMPFISEEMWQRLPKRTSEQSPTIVKASYPVYRKDFDNQKAGEEY 943
            TLYIL+DNAL+LIHPFMPFISEEMWQR+PKR++E   TIV+ASYPVY+K +D++K+   Y
Sbjct: 889  TLYILLDNALKLIHPFMPFISEEMWQRIPKRSTETVNTIVRASYPVYQKVYDDEKSAASY 948

Query: 944  ELILDTIKEARSLLAQYGILKNGKVFIESSSDAFFDTAVTQKDSIVSLIKAIDEVTVVKN 1003
            EL+LD  KEARSLLA+Y ILK GKVF+ES     F+TA +QKDSIVSLIKAI+EV VV++
Sbjct: 949  ELVLDITKEARSLLAEYNILKEGKVFVESDHTESFETAQSQKDSIVSLIKAINEVDVVRS 1008

Query: 1004 VSEIPEGAVLQAVTPEVNVHVLVKGHVDIESEISKTEGKLEKAQKTKEGIDKIMNSKDYE 1063
             SEIPEG VL+AV P+VNVH+LVKGH+DI++EI+K E K+EKA+KTK+GI++I+N KDY+
Sbjct: 1009 ASEIPEGCVLKAVNPQVNVHLLVKGHIDIDAEIAKVEKKIEKARKTKQGIEQIINGKDYD 1068

Query: 1064 EKANEQAKASNLARLQNTLAE 1084
             KANEQAK +N  RL+N++A+
Sbjct: 1069 TKANEQAKEANKVRLENSIAD 1089

>KLLA0D14971g 1263323..1266598 highly similar to sp|P07806
            Saccharomyces cerevisiae YGR094w VAS1 valyl-tRNA
            synthetase, start by similarity
          Length = 1091

 Score = 1697 bits (4394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 805/1062 (75%), Positives = 905/1062 (85%), Gaps = 5/1062 (0%)

Query: 24   LPFVGRSASIRLASTWNSIMSSEQLPPVDPKTGEIIINPLKEDGSEKTPXXXXXXXXXXX 83
            LP    S +IR  ST       + LP VD KTGEIIINPLKEDG++K+P           
Sbjct: 18   LPTSSLSITIRKMST----EPKQDLPQVDEKTGEIIINPLKEDGTQKSPKEIEKEKKKAE 73

Query: 84   XXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXVVVPIPEFVDKTAAGEKKILVSLEDPALK 142
                                              PIPEFVDKT AGEKKILVSL+DPALK
Sbjct: 74   KLLKFAAKQAKQAQNQAGQAKNAAKKEKKKKETEPIPEFVDKTVAGEKKILVSLDDPALK 133

Query: 143  AYNPANVESSWYDWWVKSGFFEPEFTKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAI 202
            AYNPANVESSWY+WW KSGFFEPEFTK+G+IKPEG+F IPAPPPNVTG+LHIGH LTIAI
Sbjct: 134  AYNPANVESSWYEWWNKSGFFEPEFTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAI 193

Query: 203  QDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWK 262
            QDSL RY RMKGKTVLFLPGFDHAGIATQSVVEKQ+WA EKKTRHDYGRE FV+K+WEWK
Sbjct: 194  QDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWASEKKTRHDYGREEFVDKVWEWK 253

Query: 263  EDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVK 322
            E+YHK+IKNQ+ KLGASYDWSREAFTL P+L+K+V EAFV+LHE+G+IYRA RLVNWSVK
Sbjct: 254  EEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVK 313

Query: 323  LNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLIVATTRPETMF 382
            LNTAISNLEVENKDIK +TLLSVPGYDEKVEFGVLTSF+YPVV SDEKLIVATTRPETMF
Sbjct: 314  LNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDEKLIVATTRPETMF 373

Query: 383  GDTGVAVHPDDPRYKHLHGKFVQHPFLPRKIPIFCDSEAVDMNFGTGAVKMTPAHDQNDY 442
            GDT VA+HPDD RYKHLHG FVQHPFL RK+PI CD+EAVDM FGTGAVK+TPAHDQNDY
Sbjct: 374  GDTAVAIHPDDERYKHLHGHFVQHPFLNRKMPIVCDAEAVDMEFGTGAVKITPAHDQNDY 433

Query: 443  NTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDARKNVIEALKQKGLYIGQEDNEMTI 502
            NTG RHNLE IN  TD GLLNENCGPEW G +RFDARK VIE LK+KGL++GQ+DNEMTI
Sbjct: 434  NTGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDARKLVIEKLKEKGLFVGQKDNEMTI 493

Query: 503  PTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRITITPKSSEAEYFHWLENIQDWC 562
            PTCSRSGD+IEPLLKPQWWVSQ QMAE+AIK V++G ITITPKSSE+EYFHWLENIQDWC
Sbjct: 494  PTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEITITPKSSESEYFHWLENIQDWC 553

Query: 563  ISRQLWWGHRCPVYFVDIEGQDNDQIDGEYWVSGRNLXXXXXXXXXXFPNAKYTLKQDED 622
            ISRQLWWGHRCPVYFV+IEG++ND+ D  +WVSGRNL          F + KYTL+QDED
Sbjct: 554  ISRQLWWGHRCPVYFVNIEGEENDRNDNSFWVSGRNLEEAEAKAATKFADKKYTLEQDED 613

Query: 623  VLDTWFSSGLWPFSTLGWPDKTKDLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIP 682
            VLDTWFSSGL+PFSTLGWPDKT D+SQFYP SMLETGWDILFFWVSRMILLGL+LTG IP
Sbjct: 614  VLDTWFSSGLYPFSTLGWPDKTPDMSQFYPASMLETGWDILFFWVSRMILLGLKLTGSIP 673

Query: 683  FKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAG 742
            FKEVFCHSLVRDAQGRKMSKSLGNVVDPLDV+ GIKLEDLHAKLL GNLDPREVEKAK G
Sbjct: 674  FKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNG 733

Query: 743  QKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALIRLG 802
            QKESYP+GIP+CGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFAL+RLG
Sbjct: 734  QKESYPHGIPECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLG 793

Query: 803  EDYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYEFWYLVCDVY 862
            +DY+PP+ E LSGNESLVEKWIL+++T  AK++NEA +KRDFL STS IYEFWYLVCDVY
Sbjct: 794  DDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFWYLVCDVY 853

Query: 863  IENSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRLPKRTSEQSPTI 922
            IENSKYLI EGT+ ++KSAKDTLYILIDNAL++IHPFMPFISEEMWQ LP+  SE SPTI
Sbjct: 854  IENSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHLPRYASETSPTI 913

Query: 923  VKASYPVYRKDFDNQKAGEEYELILDTIKEARSLLAQYGILKNGKVFIESSSDAFFDTAV 982
            VK+SYP ++++F N  A +EYELIL+  K+ARSLLAQY ILKNGKVF+ES++++++ T  
Sbjct: 914  VKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNILKNGKVFVESANESYYSTVQ 973

Query: 983  TQKDSIVSLIKAIDEVTVVKNVSEIPEGAVLQAVTPEVNVHVLVKGHVDIESEISKTEGK 1042
            +QKDSIVSLIKAIDEV+VVK+ ++IP+G VLQ+V PEVNVHVLVKGHVDI++EISK + K
Sbjct: 974  SQKDSIVSLIKAIDEVSVVKSAADIPQGCVLQSVNPEVNVHVLVKGHVDIDAEISKVQKK 1033

Query: 1043 LEKAQKTKEGIDKIMNSKDYEEKANEQAKASNLARLQNTLAE 1084
            L+K  K+K  IDKI+NS DYE+KAN+Q K  N  R ++  AE
Sbjct: 1034 LDKTLKSKSAIDKIVNSSDYEQKANDQVKQFNKERSEHAAAE 1075

>Scas_705.21
          Length = 1061

 Score = 1691 bits (4380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 798/1039 (76%), Positives = 892/1039 (85%), Gaps = 2/1039 (0%)

Query: 48   LPPVDPKTGEIIINPLKEDGSEKTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 107
            LPPVDP TGE IINPLKEDG+ KTP                                   
Sbjct: 7    LPPVDPTTGEPIINPLKEDGTAKTPKEIEKEKKKAEKLLKFAAKQAKKKAAAATANPQKK 66

Query: 108  XXXXXXVVVPIPEFVDKTAAGEKKILVSLEDPALKAYNPANVESSWYDWWVKSGFFEPEF 167
                     PIPEFVDKT  GEKK+LVSL+DP+LK+YNPANVESSWYDWWVKSGFFEPEF
Sbjct: 67   AKKPKKEAEPIPEFVDKTVPGEKKVLVSLDDPSLKSYNPANVESSWYDWWVKSGFFEPEF 126

Query: 168  TKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAG 227
            T++GEIKPEGLFCIP PPPNVTGALHIGH LTI+IQDSLIRYNRMKGKTVLFLPGFDHAG
Sbjct: 127  TEDGEIKPEGLFCIPCPPPNVTGALHIGHALTISIQDSLIRYNRMKGKTVLFLPGFDHAG 186

Query: 228  IATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAF 287
            IATQSVVEKQ+WAKEKKTRHDYGR  FV K+WEWK++YH RIKNQI  LGASYDW+REAF
Sbjct: 187  IATQSVVEKQMWAKEKKTRHDYGRTEFVNKVWEWKDEYHNRIKNQIKNLGASYDWTREAF 246

Query: 288  TLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPG 347
            TL P+LT +V EAFVRLH+ G IYRA+RLVNWSVKLNTAISNLEVENKD+K RTLLSVP 
Sbjct: 247  TLDPKLTNAVVEAFVRLHDDGTIYRASRLVNWSVKLNTAISNLEVENKDVKGRTLLSVPN 306

Query: 348  YDEKVEFGVLTSFAYPVVDSD--EKLIVATTRPETMFGDTGVAVHPDDPRYKHLHGKFVQ 405
            YDEKVEFGVLTSFAYPV DS+  EKLI+ATTRPET+FGDT +AVHPDDPRY HLHGKFVQ
Sbjct: 307  YDEKVEFGVLTSFAYPVADSETGEKLIIATTRPETLFGDTAIAVHPDDPRYTHLHGKFVQ 366

Query: 406  HPFLPRKIPIFCDSEAVDMNFGTGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLNEN 465
            HPFLPRK+PI  D EAVDM FGTGAVK+TPAHDQNDY TGKRHNLEFIN+LTD GLLNEN
Sbjct: 367  HPFLPRKLPIVLDKEAVDMEFGTGAVKITPAHDQNDYQTGKRHNLEFINILTDNGLLNEN 426

Query: 466  CGPEWAGMKRFDARKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQS 525
            CGPEW GM+RFDARK VIE LK+ GLYIGQEDNEMTIPTCSRSGD+IEPLLKPQWWV+Q 
Sbjct: 427  CGPEWEGMRRFDARKAVIEKLKEMGLYIGQEDNEMTIPTCSRSGDIIEPLLKPQWWVAQG 486

Query: 526  QMAEKAIKAVKDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDN 585
             MA++AIK VK+G +TITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYF+ IEG+++
Sbjct: 487  DMAKEAIKVVKNGEVTITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFIKIEGRED 546

Query: 586  DQIDGEYWVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDKTK 645
            D+ DG +WV+GRNL          +PN K+TL+QDEDVLDTWFSSGLWPFSTLGWP+KT 
Sbjct: 547  DRNDGTFWVAGRNLAEAEEKAKAKYPNEKFTLEQDEDVLDTWFSSGLWPFSTLGWPEKTA 606

Query: 646  DLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKSLG 705
            DL  FYPFSMLETGWDILFFWVSRMILLGL+LTG +PFKEVFCHSLVRDAQGRKMSKSLG
Sbjct: 607  DLEHFYPFSMLETGWDILFFWVSRMILLGLKLTGSVPFKEVFCHSLVRDAQGRKMSKSLG 666

Query: 706  NVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCA 765
            NVVDPLDV+ GIKLEDLHAKLL GNLDPREVEKAK GQKESYPNGIPQCGTDA+RFALCA
Sbjct: 667  NVVDPLDVISGIKLEDLHAKLLLGNLDPREVEKAKLGQKESYPNGIPQCGTDAMRFALCA 726

Query: 766  YTTGGRDINLDILRVEGYRKFCNKIYQATKFALIRLGEDYQPPSMEKLSGNESLVEKWIL 825
            YTTGGRDINLDILRVEGYRKFCNKIYQATKFAL+RLG+DYQPP+ + LSG ESLVEKWIL
Sbjct: 727  YTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYQPPAEKHLSGKESLVEKWIL 786

Query: 826  NKMTNYAKSINEALDKRDFLTSTSGIYEFWYLVCDVYIENSKYLITEGTDAEKKSAKDTL 885
            +K+T  +K +NEAL+KRDFL STS IYEFWYLVCDVYIENSKYLI EG+  E+KSAKDTL
Sbjct: 787  HKLTTTSKVVNEALEKRDFLNSTSAIYEFWYLVCDVYIENSKYLIQEGSPEEQKSAKDTL 846

Query: 886  YILIDNALRLIHPFMPFISEEMWQRLPKRTSEQSPTIVKASYPVYRKDFDNQKAGEEYEL 945
            Y LI++AL+LIHPFMPFISEE+WQRLPKR +E S TIVKASYPVY ++FDN+ A   YEL
Sbjct: 847  YTLIEDALKLIHPFMPFISEELWQRLPKRATETSNTIVKASYPVYEQEFDNESAANAYEL 906

Query: 946  ILDTIKEARSLLAQYGILKNGKVFIESSSDAFFDTAVTQKDSIVSLIKAIDEVTVVKNVS 1005
            +LD  KEARSLLA+Y ILKNGKV++ES+ D  F+T  +QKDSIVS+IKAIDEVTVV+  S
Sbjct: 907  VLDVTKEARSLLAEYNILKNGKVYVESNHDESFETTTSQKDSIVSMIKAIDEVTVVRKSS 966

Query: 1006 EIPEGAVLQAVTPEVNVHVLVKGHVDIESEISKTEGKLEKAQKTKEGIDKIMNSKDYEEK 1065
            EIPEG VL+AV P+VNVH+LVKGH+DIE+EI+K + KLEKA K+K+ I++ +  KDYE K
Sbjct: 967  EIPEGCVLKAVNPDVNVHLLVKGHIDIEAEIAKVQKKLEKANKSKQNIEQTIGRKDYESK 1026

Query: 1066 ANEQAKASNLARLQNTLAE 1084
            AN+QAK +N  +L+N++AE
Sbjct: 1027 ANDQAKEANKVKLENSVAE 1045

>AAR034W [220] [Homologous to ScYGR094W (VAS1) - SH]
            complement(402706..406002) [3297 bp, 1098 aa]
          Length = 1098

 Score = 1662 bits (4303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 789/1059 (74%), Positives = 890/1059 (84%), Gaps = 4/1059 (0%)

Query: 29   RSASIRLASTWNSIMSSEQLPPVDPKTGEIIINPLKEDGSEKTPXXXXXXXXXXXXX-XX 87
            RS   R+     ++ + +QLP VD   GEIIINPLKEDGS KT                 
Sbjct: 25   RSIFERIRPQSVAMSTEQQLPEVDA-NGEIIINPLKEDGSPKTAKEVEKERKKAEKLLKF 83

Query: 88   XXXXXXXXXXXXXXXXXXXXXXXXXXVVVPIPEFVDKTAAGEKKILVSLEDPALKAYNPA 147
                                          + EFVD+T  GEKKIL SL+DPALKAYNPA
Sbjct: 84   AAKQAKKAENKANQQKNQTKKEKKKKETEAVVEFVDETVPGEKKILKSLDDPALKAYNPA 143

Query: 148  NVESSWYDWWVKSGFFEPEFTKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLI 207
            NVESSWYDWWVKSGFFEPE TK+G+IKPEG+FCIPAPPPNVTGALHIGH LTIAIQDSLI
Sbjct: 144  NVESSWYDWWVKSGFFEPELTKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLI 203

Query: 208  RYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHK 267
            RYNRMKGKTVLFLPGFDHAGIATQSVVEKQ+WA EKKTRHDYGRE FV+K+W+WKE YH 
Sbjct: 204  RYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHA 263

Query: 268  RIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAI 327
            +IK+Q+ +LGASYDWSREAFTL PEL++SVTEAFVRLHE+GVIYRA+RLVNWSVKLNTAI
Sbjct: 264  KIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAI 323

Query: 328  SNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLIVATTRPETMFGDTGV 387
            SNLEVENK+I  +TLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLI+ATTRPETMFGDT +
Sbjct: 324  SNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLIIATTRPETMFGDTAI 383

Query: 388  AVHPDDPRYKHLHGKFVQHPFLPRKIPIFCDSEAVDMNFGTGAVKMTPAHDQNDYNTGKR 447
            A+HPDDPRYKHLHGKFVQHPFLPRK+PI CD+EAVDM FGTGAVK+TP HDQNDYNTGKR
Sbjct: 384  AIHPDDPRYKHLHGKFVQHPFLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQNDYNTGKR 443

Query: 448  HNLEFINVLTDTGLLNENCGPEWAGMKRFDARKNVIEALKQKGLYIGQEDNEMTIPTCSR 507
            H+LE IN+LTD GLLNENCGPEW GMKRFDARK VIE L++ GL++ Q+DNEM IPTCSR
Sbjct: 444  HDLEIINILTDDGLLNENCGPEWQGMKRFDARKRVIEKLQELGLFVSQQDNEMVIPTCSR 503

Query: 508  SGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRITITPKSSEAEYFHWLENIQDWCISRQL 567
            SGDVIEP+LKPQWWVSQ +MA++AI AVKDGRITITPKSS +EYFHWLENIQDWCISRQL
Sbjct: 504  SGDVIEPILKPQWWVSQGEMAKEAINAVKDGRITITPKSSASEYFHWLENIQDWCISRQL 563

Query: 568  WWGHRCPVYFVDIEGQDNDQIDGEYWVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTW 627
            WWGHRCPVYFV+IEG++  + +G YWVSGRNL          FPN  YTL+QDEDVLDTW
Sbjct: 564  WWGHRCPVYFVNIEGKEQSRNEGTYWVSGRNLEEAQKKAAEKFPNEVYTLEQDEDVLDTW 623

Query: 628  FSSGLWPFSTLGWPDKTKDLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIPFKEVF 687
            FSSGLWPFSTLGWPDKT D+S FYPFSMLETGWDIL+FWV+RMILLG++LTG +PF EVF
Sbjct: 624  FSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGWDILYFWVARMILLGIKLTGNVPFNEVF 683

Query: 688  CHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESY 747
            CHSLVRDAQGRKMSKSLGNVVDPL V+ G  LE+LHA L  GNLDPREVEKAKAGQKESY
Sbjct: 684  CHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESY 743

Query: 748  PNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALIRLGEDYQP 807
            PNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFAL+RLG+DY P
Sbjct: 744  PNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYVP 803

Query: 808  PSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYEFWYLVCDVYIENSK 867
            P+ E+LSGNESLVEKWIL+++++ AK++NEA DKRDFLTSTS IY+FWYL+CDVYIENSK
Sbjct: 804  PAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIENSK 863

Query: 868  YLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRLPKRTSEQSPTIVKASY 927
            YLI EGTD EKKSA+DTLY L+DNALRLIHPFMPFISEEMWQ LPKR SE S +IVKA Y
Sbjct: 864  YLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQHLPKRASETSESIVKAKY 923

Query: 928  PVYRKDFDNQKAGEEYELILDTIKEARSLLAQYGILKNGKVFIE--SSSDAFFDTAVTQK 985
            PV+R+DF ++++  +Y L+L   KEARSLLA+Y I+KNGKVFIE   ++D  F    +Q 
Sbjct: 924  PVFRQDFFDEESAADYNLVLSATKEARSLLAEYNIVKNGKVFIEVQGNNDKVFTCLNSQS 983

Query: 986  DSIVSLIKAIDEVTVVKNVSEIPEGAVLQAVTPEVNVHVLVKGHVDIESEISKTEGKLEK 1045
             SIVSLIKAID+VTVV++ +EIPEG VL +VTP+VNVH LVKG VDI++EI K   KL+K
Sbjct: 984  ASIVSLIKAIDQVTVVRSATEIPEGCVLSSVTPDVNVHALVKGQVDIDTEIQKFNKKLDK 1043

Query: 1046 AQKTKEGIDKIMNSKDYEEKANEQAKASNLARLQNTLAE 1084
            AQK+KE I+K++ S DYE KANEQAK +N  RL +  AE
Sbjct: 1044 AQKSKEAIEKVVGSSDYETKANEQAKKANKDRLDSIAAE 1082

>Scas_716.31*
          Length = 1019

 Score = 1252 bits (3240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/962 (61%), Positives = 742/962 (77%), Gaps = 15/962 (1%)

Query: 130  KKILVSLEDPALKAYNPANVESSWYDWWVKSGFFEPEFTKEGEIKPEGLFCIPAPPPNVT 189
            KK+L  L    LKAY+P   E +WY WW + G F+PEFTK+G+IK EGLFCIPAPPPNVT
Sbjct: 42   KKVLPPLNSIELKAYDPEICEKNWY-WWDQIGAFKPEFTKDGKIKAEGLFCIPAPPPNVT 100

Query: 190  GALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWAKEKKTRHDY 249
            GALH+GH LTIAIQDSLIRY RMKGKTVLFLPGFDHAGIATQSVVEKQ+W +EKKTR+DY
Sbjct: 101  GALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDY 160

Query: 250  GREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRLHEKGV 309
            GR+ F++K WEWKE YHKRIKNQ+ +LGASYDWSREAFTL P+L+ +V EAFVRLH+ G+
Sbjct: 161  GRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGI 220

Query: 310  IYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFAYPVVDSD- 368
            IYRA+RLVNWSVKL T ISNLEV+NK I  RTLL+VP Y +K+EFGVL   AYPV+DS+ 
Sbjct: 221  IYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVIDSNT 280

Query: 369  -EKLIVATTRPETMFGDTGVAVHPDDPRYKHLHGKFVQHPFLPRKIPIFCDSEAVDMNFG 427
             E++IVATTRPET+FGD  +A+HP+D RYKHLHGKFVQHP +P+KIPI  D+ AVDM FG
Sbjct: 281  NERIIVATTRPETLFGDVAIAIHPEDSRYKHLHGKFVQHPLIPKKIPIILDATAVDMTFG 340

Query: 428  TGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDARKNVIEALK 487
            TGAVK+TPAHDQNDYN GKRH+L+F+N+ TD GLLNENCG  W G+KRFDAR+ VI+ LK
Sbjct: 341  TGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVIDELK 400

Query: 488  QKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRITITPKSS 547
            +KG ++ QEDN M IP CSRSGDVIEPLLK     S     + + +      I  +  ++
Sbjct: 401  RKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNGG-SHKINGQDSDRYCGKREIRFSSSNT 459

Query: 548  EAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDN----DQIDGEYWVSGRNLXXXX 603
            + +YF WLENIQDWCISRQLWWGHRCPVYF+++EG ++    ++ DG+YWV+GRNL    
Sbjct: 460  KNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLEEAV 519

Query: 604  XXXXXXFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDKTKDLSQFYPFSMLETGWDIL 663
                  FPN K++L+QD+DVLDTWFSS LWPFSTLGWP+KT D++ FYPFSMLETGWDIL
Sbjct: 520  HKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGWDIL 579

Query: 664  FFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLEDLH 723
            FFWV+RMI+LG++LTG IPFKEV+CHSLVRD +GRKMSKSLGNV+DPLD++ G  L++LH
Sbjct: 580  FFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELH 639

Query: 724  AKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGY 783
             KL  GNLDP++++K K  QK+ YP GIPQCG+DALRFALCAYTTGGRDINLDI RVEGY
Sbjct: 640  EKLQQGNLDPKKIDKMKIEQKKMYPRGIPQCGSDALRFALCAYTTGGRDINLDISRVEGY 699

Query: 784  RKFCNKIYQATKFALIRLGEDYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRD 843
            RKFCNKIYQATKF++ RLG+DYQPPS      ++SLVEKWIL +M N    +N++ +KRD
Sbjct: 700  RKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFEKRD 759

Query: 844  FLTSTSGIYEFWYLVCDVYIENSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFI 903
            FLT TS IYE WY++CDVYIEN K+L  +     +K+AKDTL+ LI+N L++IHPFMP++
Sbjct: 760  FLTCTSKIYELWYMICDVYIENFKWLANDTI--MEKAAKDTLHTLIENGLKMIHPFMPYL 817

Query: 904  SEEMWQRLPKRTS-EQSPTIVKASYPVYRKDFDNQKAGEEYELILDTIKEARSLLAQYGI 962
            SEE+WQRLP     ++S +I+K  YP   +DF+  K  ++Y+ IL  IK  RSLL++Y I
Sbjct: 818  SEELWQRLPDGIGKDESSSIMKTLYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSEYNI 877

Query: 963  LKNGKVFIESSSDAFFDTAVTQKDSIVSLIKAIDEVT---VVKNVSEIPEGAVLQAVTPE 1019
              N + F E   D  FD    +KD+I+S++K ++ ++   V  +   I    V  +++ +
Sbjct: 878  TANARFFFEILDDELFDIVRAEKDAILSVMKGVENISFLAVAPDRQPIKNDCVSCSISSQ 937

Query: 1020 VNVHVLVKG-HVDIESEISKTEGKLEKAQKTKEGIDKIMNSKDYEEKANEQAKASNLARL 1078
            VNV++LVKG + DI  E+SK   +LEK         +++ +KD+ +KA+E+ +  N  +L
Sbjct: 938  VNVYLLVKGQYKDISKELSKQLKQLEKLNNIYAATQRMLTNKDFIKKASEEIREMNEKKL 997

Query: 1079 QN 1080
             N
Sbjct: 998  IN 999

>Scas_97.1*
          Length = 261

 Score =  434 bits (1115), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 222/252 (88%), Gaps = 8/252 (3%)

Query: 348 YDEKVEFGVLTSFAYPVVDS--DEKLIVATTRPETMFGDTGVAVHPDDPRYKHLHGKFVQ 405
           YDEKV +     F  P++ S  DEKLI+ATTRPETMF       HP+DPRYKHLHGKFVQ
Sbjct: 1   YDEKVNW-----FLTPLLSSRSDEKLIIATTRPETMFVHC-YCCHPEDPRYKHLHGKFVQ 54

Query: 406 HPFLPRKIPIFCDSEAVDMNFGTGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLNEN 465
           HPFLPRK+PI CDSEAVDM FGTGAVK+TPAHDQNDYNTGKRHNLEFIN+LTD GLLNEN
Sbjct: 55  HPFLPRKLPIVCDSEAVDMEFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNEN 114

Query: 466 CGPEWAGMKRFDARKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQS 525
           CGPEW GMKRFDARK V+E LK  GLYIGQEDNEMTIP CSRSGD+IEPLLKPQWWVSQ+
Sbjct: 115 CGPEWCGMKRFDARKKVVEELKNAGLYIGQEDNEMTIPICSRSGDIIEPLLKPQWWVSQT 174

Query: 526 QMAEKAIKAVKDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDN 585
           +MA++AIKAV++G ITITPKSSE+EYFHWLENIQDWCISRQLWWGHRCPVYFV IEG+DN
Sbjct: 175 EMAKEAIKAVRNGDITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVKIEGEDN 234

Query: 586 DQIDGEYWVSGR 597
           D+ DG+YWVSGR
Sbjct: 235 DKNDGKYWVSGR 246

>CAGL0G03311g 315470..318688 highly similar to sp|P09436
           Saccharomyces cerevisiae YBL076c ILS1 isoleucyl-tRNA
           synthetase, start by similarity
          Length = 1072

 Score =  178 bits (451), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 210/836 (25%), Positives = 341/836 (40%), Gaps = 159/836 (19%)

Query: 166 EFTKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDH 225
           E TK+   KPE  F     PP  TG  H GH L   I+D + RY  M G  V    G+D 
Sbjct: 32  ELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKDIVPRYATMTGHHVERRFGWDT 86

Query: 226 AGIATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSRE 285
            G+  + +++K++  K K+    YG + +  +       Y    +  I +LG   D+  +
Sbjct: 87  HGVPIEHIIDKKLGIKGKEDVFKYGLDNYNNECRAIVMTYADEWRKTIGRLGRWIDFDND 146

Query: 286 AFTLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVEN--KDIKARTLL 343
             T+ P   +SV  AF +LHEKG +YR  R++ +S  L T +SN E +   KD+      
Sbjct: 147 YKTMYPSFMESVWWAFKQLHEKGQVYRGFRVMPYSTGLTTPLSNFEAQQNYKDVN----- 201

Query: 344 SVPGYDEKVEFGVLTSFAYPVVDSDE-KLIVATTRPETMFGDTGVAVHPD---------- 392
                D  V  G      + V+  ++ KL+  TT P T+  +  + V+P+          
Sbjct: 202 -----DPAVTIG------FNVIGQEKTKLVAWTTTPWTLPSNLALCVNPEFEYVKIYDEN 250

Query: 393 --------DPRYKHLHGKFVQHPF-LPRKI-----------PIF--------------CD 418
                   +   K L+ K     + +  KI           PIF                
Sbjct: 251 KDCYFILLESLIKTLYKKPAAEKYKIVEKIKGSELVGLKYEPIFPYFYEQMKETAFRVIA 310

Query: 419 SEAVDMNFGTGAVKMTPAHDQNDY-----NTGKRHNLEFINVLTDTGLLNENCGPEWAGM 473
            + V  + GTG V   P+  + DY     N     +    N + D G    +   ++AG+
Sbjct: 311 GDYVTADSGTGIVHNAPSFGEEDYAVCLENGVISEDTVAPNPVDDNGKFTSDV-TDFAGI 369

Query: 474 KRFDARKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLK---PQWWVSQSQMAEK 530
              DA K +I+ L + G  +       + P C RS     PLL    P W+V   ++A K
Sbjct: 370 YVKDADKLIIKHLTETGNLLLASQIRHSYPFCWRSD---TPLLYRSVPAWFVRVKEIAPK 426

Query: 531 AIKAVKDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDI--------EG 582
            + +V +    +     E  + +W+ N +DW +SR  +WG   P++  D           
Sbjct: 427 MLDSVMNSH-WVPNTIKEKRFANWIANARDWNVSRNRYWGTPIPLWVSDDFEEIVCVGSI 485

Query: 583 QDNDQIDGEYWVSGRNLXXXXXXXXXXFPN--AKYTLKQDEDVLDTWFSSGLWPFSTLGW 640
           ++ +Q+ G   V                P+   K  LK+ E+V D WF SG  P+++  +
Sbjct: 486 EELEQLSG---VKNITDLHRDKIDHITIPSKMGKGDLKRIEEVFDCWFESGSMPYASQHY 542

Query: 641 P-DKTKDLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRK 699
           P + T+  S   P + +  G D    W   + +LG  L GE+P+K V    +V  + GRK
Sbjct: 543 PFENTEKFSDRVPANFISEGLDQTRGWFYTLSVLGTHLFGEVPYKNVIVSGIVLASDGRK 602

Query: 700 MSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDAL 759
           MSKSL N  DP      I LE                                + G DAL
Sbjct: 603 MSKSLKNYPDP-----NIVLE--------------------------------KYGADAL 625

Query: 760 RFALCAYTTGGRDINLDILRV-------EGYRKFCNKI----YQATKF-----ALIRLGE 803
           R  L         IN  +L+        EG ++   K+    + + KF     AL++   
Sbjct: 626 RLYL---------INSPVLKAESLKFKEEGVKEVVTKVLLPWWNSYKFLEGQLALLKKTS 676

Query: 804 DYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYEFWYLVCDVYI 863
           D       KLS +++++++WIL  M +  + I++ +      T    +  F   + + YI
Sbjct: 677 DVDFKYDPKLS-SDNVMDRWILASMQSLVQFIHQEMAVYKLYTVVPKLLHFIDELTNWYI 735

Query: 864 E-NSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRLPKRTSEQ 918
             N + L  E    +   A +TL+  +    R + PF PF+++ ++QRL     E+
Sbjct: 736 RFNRRRLKGENGVDDCLKALNTLFDALFTFARAMAPFTPFLADGIYQRLRAYIPEE 791

>Scas_599.13
          Length = 1071

 Score =  177 bits (448), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 201/851 (23%), Positives = 344/851 (40%), Gaps = 149/851 (17%)

Query: 166 EFTKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDH 225
           E TK+   KPE  F     PP  TG  H GH L   I+D + RY  M G  V    G+D 
Sbjct: 32  ELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKDIVPRYATMTGHHVERRFGWDT 86

Query: 226 AGIATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSRE 285
            G+  + +++K++  K K+    YG + +  +       Y +  +  I +LG   D+  +
Sbjct: 87  HGVPIEHIIDKKLGIKGKEDVFKYGIDNYNNECRSIVMTYAEDWRKTIGRLGRWIDFDND 146

Query: 286 AFTLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVEN--KDIKARTLL 343
             T+ P   +S   AF +L EK  +YR  R++ +S  L T +SN E +   KD+      
Sbjct: 147 YKTMYPSYMESTWWAFKQLFEKQQVYRGYRVMPYSTGLTTPLSNFEAQQNYKDVN----- 201

Query: 344 SVPGYDEKVEFGVLTSFAYPVVDSDEKLIVA-TTRPETMFGDTGVAVHPD---------- 392
                D  V  G      + V+  ++  +VA TT P T+  +  + V+PD          
Sbjct: 202 -----DPAVTIG------FNVIGQEKTQLVAWTTTPWTLPSNMALCVNPDFEYVKIYDEK 250

Query: 393 --------------------DPRYK---HLHGK----FVQHPFLPRKIPIFCDSE----- 420
                               D +YK    + G         P  P     F D+      
Sbjct: 251 KDRYYILLESLIKSLYKKPKDEKYKVVEKIKGSDLVGLKYEPLFPYFAEEFKDTAFRVIS 310

Query: 421 --AVDMNFGTGAVKMTPAHDQNDYNTGKRHNL-----EFINVLTDTGLLNENCGPEWAGM 473
              V    GTG V   PA  + DY    R  +      F N L D G        ++AG+
Sbjct: 311 DGYVTSESGTGIVHNAPAFGEEDYTICTREGIVSEGANFPNPLDDLGRFTSEV-TDFAGV 369

Query: 474 KRFDARKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIK 533
              DA K +I+ L   G  +       + P C RS   +     P W+V    +  + ++
Sbjct: 370 YVKDADKLIIKHLTATGNMLYHTQIRHSYPFCWRSDTPLLYRAVPAWFVRVRNIVPQMLE 429

Query: 534 AVKDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVD-----IEGQDNDQI 588
           +V+     +     E  + +W+ N +DW +SR  +WG   P++  D     +     +++
Sbjct: 430 SVEKSH-WVPNVIKEKRFANWIANARDWNVSRNRYWGTPIPLWVSDDFKEIVCIGSVEEL 488

Query: 589 DGEYWVSGRNLXXXXXXXXXXFPN--AKYTLKQDEDVLDTWFSSGLWPFSTLGWP-DKTK 645
           +    V+G              P+   K  LK+ E+V D WF SG  P+++  +P + T+
Sbjct: 489 EKLSGVTGIKDLHRDTIDKLTIPSKQGKGELKRIEEVFDCWFESGSMPYASQHYPFENTE 548

Query: 646 DLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKSLG 705
             SQ  P + +  G D    W   + +LG  L G +P+K V    +V  A GRKMSKSL 
Sbjct: 549 KFSQRVPANFISEGLDQTRGWFYTLSVLGTHLFGSVPYKNVIVSGIVLAADGRKMSKSLK 608

Query: 706 NVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCA 765
           N  DP  V+     + L   L++                       P    ++L+F    
Sbjct: 609 NYPDPNIVLVKYGADALRLYLINS----------------------PVLKAESLKF---- 642

Query: 766 YTTGGRDINLDILRVEGYRKFCNKI----YQATKF-----ALIRLGED----YQPPSMEK 812
                        + EG ++  +K+    + + KF     AL++   D    Y P  M  
Sbjct: 643 -------------KEEGVKEVVSKVLLPWWNSFKFLDGQIALLKKTSDIDFKYDPSLM-- 687

Query: 813 LSGNESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYEFWYLVCDVYIE-NSKYLIT 871
              +++++++WIL  M +  + I++ +      T    +  F   + + YI  N + L  
Sbjct: 688 ---SDNVMDRWILASMQSLVQFIHQEMGLYKLYTVVPRLLNFIDELTNWYIRFNRRRLKG 744

Query: 872 EGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRLPK--------RTSEQSPTIV 923
           E    +   A ++L+  +   +R + PF PF+++ ++ +L +        + ++   ++ 
Sbjct: 745 ENGVEDCLKALNSLFEALFTFVRAMAPFTPFLADTIYLKLKEYIPADVLAKYTKDGRSVH 804

Query: 924 KASYPVYRKDF 934
             SYPV R++ 
Sbjct: 805 FLSYPVVREEL 815

>YBL076C (ILS1) [123] chr2 complement(81041..84259) Isoleucyl-tRNA
           synthetase, cytoplasmic, member of the class I aminoacyl
           tRNA synthetase family [3219 bp, 1072 aa]
          Length = 1072

 Score =  170 bits (431), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 207/867 (23%), Positives = 344/867 (39%), Gaps = 181/867 (20%)

Query: 166 EFTKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDH 225
           E TK+   KPE  F     PP  TG  H GH L   I+D + RY  M G  V    G+D 
Sbjct: 32  ELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKDIVPRYATMTGHHVERRFGWDT 86

Query: 226 AGIATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSRE 285
            G+  + +++K++    K     YG E +  +       Y    +  I +LG   D+  +
Sbjct: 87  HGVPIEHIIDKKLGITGKDDVFKYGLENYNNECRSIVMTYASDWRKTIGRLGRWIDFDND 146

Query: 286 AFTLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVEN--KDIKARTLL 343
             T+ P   +S   AF +LHEKG +YR  +++ +S  L T +SN E +   KD+      
Sbjct: 147 YKTMYPSFMESTWWAFKQLHEKGQVYRGFKVMPYSTGLTTPLSNFEAQQNYKDVN----- 201

Query: 344 SVPGYDEKVEFGVLTSFAYPVVDSDEKLIVA-TTRPETMFGDTGVAVHPD---------- 392
                D  V  G      + V+  ++  +VA TT P T+  +  + V+ D          
Sbjct: 202 -----DPAVTIG------FNVIGQEKTQLVAWTTTPWTLPSNLSLCVNADFEYVKIYDET 250

Query: 393 DPRYKHLHGKFVQ---------------------------HPFLPRKIPIFCDS------ 419
             RY  L    ++                            P  P     F ++      
Sbjct: 251 RDRYFILLESLIKTLYKKPKNEKYKIVEKIKGSDLVGLKYEPLFPYFAEQFHETAFRVIS 310

Query: 420 -EAVDMNFGTGAVKMTPAHDQNDYNTGKRHNL-----EFINVLTDTGLLNENCGPEWAGM 473
            + V  + GTG V   PA  + D     ++ +        N + D G   ++  P++ G+
Sbjct: 311 DDYVTSDSGTGIVHNAPAFGEEDNAACLKNGVISEDSVLPNAIDDLGRFTKDV-PDFEGV 369

Query: 474 KRFDARKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLK---PQWWVSQSQMAEK 530
              DA K +I+ L   G  +       + P C RS     PLL    P W+V    +  +
Sbjct: 370 YVKDADKLIIKYLTNTGNLLLASQIRHSYPFCWRSD---TPLLYRSVPAWFVRVKNIVPQ 426

Query: 531 AIKAV-KDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDNDQI- 588
            + +V K   +  T K  E  + +W+ N +DW +SR  +WG   P++  D    D +++ 
Sbjct: 427 MLDSVMKSHWVPNTIK--EKRFANWIANARDWNVSRNRYWGTPIPLWVSD----DFEEVV 480

Query: 589 ------DGEYWVSGRNLXXXXXXXXXXFP----NAKYTLKQDEDVLDTWFSSGLWPFSTL 638
                 + E     RN+                  K  LK+ E+V D WF SG  P+++ 
Sbjct: 481 CVGSIKELEELTGVRNITDLHRDVIDKLTIPSKQGKGDLKRIEEVFDCWFESGSMPYASQ 540

Query: 639 GWP-DKTKDLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQG 697
            +P + T+   +  P + +  G D    W   + +LG  L G +P+K V    +V  A G
Sbjct: 541 HYPFENTEKFDERVPANFISEGLDQTRGWFYTLAVLGTHLFGSVPYKNVIVSGIVLAADG 600

Query: 698 RKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTD 757
           RKMSKSL N  DP  V                                     + + G D
Sbjct: 601 RKMSKSLKNYPDPSIV-------------------------------------LNKYGAD 623

Query: 758 ALRFALCAYTTGGRDINLDILRV-------EGYRKFCNKI----YQATKFALIRLGEDYQ 806
           ALR  L         IN  +L+        EG ++  +K+    + + KF       D Q
Sbjct: 624 ALRLYL---------INSPVLKAESLKFKEEGVKEVVSKVLLPWWNSFKFL------DGQ 668

Query: 807 PPSMEKLSG----------NESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYEFWY 856
              ++K+S           +++++++WIL  M +  + I+E + +    T    +  F  
Sbjct: 669 IALLKKMSNIDFQYDDSVKSDNVMDRWILASMQSLVQFIHEEMGQYKLYTVVPKLLNFID 728

Query: 857 LVCDVYIE-NSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRLPKRT 915
            + + YI  N + L  E    +   A ++L+  +   +R + PF PF+SE ++ RL +  
Sbjct: 729 ELTNWYIRFNRRRLKGENGVEDCLKALNSLFDALFTFVRAMAPFTPFLSESIYLRLKEYI 788

Query: 916 SE--------QSPTIVKASYPVYRKDF 934
            E           ++   SYPV +K++
Sbjct: 789 PEAVLAKYGKDGRSVHFLSYPVVKKEY 815

>KLLA0E20625g 1825036..1828257 highly similar to sp|P09436
           Saccharomyces cerevisiae YBL076c ILS1 isoleucyl-tRNA
           synthetase, start by similarity
          Length = 1073

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 205/890 (23%), Positives = 351/890 (39%), Gaps = 187/890 (21%)

Query: 169 KEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGI 228
           K  E KPE  F     PP  TG  H GH L   ++D + RY  M G  V    G+D  G+
Sbjct: 33  KLTEDKPE--FSFFDGPPFATGTPHYGHLLASTVKDIVPRYATMTGHHVERRFGWDTHGL 90

Query: 229 ATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFT 288
             + +++K++    K+  + +G + +  +       Y +  +  I +LG   D+  +  T
Sbjct: 91  PIEHIIDKKLNITCKEDVYAFGIDNYNNECRAIVSTYAEEWRKTIGRLGRWIDFDDDYKT 150

Query: 289 LSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVEN--KDIKARTLLSVP 346
           + P   +S+  AF  L +K  +YR  +++ +S    T +SN E +   KD+    +    
Sbjct: 151 MYPTFMESIWWAFKELFDKDQVYRGYKVMPYSTGCTTPLSNFEAQQNYKDVNDPAI---- 206

Query: 347 GYDEKVEFGVLTSFAYPVVDSDE-KLIVATTRPETMFGDTGVAVHPD------------- 392
                       + A+ V+  ++ KL+  TT P T+  +  + V+P+             
Sbjct: 207 ------------TIAFNVIGQEKTKLVAWTTTPWTLPSNLALCVNPEFEYVKIYDENKDT 254

Query: 393 -----DPRYKHLHGKFVQHPF-LPRKI--------------PIFCDSEAVDMNF------ 426
                +   K L+ K  Q  + +  KI              P F D E  D  F      
Sbjct: 255 YFILLESLIKTLYKKPAQEKYKVVEKIKGKDLVGLKYEPLFPYFVD-EYKDTGFRVLGDS 313

Query: 427 ------GTGAVKMTPAHDQNDYNTGKRHNL-----EFINVLTDTGLLNENCGPEWAGMKR 475
                 GTG V   PA  ++D      H +        N + D G   +    ++ GM  
Sbjct: 314 YVSNDSGTGIVHQAPAFGEDDNRVCLEHGVIREDTPAPNPIDDVGKFTKEVS-DFTGMYV 372

Query: 476 FDARKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAV 535
            DA K +I+ L   G  +       + P C RS   +     P W+V    +  + +++V
Sbjct: 373 KDADKEIIKKLLASGHILLNSQIRHSYPFCWRSDTPLIYRTVPAWFVRVKTIIPQFLESV 432

Query: 536 KDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFV----------------- 578
           K      T    E  + +W+ N +DW +SR  +WG   P++                   
Sbjct: 433 KKSNWVPTV-IKEKRFSNWIANARDWNVSRNRYWGTPIPLWVSEDYEEMVCIGSVEELRE 491

Query: 579 -----DIEGQDNDQIDGEYWVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSGLW 633
                DI     D ID     S +                K  L++ E+V D WF SG  
Sbjct: 492 LSGVQDITDLHRDSIDNITIPSKK---------------GKGVLRRIEEVFDCWFESGSM 536

Query: 634 PFSTLGWP-DKTKDLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIPFKEVFCHSLV 692
           P+++  +P + T+  SQ  P + +  G D    W   + +LG  L GE+P++ V    +V
Sbjct: 537 PYASQHYPFENTEKFSQRVPANFISEGLDQTRGWFYTLGVLGTHLFGEVPYRNVIVSGIV 596

Query: 693 RDAQGRKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIP 752
             A G+KMSKSL N  DP      I LE                                
Sbjct: 597 LAADGKKMSKSLKNFPDP-----NIVLE-------------------------------- 619

Query: 753 QCGTDALRFALCAYTTGGRDINLDILRV-------EGYRKFCNKI----YQATKF----- 796
           + G+DALR  L         IN  +L+        EG ++  +K+    + + KF     
Sbjct: 620 KYGSDALRLYL---------INSPVLKAESLKFKEEGVKEVVSKVLLPWWNSFKFLDGQI 670

Query: 797 ALIRLGEDYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYEFWY 856
           AL++   D        L  +++++++WIL  + +    I++ +      T    + +F  
Sbjct: 671 ALLKKNSDVDFKYNPHLK-SDNVMDRWILASLQSLVAYIHQEMSTYKLYTVVPRLLDFID 729

Query: 857 LVCDVYIE-NSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRLP--- 912
            + + YI  N + L  EG   +   A +TL+  +   +R + PF PF+S+ ++ +L    
Sbjct: 730 ELTNWYIRFNRRRLKGEGGVEDCLKALNTLFDALFTFVRAMAPFTPFLSDNIYSKLRPFI 789

Query: 913 -----KRTSEQSPTIVKASYPVYRKDF---DNQKAGEEYELILDTIKEAR 954
                 + S+ S ++   SYP   +D    D +KA +  + ++D  +  R
Sbjct: 790 PEEVLAQYSKDSRSVHFLSYPEVNEDLYDEDIEKAVKRMQSVIDLGRNIR 839

>Kwal_27.10811
          Length = 1099

 Score =  164 bits (414), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 209/896 (23%), Positives = 350/896 (39%), Gaps = 202/896 (22%)

Query: 155 DWWVKSGFFEPEFTKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKG 214
           D W +   F+    K  E KPE  F     PP  TG  H GH LT  ++D + RY  M G
Sbjct: 46  DLWNEIDAFQTSL-KLTEGKPE--FSFFDGPPFATGTPHYGHILTSTVKDVVPRYASMNG 102

Query: 215 KTVLFLPGFDHAGIATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQIN 274
             V    G+D  G+  + +++K++    K+  +  G + + ++       Y +  +  I 
Sbjct: 103 FHVERRFGWDTHGLPIEHIIDKKLGITCKEDVYKMGIDKYNDECRAIVMMYAEEWRKTIG 162

Query: 275 KLGASYDWSREAFTLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVEN 334
           ++G   D+  +  T+ P   +S   AF +L EKG +YR  +++ +S    T +SN E + 
Sbjct: 163 RMGRWIDFDNDYKTMYPSFMESTWWAFKQLFEKGQVYRGYKVMPYSTGCTTPLSNFEAQQ 222

Query: 335 --KDIKARTLLSVPGYDEKVEFGVLTSFAYPVVDSDEK-LIVATTRPETMFGDTGVAVHP 391
             KD+           D  V +G      + V+  D   L+V TT P T+  +  V V+ 
Sbjct: 223 NYKDVS----------DPAVTWG------FRVIGMDNTYLVVWTTTPWTIPSNLAVCVNA 266

Query: 392 --------DDPRYKH-------------------------LHGK------------FVQH 406
                   D+ R KH                         + GK            + + 
Sbjct: 267 EFEYVKIYDETRDKHFIILESLIKTLYKKPEKEKYKVVEKIMGKDLVGLKYEPVYPYYKE 326

Query: 407 PFLPRKIPIFCDSEAVDMNFGTGAVKMTPAHDQNDYNTGKRHNL-----EFINVLTDTGL 461
            +  +   +  DS  V  + GTG V   PA  + DY    +H +     E  N + D G 
Sbjct: 327 AYKDKAFRVIEDS-YVTSDSGTGLVSNAPAFGEEDYKVCLQHGIISEDDELPNPVDDAGK 385

Query: 462 LNENCGPEWAGMKRFDARKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLK---P 518
                  ++ G    DA K +I+ L   G  +       + P C RS     PLL    P
Sbjct: 386 FTLPV-TDYLGQYVKDADKQIIKDLTANGTMLANTQFRHSYPFCWRSD---TPLLYRSVP 441

Query: 519 QWWVSQSQMAEKAIKAVKDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFV 578
            W+V    +  K + +V+     +     E  + +W+ N +DW +SR  +WG   P++  
Sbjct: 442 AWFVRVKPIIPKFLDSVQKSH-WVPNVIKEKRFSNWIANARDWNVSRNRYWGTPIPIWVS 500

Query: 579 D----------------------IEGQDNDQIDGEYWVSGRNLXXXXXXXXXXFPNAKYT 616
           D                      IE    D IDG    S +                K  
Sbjct: 501 DDYEEVVCVGSVQELKDLSGVQTIEDLHRDSIDGITIPSKK---------------GKGV 545

Query: 617 LKQDEDVLDTWFSSGLWPFSTLGWPDKTKD-LSQFYPFSMLETGWDILFFWVSRMILLGL 675
           LK+ E+V D WF SG  P+S+  +P + +D   +  P + +  G D    W   + +LG 
Sbjct: 546 LKRIEEVFDCWFESGSMPYSSQHYPFENQDKFKERVPANFISEGLDQTRGWFYTLGVLGS 605

Query: 676 ELTGEIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPRE 735
           +L G++P++ V    +V  A G+KMSKSL N  DP  V                      
Sbjct: 606 QLFGQVPYQNVIVCGIVLAADGKKMSKSLKNYPDPNLV---------------------- 643

Query: 736 VEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVE-------GYRKFCN 788
                          + + G DALR  L         IN  +L+ E       G ++  +
Sbjct: 644 ---------------LDKYGADALRLYL---------INSPVLKAESLKFKEDGVKEVVS 679

Query: 789 KI----YQATKFALIRLGEDYQPPSMEKLSG----------NESLVEKWILNKMTNYAKS 834
           K+    + + KF       D Q   ++K S           +++++++WIL  +    K+
Sbjct: 680 KVLLPWWNSFKFL------DGQISLLKKTSNIDFKYDPTIKSDNVMDRWILASLQTLVKN 733

Query: 835 INEALDKRDFLTSTSGIYEFWYLVCDVYIE-NSKYLITEGTDAEKKSAKDTLYILIDNAL 893
           I+  +           + +F   + + YI  N + L  E  + +  +A ++L+  +   +
Sbjct: 734 IHAEMKSYKLYAVVPRLLDFIDQLTNWYIRLNRRRLKGENGEQDCLNALNSLFDALFTFV 793

Query: 894 RLIHPFMPFISEEMWQRLPKRTSEQ--------SPTIVKASYPVY-RKDFDNQKAG 940
             + PF PF+S+ ++QR+ +   E         S ++   SYPV   K FD +  G
Sbjct: 794 CAMAPFTPFLSDNIYQRMKEYIPENVLSTFGPDSRSVHFLSYPVVDEKLFDEKIEG 849

>AER394W [2894] [Homologous to ScYBL076C (ILS1) - SH]
           complement(1386794..1390012) [3219 bp, 1072 aa]
          Length = 1072

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 192/821 (23%), Positives = 328/821 (39%), Gaps = 146/821 (17%)

Query: 169 KEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGI 228
           K  E +PE  F     PP  TG  H GH L   ++D + RY  M G  V    G+D  G+
Sbjct: 32  KLTEGRPE--FSFFDGPPFATGTPHYGHILASTVKDIVPRYATMNGYHVERRFGWDTHGL 89

Query: 229 ATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFT 288
             + +++K++    K+  + +G E +  +       Y    +  I +LG   D+  +  T
Sbjct: 90  PIEHIIDKKLNITCKEDVYKFGIENYNNECRAIIMTYADEWRKTIGRLGRWIDFDNDYKT 149

Query: 289 LSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGY 348
           + P   +SV  AF +L+EK  +YR  R++ +S    T +SN E +              Y
Sbjct: 150 MYPSFMESVWWAFKQLYEKEQVYRGYRVMPYSTGCTTPLSNFEAQQ------------NY 197

Query: 349 DEKVEFGVLTSFAYPVVDSDEKLIVATTRPETMFGDTGVAVHPD----------DPRY-- 396
            E  +  V   F   V + + + +  TT P T+  +  + V+P+            RY  
Sbjct: 198 KEVNDPAVTIGFNV-VGEENTQFVAWTTTPWTLPSNLALCVNPEFEYVKIYDEKKDRYFI 256

Query: 397 ------KHLHGK-------------------FVQHPFLP--------RKIPIFCDSEAVD 423
                 K L+ K                       P  P        +   +  DS  V 
Sbjct: 257 LMESLLKSLYKKPAAEKYKVVERYTGKDLVGMKYEPLFPYFKEEYGTQAYRVISDS-YVT 315

Query: 424 MNFGTGAVKMTPAHDQNDYNTGKRHNL-----EFINVLTDTGLLNENCGPEWAGMKRFDA 478
            + GTG V   PA  ++DY     + +        N + D+G        +++G    DA
Sbjct: 316 NDSGTGIVHNAPAFGEDDYRVCLANGIINEDSTLPNPVDDSGKFTSEV-TDFSGKYVKDA 374

Query: 479 RKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDG 538
            K +I+ L      +       + P C RS   +     P W+V    +  + +++VK  
Sbjct: 375 DKEIIKHLTATSNLLLATQVRHSYPFCWRSDTPLIYRSVPAWFVRVKPIIPQFLESVKKS 434

Query: 539 RITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDNDQI---------D 589
               T    E  +  W+ N +DW ISR  +WG   P++  D    D D+I         +
Sbjct: 435 NWVPTV-IKEKRFATWIANARDWNISRNRYWGTPIPLWVSD----DFDEIVCVGSIAELE 489

Query: 590 GEYWVSGRNLXXXXXXXXXXFPN--AKYTLKQDEDVLDTWFSSGLWPFSTLGWP-DKTKD 646
               VSG +            P+   K  L++ E+V D WF SG  P+++  +P + T+ 
Sbjct: 490 ELSGVSGISDLHRDTVDKITIPSKKGKGELRRIEEVFDCWFESGSMPYASQHYPFENTEK 549

Query: 647 LSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKSLGN 706
            +Q  P + +  G D    W   + +LG +L G +P++ V    +V  A G+KMSKSL N
Sbjct: 550 FAQRVPANFISEGLDQTRGWFYTLGVLGTQLFGHVPYQNVIVSGIVLAADGKKMSKSLKN 609

Query: 707 VVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAY 766
             DP  V                                     I + G+DALR  L   
Sbjct: 610 YPDPNIV-------------------------------------IDKYGSDALRLYL--- 629

Query: 767 TTGGRDINLDILRV-------EGYRKFCNKI----YQATKFALIRLGEDYQPPSME-KLS 814
                 IN  +LR        EG ++  +K+    + + KF   ++    +  S++ K  
Sbjct: 630 ------INSPVLRAESLKFKEEGVKEVVSKVLLPWWNSFKFLEGQIALLKKTSSVDFKYD 683

Query: 815 GN---ESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYEFWYLVCDVYIE-NSKYLI 870
            N   ++++++W+L  + +  K I+  +      +    + +F   + + YI  N + L 
Sbjct: 684 PNVRSDNVMDRWVLASLQSLIKYIHVEMKAYKLYSVVPRLLDFIDELTNWYIRFNRRRLK 743

Query: 871 TEGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRL 911
            E    +  +A +TL+  +   +R + PF PF+SE ++ RL
Sbjct: 744 GEDGMEDCINALNTLFEALFTFVRAMAPFTPFLSETIYLRL 784

>CAGL0L12606g 1353211..1356159 similar to sp|P48526 Saccharomyces
            cerevisiae YPL040c isoleucine--tRNA ligase,
            mitochondrial, hypothetical start
          Length = 982

 Score =  146 bits (368), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 203/932 (21%), Positives = 354/932 (37%), Gaps = 141/932 (15%)

Query: 161  GFFEPEFTKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFL 220
            G  E E  K   ++ E LF +   PP   G LH+GH L   ++D + R+   +GKTV + 
Sbjct: 58   GAVEGEDEKLAAVR-ERLFVLHDGPPYANGDLHLGHALNKILKDFVNRFQLSQGKTVYYR 116

Query: 221  PGFDHAGIATQSVVEKQVWAKEK----KTRHDYGREAFVEKIWEWKEDYHKRIKNQINKL 276
            PG+D  G+  +    K +   +K    K R +  R+  +  +         + ++Q  K 
Sbjct: 117  PGWDCHGLPIEMKALKDLRDADKMDSVKVR-ELARQHALRSL--------DKQRDQFKKY 167

Query: 277  GASYDWSREAFTLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAI--SNLEVEN 334
            G   DWS    T+      +  + F ++   G+I R N+ V W     TA+  S LE   
Sbjct: 168  GILTDWSDPYVTMDKSFEVNQLKVFQKMFNMGLIKRQNKPVYWGTVTKTALAESELEYNE 227

Query: 335  KDIKARTLLSVP-GYDEKVEFGVLTSFAYPVVDSDEKLIVATTRPETMFGDTGVAVHPD- 392
            K +     +  P   D +            + +     ++ T+ P T+F +  +  + + 
Sbjct: 228  KHVSTAAYVKFPLTADSRAHLQDKLKLENELQNDQISCLIWTSTPWTLFSNRAICFNENF 287

Query: 393  -------DPRY-------------------------KHLHGKFVQHPFLPRKI--PIFCD 418
                   D  Y                         K L G F  +P +   +  P+   
Sbjct: 288  SYSLLQLDGSYVIVENNLINQLGSDHKGEILKTFEGKLLKGLFYYNPLVSDIVARPLIHG 347

Query: 419  SEAVDMNFGTGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTG--LLNE---NC------G 467
                D N GTG V   P H  +DY  G  ++LE  + +   G  +LNE   NC      G
Sbjct: 348  DHVTD-NAGTGLVHTAPGHGHDDYFLGIENDLEIYSPVDHEGRYILNELPDNCKELLMEG 406

Query: 468  PEWAGMKRFDARKN--VIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQS 525
                G K  D+     +++ L +K   +       + P   R+   +     PQW+    
Sbjct: 407  GTGLGRKVLDSETTTVILDLLSKKQALLKAHKYTHSYPYDWRAKTPVIIRATPQWFADLH 466

Query: 526  QMAEKAIKAVKDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQD- 584
             + + AIK+++  ++   PK  E     ++++  +WCISRQ  WG   PV F +    D 
Sbjct: 467  DVKDLAIKSLE--KVEFYPKRGENRLSSFIKSRNEWCISRQRSWGVPIPV-FHNKSNPDK 523

Query: 585  ---NDQIDGEYWVS-----GRNLXXXXXXXXXX-FPNAKYTLKQD----EDVLDTWFSSG 631
               ND++  EY ++     G +L           FP    T+ +D     D +D WF SG
Sbjct: 524  VLINDEL-LEYIITRISKHGSDLWFSPEDDISDWFPENYRTMAKDFIKGTDTMDVWFDSG 582

Query: 632  -LWPF------STLGWPDKTKDLSQFY-PFSMLETGWDILFFWVSRMILLGLELTGEIPF 683
              W          LG     + L+  Y   S    GW    F  S +  +   ++   P+
Sbjct: 583  STWNIIREFYQKELGLSTVPQPLANVYLEGSDQHRGW----FQSSLLTKVACSMSEIAPY 638

Query: 684  KEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQ 743
             EV  H    D +G KMSKS+GN + P  ++ G K  +L                     
Sbjct: 639  NEVITHGFTLDEKGIKMSKSIGNTISPESIIEGDKKRNL--------------------- 677

Query: 744  KESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALIRLGE 803
                    P  G D LR     Y     D   D+       K   +  +  +  +  L  
Sbjct: 678  --------PALGIDGLR-----YFVAQADFTTDVTVGPTVLKHVAEALKKCRLTMRFLIS 724

Query: 804  DYQPPSMEKLSGNESL--VEKWILNKMTNYAKSINEALDKRDFLTSTSGI-YEFWYLVCD 860
            + +      L     L  V+K++L  +    +   E     +F  +   + +     +  
Sbjct: 725  NLEISKRYSLLNTSELRPVDKYVLASVNKLLEETKELYKVHNFSKALVALQFHMNNELSS 784

Query: 861  VYIENSK-YLITEGTDA-EKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRLPKR--TS 916
             Y + SK  L ++  ++ +++  + TL+ + D    ++ P +P + +E W  LPK+    
Sbjct: 785  FYFDISKDSLYSDSIESLKRRQIQTTLFHIYDAYRAMLAPILPILVQESWNFLPKQWLNG 844

Query: 917  EQSPTIVKASYPVYRKDFDNQKAGEEYELILDTIKEARSLLAQYGILKNGKVFIESSSDA 976
            +     V   +P    + + +   E  ++IL  +KE +S   ++  L N  +   S + A
Sbjct: 845  DNEAEAVTRKWPSL-TEINPEVVNEFKQVILPLVKEYKS---KFATLGNPSITKPSQTKA 900

Query: 977  FFDTAVTQKDSIVSLIKAIDEVTVVKNVSEIP 1008
              + + +   S   L   +    V  N+ ++P
Sbjct: 901  IINCSKSTGYSNEELCDVLQTAEVDVNIGDMP 932

>Scas_568.3
          Length = 1001

 Score =  142 bits (358), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 170/822 (20%), Positives = 329/822 (40%), Gaps = 130/822 (15%)

Query: 176 EGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVE 235
           E LF +   PP   G LH+GH L   ++D ++RY    GK V + PG+D  G+  +  V 
Sbjct: 79  ENLFILHDGPPYANGDLHLGHALNKILKDIIVRYQYSSGKYVFYKPGWDCHGLPIELKVL 138

Query: 236 KQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTK 295
           K +  K+ +T       +   K      D+ ++   Q ++     DW+    T+  +   
Sbjct: 139 KSLPKKDIETISPEKIRSMARKHALTAIDHQRK---QFHQFAIFTDWNDPYITMDKKFEI 195

Query: 296 SVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVE-NKDIKARTLLSVPGYDEKVEF 354
              + F +++ +G+I R N+ V W  +  TA++  E+E NK  ++ +        ++   
Sbjct: 196 DQLKIFQKMYHEGLILRQNKPVFWGTETKTALAESELEYNKSHESTSAYVKFPLTKQSSL 255

Query: 355 GVLTSFAY----PVVDSDEKLIVATTRPETMFGDTGVA---------------------- 388
            ++ +       PV  S    ++ T+ P T+F +  +                       
Sbjct: 256 QLIENLNIVQDTPVTIS---CLIWTSTPWTLFSNRAICFNQNFSYSLVKLVDNNNEFILV 312

Query: 389 -----VHPDDPRY---KHLHGKFVQHPFLPRKIPIFCDSEAVDM--------NFGTGAVK 432
                +  + P Y   K   G+ + +  L  + P+F + E + +        + GTG V 
Sbjct: 313 ESNLLIQLNIPNYDIVKTFSGELLTN--LKYENPLFSEEEPLPLLHGTHVTNDTGTGLVH 370

Query: 433 MTPAHDQNDYNTGKRHNLEFINVLTDTG-------------LLNENCGPEWAGMKRFDAR 479
             P H  +DY  G R+NL   + +   G             LL +   P   G    D +
Sbjct: 371 TAPGHGPDDYLVGIRNNLPIYSPVDHEGRYNLSELPSSTHKLLTDPDAPGNTGRYVLDPK 430

Query: 480 KN--VIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKD 537
               +IE LK+  +    +    + P   RS   +     PQW+++ ++M + A++++ D
Sbjct: 431 TTLIIIEKLKELNMLFRSKKYTHSYPYDWRSKKPVIIRATPQWFLNLAKMKQLAVESLND 490

Query: 538 GRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDNDQIDGEY----- 592
            ++   P+  +     +++N  +WCISRQ  WG   P ++  IE  D   ++ E      
Sbjct: 491 -KVNFFPERGKTRLLSFIKNRNEWCISRQRAWGVPIPAFY-RIENSDEVLMNEEIINHVI 548

Query: 593 ----------WVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSG-LWPFSTLGWP 641
                     W    +           + N  +  ++  D +D WF SG  W      + 
Sbjct: 549 KTIESNGIDKWFDQYS-SPTEEWLPESYKNVAHEYRRGTDTMDVWFDSGSSWKVIESFYH 607

Query: 642 DKTKDLS-QFYP---FSMLETGWDILFFWVSRMILLGLELT--GEIPFKEVFCHSLVRDA 695
           D  K  +    P   F +   G D    W   ++L  +  +   E P++ +  H    D 
Sbjct: 608 DTLKIRNGSVLPSPLFDVALEGSDQHRGWFQSLLLTKVAYSKVAEAPYRNIITHGFTLDE 667

Query: 696 QGRKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCG 755
           +G KMSKS+GN + P DV+ G               +P                G+   G
Sbjct: 668 KGIKMSKSIGNTISPTDVIQG---------------NPAR--------------GLIPLG 698

Query: 756 TDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALIRLGED--YQPPSMEKL 813
            D LR+ + A++   +D+ +    ++   +   KI    +F L  L +   ++P ++E+L
Sbjct: 699 IDGLRYYV-AHSNFTKDLVVGANIMKRVSESLKKIRITFRFLLSNLEKSGTFEPLAVEEL 757

Query: 814 SGNESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGI-YEFWYLVCDVYIENSK-YLIT 871
                 V+++I++ +        E+    +F    + + +     +   Y ++SK  L +
Sbjct: 758 RP----VDQYIISTLQKLLAESKESYQSYNFSKILTTLQHHLSSELSAFYFDSSKDSLYS 813

Query: 872 EGTDAEK-KSAKDTLYILIDNALRLIHPFMPFISEEMWQRLP 912
           +   +EK K  +  L  ++     +++P +P + +E+   +P
Sbjct: 814 DSITSEKRKQIQTVLLYVLQTYSTILNPILPTLIQEVRNYIP 855

>AGL247C [4065] [Homologous to ScYPL040C (ISM1) - SH] (237045..240011)
            [2967 bp, 988 aa]
          Length = 988

 Score =  131 bits (330), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 193/954 (20%), Positives = 347/954 (36%), Gaps = 178/954 (18%)

Query: 165  PEFTKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFD 224
            P+ T +     + +F +   PP   G LH+GH +   ++D + RY   KG+ V + PG+D
Sbjct: 61   PDDTDKANFVRDRVFVLHDGPPYANGDLHVGHAMNKILKDIMSRYQLTKGRYVFYRPGWD 120

Query: 225  HAGIA------------TQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQ 272
              G+             T ++  +QV  +    +H  G  A   K              Q
Sbjct: 121  CHGLPIELKALRSLDYDTAAISPQQV--RAMAAQHAEGAIAAQRK--------------Q 164

Query: 273  INKLGASYDWSREAFTLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEV 332
              + G   DW     T+ P            +  +G+I R  + V W  +  TA++  E+
Sbjct: 165  FQQFGILTDWQDTYRTMDPGYEIQQLRLLQGIFARGLIRRQRKPVYWGTETRTALAEGEL 224

Query: 333  ENKD--IKARTLLSVP---GYDEKVEFGVLTSFA-YPVVDSDEKLIVATTRPETMFGDTG 386
            E +D  I     +  P   G    +   + TS    P+V      ++ T+ P T+  +  
Sbjct: 225  EYRDDHISKAAYVYFPLTEGASATLRERLGTSLPEQPIV-----CLIWTSTPWTLLSNRA 279

Query: 387  VAVHPDDP----------------------------------RYKHLHGKFVQHPFLPRK 412
            +  H D                                    R   L G +  +P L   
Sbjct: 280  ICFHDDHAYLLLQWKGMLVVAERTELADFKWSGDTPVVVTSFRGSDLRGLYYTNPLLGDA 339

Query: 413  I--PIFCDSEAVDMNFGTGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTG-LLNENCGPE 469
            +  P+    + V  + GTG V   P H Q DY  G+ H +E  + +   G  + ++  P 
Sbjct: 340  VSRPLL-HGDHVTADTGTGLVHTAPGHGQEDYLVGQAHGIEVYSPVDHEGRYILDDIPPH 398

Query: 470  WAGMKRFDARKN-----------VIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKP 518
               M R ++ K            +I+ L++  + +   +   + P   RS   +     P
Sbjct: 399  LRDMLREESGKPLKVTDQKTAGVIIKLLEEHKMLLHSHEYTHSYPYDWRSKKPVILRATP 458

Query: 519  QWWVSQSQMAEKAIKAVKDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFV 578
            QW+   S M   A++++++  +   P   +     ++++  +WCISRQ  WG   P+  +
Sbjct: 459  QWFADLSDMKHHAVESLEN--VEFFPARGKKRLEAFIKSRNEWCISRQRSWG--VPIPAL 514

Query: 579  DIEGQDND----------------QIDGEYWVSGRNLXXXXXXXXXXFPNAKYTLKQDED 622
             +    ++                ++    W    N           + +  +   +  D
Sbjct: 515  HLRSNPDEVLLNNETLAHIIETISKVGINSWFEESNAENMKQWLPEKYHDVAHLYYRGRD 574

Query: 623  VLDTWFSSGL-------WPFSTLGWPDKTKDLSQFYPFSMLETGWDILFFWVSRMILLGL 675
             +D WF SG        W   TLG     + L+  Y    LE G D    W    +L  +
Sbjct: 575  TIDVWFDSGSSWNLLEKWYTETLGLKKPLQPLADVY----LE-GSDQHRGWFQSSLLTKV 629

Query: 676  ELTGEI--PFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVCG-IKLEDLHAKLLSGNLD 732
              +G +  PF ++  H    D  G KMSKSLGN + P  ++ G  KL+            
Sbjct: 630  AASGTVGAPFGKIVTHGFTLDEAGLKMSKSLGNTIAPSSIIEGDQKLQ------------ 677

Query: 733  PREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQ 792
                              +P+ G D LR  L A     +D+    L          K+  
Sbjct: 678  ------------------LPRLGVDGLRL-LVAQADFTKDVAFGPLIARHVADSLKKVRL 718

Query: 793  ATKFALIRLGEDYQPPSMEKLSGNESL----------VEKWILNKMTNYAKSINEALDKR 842
              +F    LG     PS+       SL          ++ +IL+K            + +
Sbjct: 719  TFRFI---LGNLQDCPSVASAGEQASLAPGDCAQLRRIDWYILDKTQKLTAKCQGLYESQ 775

Query: 843  DFLTSTSGIYEFWYLVCDVYIENSK-YLITEGTDAEKKSA-KDTLYILIDNALRLIHPFM 900
            ++    S +         +Y + SK  L  E    +++ A + TL+ ++D    ++ P M
Sbjct: 776  NYSNVISLVLYHMSNDLSLYFDASKDTLYMEPPHNKRRLAIQTTLFHILDAYRSILGPIM 835

Query: 901  PFISEEMWQRLPKR--TSEQSPTIVKASYPVYRKDFDNQKAGEEYELILDT-IKEARSLL 957
            P + +E W  LP+     + +P + +  +P      D  +  E  +L L T  ++A + L
Sbjct: 836  PALVQEAWNCLPREWLRGDTTPAL-RRPWPALPALADRIRDCETTDLALVTAFRQALARL 894

Query: 958  AQYGILKNGKVFIESSSDAFFDT----AVTQKDSIVSLIKAIDEVTVVKNVSEI 1007
                  +  +V I     A +       +TQ   ++ +  + D V  + +VS++
Sbjct: 895  PHVRKPEQCRVIIYMPDSALYTVEDVMELTQAGEVI-IDGSKDRVLALPHVSKL 947

>Kwal_27.11827
          Length = 985

 Score =  128 bits (321), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 181/818 (22%), Positives = 303/818 (37%), Gaps = 140/818 (17%)

Query: 178 LFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQ 237
           LF +   PP   G LH+GH +   ++D + RY  ++GK + + PG+D  G+     +E +
Sbjct: 74  LFVLHDGPPYANGDLHLGHAMNKMLKDIINRYQLLQGKFIFYKPGWDCHGLP----IELK 129

Query: 238 VWAKEKKTRHDYGREAFVEKIWEWKEDY-HKRIK---NQINKLGASYDWSREAFTLSPEL 293
              K  K       E F  +I +    +  K IK   +Q  +   + DW     T+  + 
Sbjct: 130 ALQKLNKDE----SELFPTRIRKLASQHAQKTIKSQASQFKQFAIATDWDDCYETMQQQF 185

Query: 294 TKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVENKDI--KARTLLSVPGYDEK 351
                +    + +KG+I R N+ V W  +  TA++  E+E +D        +  P  +E 
Sbjct: 186 EFDQLDNLKIMIQKGLIKRQNKPVYWGTETKTALAEGELEYRDDHESMSAFIKFPLTEES 245

Query: 352 VEFGVLTSFAYPVVDSDEKLIVATTRPETMFGDTGVA----------------------- 388
               V+  +    +DS   L + T+ P T+F +  V                        
Sbjct: 246 SR--VVAEWNKLRLDSPISLAIWTSTPWTIFANQAVCFNESFDYGLYELNNEYVVLESGL 303

Query: 389 ---VHPDDPRY-KHLHGKFVQH-----PFLPRKIPIFCDSEAVDMNFGTGAVKMTPAHDQ 439
              V PD  R    + G  ++      PFL +        + V    GTG V   P H  
Sbjct: 304 GSKVLPDIARLIATIPGTKLKDLKYYIPFLNKSPKPLIHGDHVTNISGTGLVHTAPGHGH 363

Query: 440 NDYNTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFD-----ARKNVIEA--------L 486
           +DY  G ++ L   + + D G    +  P        +     ARK + EA        L
Sbjct: 364 DDYLIGVKNGLNIYSPVDDEGRYKTDMMPSHLREILIEPETGKARKVLSEATTSQILTML 423

Query: 487 KQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRITITPKS 546
           +   + +  E    + P   RS   +     PQW+   + +   A++++K+  +T  P+ 
Sbjct: 424 QNHQMLLRAEKYIHSYPYDWRSKKPVIVRSTPQWFADLTDVKSLALESLKN--VTFHPER 481

Query: 547 SEAEYFHWLENIQDWCISRQLWWGHRCPVYF----------------VDIEGQDNDQIDG 590
                  ++++  +WCISRQ  WG   P +                   I       ID 
Sbjct: 482 GLNRLTSFIKSRNEWCISRQRSWGVPIPAFHKVGKSEEVLMSEEVAKYAISAIKRKGIDA 541

Query: 591 EYWVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSG-LWPF------STLGWPDK 643
             W    N           + +  +  ++  D +D WF SG  W          LG P  
Sbjct: 542 --WFKEDN-SDINEWLPPSYQDRGHEYRRGRDTVDVWFDSGSTWKVIDRFYNHRLGLPLP 598

Query: 644 TKDLSQFYPFSMLETGWDILFFWVSRMILLGLELTG--EIPFKEVFCHSLVRDAQGRKMS 701
              L+  Y    LE G D    W    +L  +   G  + P+  V  H    D  G KMS
Sbjct: 599 RSPLADLY----LE-GSDQHRGWFQSSLLTKVATAGIPQAPYAAVLTHGFTLDENGSKMS 653

Query: 702 KSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRF 761
           KSLGN + P  V+ G K                               GIP  G D LR 
Sbjct: 654 KSLGNTILPSAVIAGDK-----------------------------DRGIPALGVDGLRL 684

Query: 762 ALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALIRL-----GEDYQPPSMEKLSGN 816
            L A T    D+++    ++   +   K+    KF L  L     G +  P   EKL   
Sbjct: 685 -LIAQTDFTTDVSIGPTVIKHVAEALKKLRLTLKFMLGNLQKTAAGCELLP--FEKLRD- 740

Query: 817 ESLVEKWILNKMTNYAKSINEALDKRDFL-TSTSGIYEFWYLVCDVYIENSKYLITEGT- 874
              ++++ L K+   +    +  D  +F    T+ +Y     +   Y + +K  +  G+ 
Sbjct: 741 ---IDQYTLCKLQELSIQAKDHYDAYNFSKVLTAVLYHMNNQLSAFYFDVTKDALYSGSI 797

Query: 875 -DAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRL 911
              +++  + TL+ + D    ++ P +P + +E W  L
Sbjct: 798 NSLKRQQIRTTLFHIFDTYRSILGPILPVMIQEAWNCL 835

>YPL040C (ISM1) [5399] chr16 complement(475988..478996)
           Isoleucyl-tRNA synthetase, mitochondrial [3009 bp, 1002
           aa]
          Length = 1002

 Score =  123 bits (309), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 184/870 (21%), Positives = 335/870 (38%), Gaps = 135/870 (15%)

Query: 135 SLEDPALKAYNPANVESSWYDWWVKSG----------FFEPEFTK------EGEIKPEGL 178
           +L  P  K  N +N+E +  +   KS           FFE EF+K      + E   E L
Sbjct: 28  TLNLPKTKFPNRSNLEITLRELIPKSSQLVYKEQLRDFFE-EFSKLNTTDEKLEFIKEKL 86

Query: 179 FCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQV 238
           F +   PP   G LH+GH L   ++D + RY   +GK + + PG+D  G+  +    K +
Sbjct: 87  FILHDGPPYANGELHLGHALNKILKDIINRYQLSQGKYIFYKPGWDCHGLPIEIKALKDL 146

Query: 239 WAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVT 298
            A++ ++       +   K     +   KR +          DW     T+  +   +  
Sbjct: 147 SAQQIESISPLKIRSMALK---HAQKAIKRQRETFQHFAILTDWETPYLTMDKDYEINQL 203

Query: 299 EAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVE----NKDIKART---LLSVPGYDEK 351
             F  ++E+G+I R N+ V W  +  TA++  E+E    +K I A     L      D  
Sbjct: 204 NIFKEMYERGLIKRQNKPVYWGTETRTALAEGELEYNENHKSIAAYVKFPLEKKSQMDLC 263

Query: 352 VEFGVLTS--------------------------FAYPVVDSDEKLIVATTRPETMFGDT 385
            + G+  +                          F+Y ++  + +LI+  T      G T
Sbjct: 264 KKLGITNNLPIYCLIWTSTPWTLLSNRAICFNQDFSYSLLRLNSELILVETGSIDKLGLT 323

Query: 386 GVAVHP-DDPRYKHLHGKFVQHPFLPRKI--PIFCDSEAVDMNFGTGAVKMTPAHDQNDY 442
             +       +  HL+G + Q+  +  K+  P+   +  V    GTG V   P H Q+DY
Sbjct: 324 TNSFETIKQFQGTHLNGLYYQNLLVDDKVGRPLLHGAH-VTSGTGTGLVHTAPGHGQDDY 382

Query: 443 NTGKRHNLEFINVLTDTGLLNENCGPEWA------------GMKRFDARKNVIEALKQKG 490
             G ++ LE  + +   G    N  P+              G +  DA    I   K   
Sbjct: 383 LIGIQNGLEIYSPVDHQGRYQLNELPQSVRSIVRDEGDLTKGRQVLDAETAKIILCKLSD 442

Query: 491 LYIGQEDNEMT--IPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRITITPKSSE 548
           L +  + +E T   P   RS   +     PQW+     +   A++++   R+   PK   
Sbjct: 443 LNLLYKSHEYTHSYPYDWRSKKPVIIRATPQWFADLHDVKNLALESI--SRVKFCPKRGY 500

Query: 549 AEYFHWLENIQDWCISRQLWWGHRCPVY-FVDIEGQDNDQIDGEY--------------- 592
           +    ++++  +WCISRQ  WG   P+  F      D+  ++ E                
Sbjct: 501 SRLSSFMKSRNEWCISRQRSWG--IPILSFYKKSEPDSVLMNSEILAHAIEKIKQKGINA 558

Query: 593 WVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDKTKDLSQFYP 652
           W + ++           + +  +   + +D +D WF SG        + +K+  LS+   
Sbjct: 559 WFNDKD-NDMKEWLPEKYHDVAHEYCRSQDTMDVWFDSGSSWSVIKDFYEKSLKLSKLPS 617

Query: 653 --FSMLETGWDILFFWVSRMILLGLELTG--EIPFKEVFCHSLVRDAQGRKMSKSLGNVV 708
             + +   G D    W    +L  +  +     P++EV  H    D  G KMSKS+GN +
Sbjct: 618 PLYQVCLEGSDQHRGWFQSSLLTKVASSNVPVAPYEEVITHGFTLDENGLKMSKSVGNTI 677

Query: 709 DPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTT 768
            P  ++ G             NL                  G+P  G D LR+ L A + 
Sbjct: 678 SPEAIIRG-----------DENL------------------GLPALGVDGLRY-LIAQSN 707

Query: 769 GGRDINLDILRVEGYRKFCNKIYQATKFALIRL--GEDYQPPSMEKLSGNESLVEKWILN 826
              DI      ++   +   K+    ++ L  L   +D+    +E+L      V+++ L 
Sbjct: 708 FTTDIVAGPTVMKHVGEALKKVRLTFRYLLSNLQKSQDFNLLPIEQLRR----VDQYTLY 763

Query: 827 KMTNYAKSINEALDKRDFLTSTSGI-YEFWYLVCDVYIENSKYLI--TEGTDAEKKSAKD 883
           K+    ++  E   K +F      + Y     +   Y + SK ++   + +   ++  + 
Sbjct: 764 KINELLETTREHYQKYNFSKVLITLQYHLNNELSAFYFDISKDILYSNQISSLARRQVQT 823

Query: 884 TLYILIDNALRLIHPFMPFISEEMWQRLPK 913
           TL  +++    ++ P +P + +E+W+ +P+
Sbjct: 824 TLVHILNAYRAILAPILPVMVQEVWKYIPE 853

>KLLA0D11858g complement(1010259..1013231) similar to sp|P48526
           Saccharomyces cerevisiae YPL040c ISM1 isoleucine--tRNA
           ligase, mitochondrial, start by similarity
          Length = 990

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 172/807 (21%), Positives = 296/807 (36%), Gaps = 113/807 (14%)

Query: 176 EGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVE 235
           E +F +   PP   G LH+GH L   ++D + R+  + GK V+++PG+D  G+     +E
Sbjct: 77  ENVFILHDGPPYANGDLHLGHALNKILKDIINRFQLLNGKHVVYIPGWDCHGLP----IE 132

Query: 236 KQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTK 295
            +   K                     +   K  + Q  + G   +W     T+ P+   
Sbjct: 133 LKALNKLNDQLDRISPTKIRSIARAHAQKTIKSQRQQFEQFGILTNWDTNYVTMDPKFEI 192

Query: 296 SVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVENKD----IKARTLL-------S 344
           +    F  L  K +I R  + V W  +  TA++  E+E K+    I A           S
Sbjct: 193 NQLSVFQELFRKKLIKRQRKPVYWGTETKTALAEGELEYKEDHISIAAYVKFPLTEESKS 252

Query: 345 VPGYDEK-VEFGVLTSFAYPVVDS-----DEKL--IVATTRPETMFGDTGVAVHPDD--- 393
           V G+ E  V F + TS  + ++ +     ++ L  ++     E M  +  +A   D    
Sbjct: 253 VLGFPEAPVSFLIWTSTPWTLLSNRAICFNQSLDYVLIKHNGEYMIVEKNLADKLDFLSG 312

Query: 394 -PRYKHLHGKFVQH-----PFLPRKI--PIFCDSEAVDMNFGTGAVKMTPAHDQNDYNTG 445
               K L G F+ H     P L   +  P+F       +  GTG V   P H   DY  G
Sbjct: 313 FELVKDLDGNFLSHLKYTNPILKDNVTRPLFHGDHVTSVT-GTGLVHTAPGHGHEDYIIG 371

Query: 446 KRHNLEFINVLTDTG-------------LLNENCGPEWAGMKRFDARKNVIEALKQKGLY 492
            ++ LE  + +   G             LL E  G     + R    K ++  LK + + 
Sbjct: 372 IQNFLEIFSPVDHEGRYNVEELPAHLRDLLKEESGKGRKVLDRTTTEK-ILSVLKGENML 430

Query: 493 IGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRITITPKSSEAEYF 552
           +   +   + P   RS   I     PQW+     +   A++A++   +   P+       
Sbjct: 431 MHHHEYVHSYPYDWRSKKPIIIRATPQWFADLHDVKTLALRALE--TVKFVPERGINRLS 488

Query: 553 HWLENIQDWCISRQLWWGHRCPVYFVDIEGQDNDQI-----------------DGEYWVS 595
            +++   +WCISRQ +WG   P      +  D D +                     W +
Sbjct: 489 SFIKTRNEWCISRQRYWGVPIPSLH---KRDDPDSVLMNEETISHIIKTIESKGVNSWFA 545

Query: 596 GRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDKTKDLSQFYPFSM 655
              +          + +  +   +  D +D WF SG        W      L    P  +
Sbjct: 546 ESTVDSMYQWLPKKYHDIAHEYYRGTDTVDVWFDSGSSWNVIADWYKNVAGLQSQLPVPL 605

Query: 656 LET---GWDILFFWVSRMILLGLELTG--EIPFKEVFCHSLVRDAQGRKMSKSLGNVVDP 710
            +    G D    W    +L  +  +G  + P+K V  H    D  G KMSKS+GN + P
Sbjct: 606 ADIYLEGSDQHRGWFQSSLLTKVASSGMPDAPYKNVITHGFTLDENGIKMSKSIGNTISP 665

Query: 711 LDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGG 770
             ++ G               DP+                +P  G D LR  L A +   
Sbjct: 666 GAIIKG---------------DPKA--------------NLPALGVDGLRL-LVAQSNFT 695

Query: 771 RDINLDILRVEGYRKFCNKIYQATKFALIRLGEDYQPPSMEKLSGNESLVEKWILN--KM 828
            D+      ++       K     KF L  L E  Q   +   S    + +  +LN   +
Sbjct: 696 SDVVAGPTVMKHVADALKKFRLTFKFILGNLQET-QSHGLIPFSELRRVDQYTLLNLKAL 754

Query: 829 TNYAKSINEALDKRDFLTSTSGIYEFWYLVCDVYIENSK-YLITEGTDAEKK-SAKDTLY 886
           +   K + +  +  + LT     Y     +  +Y   +K  L ++  + +K+ S + TL+
Sbjct: 755 SQETKKLYQQYNFSNVLTQVQ--YHMNNDLSALYFSVTKDSLYSDSLNNKKRLSIQTTLF 812

Query: 887 ILIDNALRLIHPFMPFISEEMWQRLPK 913
            ++D    ++ P +P + +E+W   PK
Sbjct: 813 HILDTYRSIMSPIIPIMVQEVWNYTPK 839

>KLLA0E05269g 476546..479173 similar to sp|P11325 Saccharomyces
           cerevisiae YLR382c NAM2 leucine--tRNA ligase precursor,
           mitochondrial singleton, start by similarity
          Length = 875

 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 98/391 (25%), Positives = 157/391 (40%), Gaps = 112/391 (28%)

Query: 186 PNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGI-ATQSVVEKQV----WA 240
           P  +G LHIGH     I D + R+ ++KG  VL   G+D  G+ A  + +E++V    W 
Sbjct: 57  PYPSGTLHIGHLRVYTISDVVNRFYQLKGYNVLHPMGWDAFGLPAENAAIERKVNPAIWT 116

Query: 241 KEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEA 300
           KE   +                      +K Q+  + ++++W RE  T  PE  K   + 
Sbjct: 117 KENIGK----------------------MKAQMGMMASNFNWDREIATCDPEYYKFTQKL 154

Query: 301 FVRLHEKGVIYRANRLVNWSVKLNTAISNLEVEN------------KDIKARTLLSVPGY 348
           F+ L + G  YR    +NW     T ++N +V++            K + ++  L +  +
Sbjct: 155 FLELFKNGYAYRKEAEINWDPVDQTVLANEQVDSNGKSWRSGAQVEKKLLSQWFLGITRF 214

Query: 349 DEKVEF------------------------GVLTSFAYPVVDSDEKLIVATTRPETMFGD 384
             +++                         GV   F  P +D    + + TTRPET++  
Sbjct: 215 AHELQHDLDGLDGWPSHVKRMQKNWIGESKGVEVVFNLPSIDP---IKIFTTRPETLYSV 271

Query: 385 TGVA---------------------VH-----PDDPRYKH-LHGKFVQHPFLPRK-IPIF 416
             V                      +H     P+D +  + L   F QHP  P+K +PIF
Sbjct: 272 QFVTLALDHSIVRKLKEEDNNLQEFIHRAEKLPEDSKKGYMLSNIFCQHPLDPKKTVPIF 331

Query: 417 CDSEAVDMNFGTGAVKMTPAHDQNDYNTGKR--------HNLEFINVLTDT--------G 460
             +  V  N+G GAV   PAHDQ D++  K         + +       DT        G
Sbjct: 332 V-APYVLGNYGHGAVMGCPAHDQRDFDFWKENCPGKPMIYTVSSAEAKIDTSGPYVSKDG 390

Query: 461 LLNENCGPEWAGMKRFDARKNVIEALKQKGL 491
           ++NEN G +  G+   +ARK V+E L   GL
Sbjct: 391 VMNENAG-DLVGLTTHEARKLVVEKLTSLGL 420

>YLR382C (NAM2) [3761] chr12 complement(882067..884751) Leucyl-tRNA
           synthetase, mitochondrial, forms a ternary complex with
           bI4 maturase and bI4 intron and stimulates bI4 intron
           splicing activity, dominant alleles suppress mutations
           in the bI4 maturase [2685 bp, 894 aa]
          Length = 894

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 185/833 (22%), Positives = 296/833 (35%), Gaps = 197/833 (23%)

Query: 186 PNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGI-ATQSVVEKQVWAKEKK 244
           P  +GALHIGH     I DSL R+ + KG  V+   G+D  G+ A  + +E+ +      
Sbjct: 56  PYPSGALHIGHLRVYVISDSLNRFYKQKGYNVIHPMGWDAFGLPAENAAIERSI------ 109

Query: 245 TRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRL 304
                   A       W  D   ++K Q+  + A++DW RE  T  PE  K     F++L
Sbjct: 110 ------NPAI------WTRDNIAKMKQQMQSMLANFDWDREITTCDPEYYKFTQWIFLKL 157

Query: 305 HEKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFA--- 361
            E G+ YR    +NW     T ++N +V+ +    R+   V     K  F  +T FA   
Sbjct: 158 FENGLAYRKEAEINWDPVDMTVLANEQVDAQGRSWRSGAIVEKKQLKQWFLGITKFAPKL 217

Query: 362 -------------------------------YPVVDSD-EKLIVATTRPETMFGDTGVAV 389
                                          + V D   E LIV TTRPET+F    VA+
Sbjct: 218 KKHLNQLKDWPSNVKQMQKNWIGESVGAELVFKVADPKFENLIVFTTRPETLFAVQYVAL 277

Query: 390 HPDDPRYKHLH------GKFVQ---------------------HPFLPRKIPIFCDSEAV 422
             D P  +          +F+Q                     +P    ++PIF     V
Sbjct: 278 ALDHPIVQKYCEEMPDLKEFIQKSDQLPNDTKEGFQLPNIKAVNPLTKEEVPIFAAPYVV 337

Query: 423 DMNFGTG--AVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDARK 480
             ++G+   AV   P HD  D+        EF         +     P       FD   
Sbjct: 338 S-SYGSAPSAVMGCPGHDNRDF--------EFWQTNCPGEHIKTCIAP------FFDDAS 382

Query: 481 NVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRI 540
            V E  +Q+ +         T+P  S  G     +L  +       +   A K++     
Sbjct: 383 KVTEQERQRIID--------TVPFTSTDG-----VLTKECGEHSGVLTVVARKSIMGMLN 429

Query: 541 TITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVD------------------IEG 582
           +     S   Y      I+DW ISRQ +WG   P+   D                  +EG
Sbjct: 430 SEGLSKSVVRY-----KIRDWLISRQRYWGTPIPIIHCDNCGPVPVPESDLPVKLPELEG 484

Query: 583 QDNDQIDGEYWVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPD 642
            D           G  L           P+     K++ D +DT+  S  + F  L   +
Sbjct: 485 LD---------TKGNPLSTIDEFVNVACPSCGSPAKRETDTMDTFIDSSWYYFRFLDPKN 535

Query: 643 KTKDL-----SQFYPFSMLETGWD--ILFFWVSRMILLGLELTGEI-----------PFK 684
            +K       S+  P  +   G +  IL    SR I    +  G I           PFK
Sbjct: 536 TSKPFDREIASKNMPVDIYIGGVEHAILHLLYSRFI---AKFLGSINAWSDPAGIFEPFK 592

Query: 685 EVFCHSLVRDAQGRK-MSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQ 743
           ++    +V   QG+  +    G  + P ++       D +  ++  N     V   K   
Sbjct: 593 KLVTQGMV---QGKTYVDPDSGKFLKPDELTFVNDSPDGNTVIIKSNGKVPVVSYEKMS- 648

Query: 744 KESYPNGIP-QC----GTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFAL 798
           K  Y    P +C    G DA R  +   +     +N D  ++ G  ++  K+   TK  L
Sbjct: 649 KSKYNGADPNECILRHGPDATRAHILFQSPIADALNWDESKIVGIERWLQKVLHLTKNIL 708

Query: 799 -----IRLGEDYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYE 853
                + + +DY+ P+      N++ V+    N    + KSI E+ +    L+  + I +
Sbjct: 709 SLEKDLAISKDYKTPT----DLNDAEVK--FHNDFQRFLKSITESFEVN--LSLNTVISD 760

Query: 854 FWYLVCDVYIENSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEE 906
           +  L            I E    + +   + +   +   + +I+P +P ISEE
Sbjct: 761 YMKLTN----------ILESALKKGEVRNEMIVQNLQKLVTVIYPAVPSISEE 803

>Kwal_26.9374
          Length = 884

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 137/620 (22%), Positives = 221/620 (35%), Gaps = 157/620 (25%)

Query: 186 PNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGI-ATQSVVEKQVWAKEKK 244
           P  +G LHIGH     I D+L R+ +  G  V+   G+D  G+ A  + +E++V      
Sbjct: 58  PYPSGNLHIGHLRVYTITDALNRFYKQNGYNVIHPMGWDAFGLPAENAAIERKVNPAS-- 115

Query: 245 TRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRL 304
                           W      ++K Q+N + A++DW RE  T +P+  K   + F+ L
Sbjct: 116 ----------------WTHQNIAKMKEQLNNMLANFDWDREVTTCNPDYYKHTQKLFLEL 159

Query: 305 HEKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFAYPV 364
            ++G+ YR +  +NW     T ++N +V+ +    R+   V        F  +T +A+ +
Sbjct: 160 FKRGLAYRKDAEINWDPVDQTVLANEQVDAQGRSWRSGALVEKRKLNQWFLGITKYAHAL 219

Query: 365 ---------------------------------VDSDEKLIVATTRPETMFGDTGVAVHP 391
                                              + E + V TTRPET+F    VA+  
Sbjct: 220 QHDLNQLQDWPRNVKTMQKNWVGESHGTEIDFKCSTSETIQVFTTRPETLFSVQYVALAL 279

Query: 392 DDPRYK---------------------------HLHGKFVQHPFLPRK---IPIFCDSEA 421
           D+P  +                            L G   ++P L      +PIF  +  
Sbjct: 280 DNPVIEKAAISDPELRKFIDQAKFLSPDCKDGYQLKGVKAKNPILKAAEYDLPIFA-APY 338

Query: 422 VDMNFGTGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDARKN 481
           V  N+G GAV   PAHD+ D                            WA        K 
Sbjct: 339 VLGNYGKGAVMGCPAHDERD-------------------------NAFWAQNMPGHPTKP 373

Query: 482 VIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWW--VSQSQMAEKAIKAVKDGR 539
            I A +      G   N + +P  S+SG +    +        + ++   KA+++  +GR
Sbjct: 374 SIIAKED-----GTATNLLQLPFTSKSGILSSAAMTYAGMDTTTAAKQMTKALESSGNGR 428

Query: 540 ITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDN----------DQID 589
             ++ K            ++DW ISRQ +WG   P+      G              +ID
Sbjct: 429 YMVSYK------------LRDWLISRQRYWGTPIPIIHCPSCGPVGVPDEHLPVLLPEID 476

Query: 590 GEYWVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSGLWPF-----STLGWPDKT 644
           G     G  L           P+     K++ D +DT+  S  + F       L  P   
Sbjct: 477 G-LATRGNPLQKVDDFVNTTCPSCGSPAKRETDTMDTFIDSSWYFFRFTDPKNLHEPFSY 535

Query: 645 KDLSQFYPFSMLETGWD--ILFFWVSRMILLGLELTGEI--------PFKEVFCHSLVRD 694
           +  S+  P      G +  IL    SR I   L   G+         PFK +    +V  
Sbjct: 536 EAASENLPVDFYIGGIEHAILHLLYSRFISKFLASIGKWDSGNYHGEPFKRLVTQGMV-- 593

Query: 695 AQGRKMSK-SLGNVVDPLDV 713
             G+ M+  S G  + P +V
Sbjct: 594 -HGKTMTDPSTGRFLKPSEV 612

>AER043C [2548] [Homologous to ScYLR382C (NAM2) - SH]
           (711416..714037) [2622 bp, 873 aa]
          Length = 873

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 105/462 (22%), Positives = 166/462 (35%), Gaps = 131/462 (28%)

Query: 186 PNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWAKEKKT 245
           P  +G LHIGH     I D+L R+ RMKG  V+   G+D  G+  ++   ++  A    T
Sbjct: 56  PYPSGMLHIGHLRVYTISDALNRFYRMKGYEVVHPMGWDAFGLPAENAALERGIAPADWT 115

Query: 246 RHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRLH 305
           R +  R                 +K Q   + A ++W RE  T  PE  +   E F+ L 
Sbjct: 116 RQNIAR-----------------MKQQKGDMLAHFEWGREVTTCDPEYYRFTQELFLELW 158

Query: 306 EKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFAYPV- 364
             G+ Y+    +NW     T ++N +V+ +    R+   V        F  +T FA+ + 
Sbjct: 159 HHGMAYKKEAEINWDPVDKTVLANEQVDAQGRSWRSGALVEKRKLNQWFLRITRFAHELS 218

Query: 365 --------------------------------VDSDEKLIVATTRPETMFGDTGVAVHPD 392
                                               E ++  T R E +FG   VA+  +
Sbjct: 219 HDLDGLDGWPAKVKAMQKHWIGEVEGTEVRLCTGDGEAIVAFTPRIEAVFGLQYVAISTE 278

Query: 393 DPRYK---------------------------HLHGKFVQHPFLP---RKIPIFCDSEAV 422
               K                            L G +VQHPF      +IP+F  S  V
Sbjct: 279 HALTKKMAERLPELCEFLQRPLVLSESDLSGFQLPGTYVQHPFAKDHGHRIPVFV-SPYV 337

Query: 423 DMNFGTGAVKMTPAHDQNDYN--TGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDARK 480
             + G GAV  TPAHD+ D+      +     I+    +G  ++ C              
Sbjct: 338 PAD-GAGAVLGTPAHDEFDHKFWRANKPAEPVISSFEASGECDDEC-------------- 382

Query: 481 NVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRI 540
                ++ KG+   +  N   I +                  ++  +A+K + A  DGR 
Sbjct: 383 ----HIQTKGILNAKAGNLKGISSQD----------------AKQVLADKLV-ATGDGRQ 421

Query: 541 TITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEG 582
           T        +Y      ++DW ISRQ +WG   P+ + D  G
Sbjct: 422 T-------TQY-----RLRDWLISRQRYWGAPIPIIYCDSCG 451

>CAGL0H05049g complement(483870..486593) similar to sp|P11325
           Saccharomyces cerevisiae YLR382c NAM2, hypothetical
           start
          Length = 907

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 175/821 (21%), Positives = 300/821 (36%), Gaps = 184/821 (22%)

Query: 186 PNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGI-ATQSVVEKQVWAKEKK 244
           P  +G LH+GH     I D+L R+ + +G  V+   G+D  G+ A  + +E+ +   E  
Sbjct: 77  PYPSGMLHMGHLRVYVISDTLNRFYQQRGYNVIHPMGWDAFGLPAENAAIERGIDPSE-- 134

Query: 245 TRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRL 304
                           W +   K++K Q+N + A+++W RE  T  PE  K     F++L
Sbjct: 135 ----------------WTKQNIKKMKEQMNDMLANFNWEREVTTCDPEYYKFTQWLFLQL 178

Query: 305 HEKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFAYPV 364
           ++ G+ YR +  +NW     T ++N +V+      R+   V        F  +T F   +
Sbjct: 179 YKNGLAYRKDAEINWDPVDKTVLANEQVDANGRSWRSGAIVEKKKLTQWFLGITKFVDQL 238

Query: 365 VDS-------------------------------------DEKLIVATTRPETMFGDTGV 387
            D                                       E + V TTR ET+F    V
Sbjct: 239 RDDLKYLEEWPNKVKTMQNNWIGSSTGMEVNFKLNKKIGKFENVTVFTTRAETLFSVEYV 298

Query: 388 AVHPDDPRYKH-----------LH----------------GKFVQHPFLPRKIPIFCDSE 420
            +  D P  +H           LH                   V++P     IP+F    
Sbjct: 299 VLATDHPITQHYAKQKSDLREFLHKLPELPEDTKTGYRISDLTVENPITHEVIPVFVAPY 358

Query: 421 AVDMNFGT--GAVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDA 478
            +   +G    AV   PAHD  DY   K               +N N   E  G      
Sbjct: 359 VIS-GYGDLPAAVMGCPAHDLRDYEFRK---------------INLNTNEEPFGC----- 397

Query: 479 RKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDG 538
              +I  L +    +GQ+    +IP  S+SG + E   K   W          + A +D 
Sbjct: 398 ---IIPDLSR----LGQD----SIPYTSKSGTMNERCGKYVGW---------DVNATRDA 437

Query: 539 RITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEG-----QDNDQIDGEY- 592
            I+   ++           I+DW ISRQ +WG   P+   +  G     +++  +   Y 
Sbjct: 438 -ISTELENKNLGKRTTRYRIKDWLISRQRYWGSPIPIIHCNNCGIVPVPEEDLPVTLPYV 496

Query: 593 ---WVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDKTKDLS- 648
                 G  L           P    + K++ D +DT+  S  + F  +   +K    S 
Sbjct: 497 QGLHQKGNPLSNISDFVNTECPRCHNSAKRETDTMDTFIDSSWYFFRYIDAHNKVLPFSP 556

Query: 649 ----QFYPFSMLETGWD--ILFFWVSRMILLGLELTGEI--------PFKEVFCHSLVRD 694
               +  P  +   G +  IL    SR I   L   G          PFK++    +V  
Sbjct: 557 EKANKSMPVDIYIGGVEHAILHLLYSRFISKFLSSIGMWDRGISHGEPFKKLVTQGMV-- 614

Query: 695 AQGRKM-SKSLGNVVDP--LDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESYPN-G 750
            QG+ +     G  + P  +D +       +  K ++  L   ++ K+K    +  PN  
Sbjct: 615 -QGKTLIDPETGKFLTPNDIDYLSSSSTPKIKGKNIAPILKYEKMSKSKYNGAD--PNEC 671

Query: 751 IPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQ-ATKFALIR---LGEDYQ 806
           I + G DA R  +   +     +  D  ++ G  ++ +KI Q    FA      +G    
Sbjct: 672 ISKHGPDATRAHILFQSPISDALRWDEEKIVGIERWLDKILQLCMSFASNPDKIVGMTGI 731

Query: 807 PPSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYEFWYLVCDVYIENS 866
           PP  ++ + +E  +   +   + +  KS +E L     ++         Y+     +EN+
Sbjct: 732 PP--DQYNTDEITLYNNVSKMVNSITKSFSENLSLNTVISD--------YMKLTTLLENA 781

Query: 867 KYLITEGTDAEKKSAKDTLYI-LIDNALRLIHPFMPFISEE 906
           K         +    +DT+ I  + + ++ I+P +P I+EE
Sbjct: 782 K---------KNTKIRDTVTINYVRDLIKCIYPVVPSIAEE 813

>Scas_719.5
          Length = 939

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 178/850 (20%), Positives = 303/850 (35%), Gaps = 237/850 (27%)

Query: 186 PNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGI-ATQSVVEKQVWAKEKK 244
           P  +G LH+GH     I DSL R+ + +G  V+   G+D  G+ A  + + + +   +  
Sbjct: 79  PYPSGTLHMGHLRVYVISDSLNRFFKQRGYEVIHPMGWDAFGLPAENAAIARGINPAD-- 136

Query: 245 TRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRL 304
                           W +    ++K Q+N + A++DW RE  T  P+  K     F++L
Sbjct: 137 ----------------WTKQNIAKMKEQMNNMLANFDWDREVTTCDPDYYKFNQWIFLKL 180

Query: 305 HEKGVIYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFA--- 361
           +E G+ Y+    +NW     T ++N +V++  I  R+   V     K  F  +T FA   
Sbjct: 181 YENGLAYQKEAEINWDPVDKTVLANEQVDSNGISWRSGAKVEKRQLKQWFLGITKFAKDL 240

Query: 362 ---------YP-------------------VVDSDEKLI----VATTRPETMFGDTGVAV 389
                    +P                   +  +D +L     + TTR ET+F    VA+
Sbjct: 241 RKDLYTLKKWPENVKTMQRNWIGESSGATLLFGTDNELFKHIQLFTTRAETLFAVQFVAL 300

Query: 390 ---HP-------DDPRYKHL------------HGKFVQ-----HPFLPRKIPIFCDSEAV 422
              HP        DP+ +               G  ++     +P   +K+ IF     +
Sbjct: 301 SKEHPIVEHYAKTDPKLREFITIMDTLPDDSKTGYLLKDIKAINPLTKKKVSIFVAPYVI 360

Query: 423 DMNFGT-----GAVKMTPAHDQNDY-----NTGKRHNLEFINVLT--------------- 457
             ++G+      AV   PAHD+ D+     N+     +  I+  T               
Sbjct: 361 G-SYGSDNEPGAAVMGCPAHDERDFAFWHENSPNEPIISCIDPFTLLEDDSITALNSPLP 419

Query: 458 ---DTGLLNENCGPEWAGMKRFDARKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEP 514
              D G ++E C  E+ G+    AR ++++ L+ + L                       
Sbjct: 420 YTYDLGSMSEICA-EYHGLATEAARASIVQKLRSENL----------------------- 455

Query: 515 LLKPQWWVSQSQMAEKAIKAVKDGRITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCP 574
                                  G  TI  K            I+DW ISRQ +WG   P
Sbjct: 456 -----------------------GHTTINYK------------IRDWLISRQRYWGTPIP 480

Query: 575 VYFVDIEG----QDND------QIDGEYWVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVL 624
           +   D  G     + D      ++       G  L           P+     K++ D +
Sbjct: 481 IIHCDHCGPVPVPEKDLPVMLPEVKTITAKGGNPLSQIPEFVNAKCPSCGSDAKRETDTM 540

Query: 625 DTWFSSGLWPFSTLG-----WPDKTKDLSQFYPFSMLETGWD--ILFFWVSRMILLGLEL 677
           DT+  S  + F  L       P   K  S+  P  +   G +  IL    +R I   L  
Sbjct: 541 DTFMDSSWYFFRYLDPKNKELPFDPKLASRNIPVDIYIGGVEHAILHLLYARFISKFLGS 600

Query: 678 TGEI--------PFKEVFCHSLVRDAQGRK-MSKSLGNVVDP----LDVVCGIKLEDLHA 724
            G          PFK++    +V   QG+  ++   G  + P    LD   G  +  + A
Sbjct: 601 IGMFDGAKFKFEPFKQLVTQGMV---QGKTYINPENGRFLKPDEVELDTAKGHPI--IKA 655

Query: 725 KLLSGNLDPREVEKAKAGQKESYPNG-IPQCGTDALRFALCAYTTGGRDINLDILRVEGY 783
             L+  +   ++ K+K    +  PN  I + G DA R  +   +     +  D +++ G 
Sbjct: 656 TGLAPQVSYEKMSKSKYNGAD--PNQCIAKHGPDATRAHILFQSPITDALAWDEVKIIGI 713

Query: 784 RKFCNKIYQAT-------KFALIRLGEDYQPPSMEKLSGNESLVEKWILNKMTNYAKSIN 836
            ++  ++ + T       K+A      DY  PS      + +  E    N++    KSI 
Sbjct: 714 ERWLIRVIRHTMVLSKEQKYAF-----DYTTPS------DMTDPEIEFHNEIQRLLKSIT 762

Query: 837 EALDKRDFLTSTSGIYEFWYLVCDVYIENSKYLITEGTDAEKKSAKDTLYILIDNALRLI 896
           +  D          IY     V   Y++ +  L  E     K   K+   + +   + +I
Sbjct: 763 QGFD----------IYLSLNTVISDYMKFTNVL--ENAYKNKTVRKELQMLNLQKLISVI 810

Query: 897 HPFMPFISEE 906
           +P  P ISEE
Sbjct: 811 YPVTPSISEE 820

>AAL088W [99] [Homologous to ScYPL160W (CDC60) - SH]
           complement(185828..189142) [3315 bp, 1104 aa]
          Length = 1104

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%)

Query: 179 FCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK 236
           F  P   P + G LH+GH  T++  +  + + RM GK  LF  GF   G+   +  +K
Sbjct: 72  FMAPMAYPYMNGVLHVGHCFTMSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADK 129

>KLLA0D06105g complement(522480..525767) highly similar to sp|P26637
           Saccharomyces cerevisiae YPL160w CDC60 leucine--tRNA
           ligase, cytosolic singleton, start by similarity
          Length = 1095

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 54/122 (44%), Gaps = 12/122 (9%)

Query: 125 TAAGEKKILVSLEDPALKAYNPANVESSWYDWWVKSGFFE---PEFTKEG-EIKPEGL-- 178
           +AA E K LV LE+ A +    A +E  +   W +   FE   P   +E   + PE L  
Sbjct: 2   SAATETKGLV-LENTARRDALIA-IEKKYQKIWAEEHQFEIDAPTLDEENVSVDPEELQK 59

Query: 179 ----FCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVV 234
               F      P + G LH GH  T++  +  I + RM GK  LF  GF   G+   +  
Sbjct: 60  KYPKFMSSFAYPYMNGVLHAGHCFTLSKVEFSIGFERMNGKRALFPIGFHCTGMPILACA 119

Query: 235 EK 236
           +K
Sbjct: 120 DK 121

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 86/404 (21%), Positives = 137/404 (33%), Gaps = 118/404 (29%)

Query: 276 LGASYDWSREAFT--LSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVE 333
            GA  DW R   T  L+P   + +     +L + G I    R   +S K      + + +
Sbjct: 214 FGARIDWRRSFITTDLNPYYDQFIKWQMKKLKDLGKIKFGERYTIYSEKDGQPCMDHDRQ 273

Query: 334 NKD-IKARTLLSVPGYDEKVEFGVLTSFAYPVV-----DSDEKL--IVATTRPETMFGDT 385
           + + +  +  L +     K+E       A  +V     D  +K+  + AT RPETM+G T
Sbjct: 274 SGEAVTPQEYLGI-----KIEVTEFAEEAKKIVAESTLDHSKKIYFVAATLRPETMYGQT 328

Query: 386 GVAVHPD---------DPRY------------------------------KHLHGKFVQH 406
              V P          D  Y                              KH  G  +  
Sbjct: 329 CCFVSPTINYGIFDAGDCYYITTERAFKNMSYQKLTPERGNYKPVVSVLGKHFVGSKIHA 388

Query: 407 PFLP----RKIPIFCDSEAVDMNFGTGAVKMTPAHDQNDYNTGK--RHNLEFINV----- 455
           P  P    R +P+    + V    GTG V   P +  +DY T +  +H  E+  +     
Sbjct: 389 PLTPYPELRILPM----DTVIATKGTGVVTCVPTNSPDDYMTTQDLKHKPEYYGIDPEWI 444

Query: 456 ---------------LTDTGLLNE------NCGPEWAGMKRFDARKNVIEALKQKGLYIG 494
                          LT   L  E          + A  K+   +++    +   G Y G
Sbjct: 445 NHELVPVIHTDRYGDLTAKSLCEELKIKSPKDTNQLAEAKKLAYKEDFYSGVMIYGKYKG 504

Query: 495 QE--------------DNEMTI------PTCSRSGDVIEPLLKPQWWV--SQSQMAEKAI 532
           ++              +NE  +         SRSGD     L+ QW+V   + +  ++AI
Sbjct: 505 EKVETAKAKVKSDMIANNEAFVYNEPESVVISRSGDECIVSLEDQWYVDYGEEEWKKQAI 564

Query: 533 KAVKDGRITITPKSSEA--EYFHWLENIQDWCISRQLWWGHRCP 574
           + + +G     P+   A      WL N   W +SR    G R P
Sbjct: 565 ECL-EGMELFAPEVKNAFESVLDWLRN---WAVSRSYGLGTRLP 604

>Scas_650.7
          Length = 1119

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 186 PNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK 236
           P   GALH GH  T++  +  + + RM GK  LF  GF   G+   +  +K
Sbjct: 95  PYANGALHAGHCFTLSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADK 145

>CAGL0J03652g 346614..349895 highly similar to sp|P26637
           Saccharomyces cerevisiae YPL160w CDC60 leucine-tRNA
           ligase, hypothetical start
          Length = 1093

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 186 PNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK 236
           P + G LH GH  T++  +  I + RM GK  LF  GF   G+   +  +K
Sbjct: 69  PYMNGVLHAGHCFTLSKVEFSIGFERMNGKRALFPLGFHCTGMPILACADK 119

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 174/818 (21%), Positives = 270/818 (33%), Gaps = 237/818 (28%)

Query: 274 NKLGASYDWSREAFTLSPELTKSVTEAFVR-----LHEKGVIYRANRLVNWSVKLNTAIS 328
           + LG+  DW R   T          +AF+R     L   G I    R   +SVK      
Sbjct: 210 SSLGSRIDWRRSYITTD---ENPYYDAFIRWQMNKLKALGKIKFGERYTIYSVKDGQPCM 266

Query: 329 NLEVENKD-IKARTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKL--------IVATTRPE 379
           + + ++ + +  +  + +     K+E       A  ++D ++K+        + AT RPE
Sbjct: 267 DHDRQSGEGVTPQEYVGI-----KIEATEFAPEAKKLIDENDKIDKSKKIYFVAATLRPE 321

Query: 380 TMFGDTGVAVHPD---------DPRY------------------------------KHLH 400
           TM+G T   V P          D  Y                              K   
Sbjct: 322 TMYGQTCCFVSPKIDYGIFDAGDSYYITTERAFKNMSYQKLTPVRGEYSPVAVINGKAFI 381

Query: 401 GKFVQHPFLPRKIPIFCDSEAVDMNFGTGAVKMTPAHDQNDYNTGKRH------------ 448
           G  +  P  P K       E V    GTG V   P +  +DY T K              
Sbjct: 382 GTKIHAPLTPYKELRILPMETVIATKGTGVVTCVPTNSPDDYMTVKDLIKKSEYYGIDPT 441

Query: 449 --NLEFINV--------LTDTGLLNE------NCGPEWAGMKRFDARKNVIEALKQKGLY 492
             ++E I V        LT   L  E      N   + A  K+   +++    +   G Y
Sbjct: 442 WIDMELIPVIKTDKYGDLTAKALCEELKIQSPNDTTKLAEAKKIAYKEDYYSGVMIYGDY 501

Query: 493 IGQE--------------------DNEMTIPTCSRSGDVIEPLLKPQWWVSQSQ-----M 527
            G++                     NE      SRSGD     L+ QW++   +      
Sbjct: 502 KGEKVEIAKAKVKADMIAKGEAFVYNEPEGLVMSRSGDECIVSLEDQWYLDYGEEEWRKQ 561

Query: 528 AEKAIKAVKDGRITITPKSSEA--EYFHWLENIQDWCISRQLWWGHRCP---VYFVDIEG 582
           AE+ +  ++       P+ + A      WL N   W +SR    G + P    Y V  E 
Sbjct: 562 AEECLSQME----VFAPEVNHAFKGVLGWLRN---WAVSRTYGLGTKLPWDDKYLV--ES 612

Query: 583 QDNDQIDGEYWVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFS-----SGLWPFST 637
             +  I   ++     L            N K     D DV D  F          P  +
Sbjct: 613 LSDSTIYQAFYTVAHLLFKDYYGKEIGPLNIKPEQMTD-DVFDYIFQHVDDVKSDIPLRS 671

Query: 638 LGWPDKTKDLSQFYPFSMLETGWDIL-----FFWVSRMILL-------GLELTGEIPFKE 685
           L      ++   FYP  +  +G D++     FF  + + L        G+   G      
Sbjct: 672 LQI--LRREFEYFYPLDVSISGKDLIPNHLTFFIYTHVALFPKKFWPKGIRANG------ 723

Query: 686 VFCHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKE 745
              H ++ +A   KMSKS GN          + LE +  K                    
Sbjct: 724 ---HLMLNNA---KMSKSTGNF---------MTLEQIVEKF------------------- 749

Query: 746 SYPNGIPQCGTDALRFALCAYTTGGRDINLD-------ILRVEGYRKFCNKIYQATKFAL 798
                    G DA R AL        D NLD       ILR+   +++  +I +      
Sbjct: 750 ---------GADASRIALADAGDTVEDANLDESNANAAILRLFNLKEWSEEIVK--DIDT 798

Query: 799 IRLGEDYQPPSMEKLSGNESLVEK-WILNKMTNYAKSINEALDKRDFLTSTSGIYEFWYL 857
           +R GE  +   +       SL+E+ +   ++TNY  ++   L   DF T+          
Sbjct: 799 LRSGEITEIFDVAFEHEMNSLIEETYKQYELTNYKNALKTGL--FDFQTAR--------- 847

Query: 858 VCDVYIENSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQR-LPKRTS 916
             D Y E           A     KD +   I+    ++ P  P  +E +++  L K+ S
Sbjct: 848 --DYYRE-----------ATGTMHKDLVLRYIETQALMLAPIAPHFAEYVYRDVLGKKGS 894

Query: 917 EQSPTIVKASYPVYRKDFDNQKAGEEYELILD-TIKEA 953
            Q+    +AS P+ R       AG EY   L  +I+EA
Sbjct: 895 VQTANFPRASKPIDRSIL----AGLEYVRALQRSIREA 928

>Sklu_2298.2 YPL160W, Contig c2298 4548-7838
          Length = 1096

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 186 PNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK 236
           P + G LH GH  T++  +  + + RM GK  LF  GF   G+   +  +K
Sbjct: 71  PYMNGVLHAGHCFTLSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADK 121

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 80/235 (34%), Gaps = 57/235 (24%)

Query: 276 LGASYDWSREAFT--LSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVE 333
            GA  DW R   T  ++P     +     +L   G I    R   +S K   A  + + +
Sbjct: 214 FGARIDWRRSFITADMNPYYDAFIRWQMNKLKALGKIKFGERYTIYSEKDGQACMDHDRQ 273

Query: 334 NKD-IKARTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKL--------IVATTRPETMFGD 384
           + + +  +  + +     K+E       A  +VDS + L        + AT RPETM+G 
Sbjct: 274 SGEGVTPQEYIGI-----KIEVTEFAPEAKKIVDSSDALDKSKKIYFVAATLRPETMYGQ 328

Query: 385 TGVAVHPD---------DPRY------------------------------KHLHGKFVQ 405
           T   V P          D  Y                              KH  G  + 
Sbjct: 329 TCCFVSPKIEYGIFDAGDAYYITTERAFKNMSYQKLTPKRGYYKPIVTISGKHFIGSKIH 388

Query: 406 HPFLPRKIPIFCDSEAVDMNFGTGAVKMTPAHDQNDYNTGK--RHNLEFINVLTD 458
            P    +       E V  N GTG V   P++  +DY T K  +H  E+  +  D
Sbjct: 389 APLAAYEELRILPMETVIANKGTGVVTCVPSNSPDDYMTTKDLQHKPEYYGIEAD 443

>YPL160W (CDC60) [5287] chr16 (246989..250261) Leucyl-tRNA
           synthetase, cytoplasmic [3273 bp, 1090 aa]
          Length = 1090

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 186 PNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK 236
           P + G +H GH  T++  +  I + RM GK  LF  GF   G+   +  +K
Sbjct: 66  PYMNGVMHAGHCFTLSKVEFSIGFERMNGKRALFPLGFHCTGMPILACADK 116

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 51/130 (39%), Gaps = 22/130 (16%)

Query: 276 LGASYDWSREAFTLSPELTKSVTEAFVR-----LHEKGVIYRANRLVNWSVKLNTAISNL 330
           LGA  DW R   T          +AF+R     L   G I    R   +S K   A  + 
Sbjct: 209 LGARIDWRRSFVTTD---ANPYYDAFIRWQMNKLKAAGKIKFGERYTIYSEKDGQACMDH 265

Query: 331 EVENKD-IKARTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKL--------IVATTRPETM 381
           + ++ + +  +  + V     K+E       A  ++DS   L        + AT RPETM
Sbjct: 266 DRQSGEGVTPQEYIGV-----KIEALEFADDAAKIIDSSSDLDKSKKFYFVAATLRPETM 320

Query: 382 FGDTGVAVHP 391
           +G T   V P
Sbjct: 321 YGQTCCFVSP 330

>YGR171C (MSM1) [2124] chr7 complement(840827..842554)
           Methionyl-tRNA synthetase, mitochondrial, member of
           class I family of aminoacyl-tRNA synthetases [1728 bp,
           575 aa]
          Length = 575

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 665 FWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDV 713
           +W S ++  GL L  +I    V  H L     G KMSKSLGNVVDP+D+
Sbjct: 313 YWPSFLLAAGLPLPRQIV---VHGHWL---CNGMKMSKSLGNVVDPIDM 355

>Scas_620.7
          Length = 576

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 91/254 (35%), Gaps = 63/254 (24%)

Query: 476 FDARKNVIEALKQKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAV 535
           F     VI+  K KG YI  E N   I              +  ++   SQ   K I  +
Sbjct: 151 FYPETKVIKDPKNKGKYINTESNNEVIYQS-----------EVNYFFKLSQFRNKLIDHI 199

Query: 536 KDGRITITPKSSEAEYFHWLENI---QDWCISR---QLWWGHRCPVYFVDIEGQDNDQID 589
            +    I P S   E  + L+N    QD  ISR   +L WG       +++ G    +I 
Sbjct: 200 SNNEAFIYPASKRTEILNELKNTDLSQDLSISRPSSRLKWG-------IEVPGDSTQRIY 252

Query: 590 ------GEYWVSGRNLXXXXXXXXXXFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDK 643
                   Y  S   +              ++ +       + W            W + 
Sbjct: 253 VWFDALCNYVTSIGGIQSVIREAPLNQTPLQHKINNSTITPNQW------------WCNT 300

Query: 644 T----KDLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRK 699
           T    KD+++F+             +W S ++  GL L  ++    V  H L     G K
Sbjct: 301 THLIGKDIARFH-----------CIYWPSFLMAAGLPLPKQVV---VHNHWL---CNGVK 343

Query: 700 MSKSLGNVVDPLDV 713
           MSKSLGNVVDP+++
Sbjct: 344 MSKSLGNVVDPIEM 357

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 9/68 (13%)

Query: 193 HIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWAKEKKTRHDYGRE 252
           H+GH  +  + D   R+N++ G   L   G D  G+  Q+  EK  ++  K         
Sbjct: 36  HLGHLYSSLLCDVFHRWNKLNGTPSLLTTGTDEHGLKIQAASEKNGFSDPK--------- 86

Query: 253 AFVEKIWE 260
            FV+K+++
Sbjct: 87  LFVDKLYK 94

>AAL133W [54] [Homologous to ScYGR171C (MSM1) - SH]
           complement(113951..115654) [1704 bp, 567 aa]
          Length = 567

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 193 HIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWAKEK 243
           H+GH  +  I D   R+ +++   VLF  G D  G+  Q+  E+Q +A  K
Sbjct: 29  HLGHLYSSLICDVQARWQKLRDSEVLFTTGTDEHGLKIQTASEQQGYASPK 79

>Kwal_33.15315
          Length = 583

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 60/144 (41%), Gaps = 19/144 (13%)

Query: 170 EGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIA 229
           +G +K + LF I  P        H+GH  +  + D   R++ M     LF  G D  G+ 
Sbjct: 8   QGGLK-KALFHITTPIFYPNAKPHLGHLYSSLLCDVSRRWHEMLTHQTLFTTGTDEHGLK 66

Query: 230 TQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTL 289
            Q+  EK+ +   K+         FV+ +      Y + +K       A+ D++R   T 
Sbjct: 67  IQTASEKRGFETPKQ---------FVDVL------YREFVKLD---QAANIDYTRFIRTT 108

Query: 290 SPELTKSVTEAFVRLHEKGVIYRA 313
             +   +V   + R  EKG IY+ 
Sbjct: 109 DADHIHAVQNIWNRCWEKGYIYKG 132

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 17/18 (94%)

Query: 697 GRKMSKSLGNVVDPLDVV 714
           G KMSKS+GNVVDPLD++
Sbjct: 345 GTKMSKSVGNVVDPLDMI 362

>CAGL0I08723g 849045..850799 similar to sp|P22438 Saccharomyces
           cerevisiae YGR171c MSM1 methionyl-tRNA synthetase,
           hypothetical start
          Length = 584

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 6/51 (11%)

Query: 663 LFFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDV 713
           + FW S ++   L L  +I    V  H L     G KMSKSLGNVV+P+ +
Sbjct: 324 IIFWPSFLLAANLPLPKQIV---VHSHWL---CNGFKMSKSLGNVVEPMKI 368

>Kwal_26.8831
          Length = 916

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (40%), Gaps = 16/127 (12%)

Query: 276 LGASYDWSREAFT--LSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAISNLEVE 333
            G+  DW R   T  ++P     +     +L E G I    R   +S K   A  + + +
Sbjct: 35  FGSRIDWRRSFITTDMNPYYDAFIRWQMNKLKELGKIKFGERYTIYSEKDGQACMDHDRQ 94

Query: 334 NKD-IKARTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKL--------IVATTRPETMFGD 384
           + + +  +  + +     K+E       A  ++DS E L        + AT RPETM+G 
Sbjct: 95  SGEGVTPQEYVGI-----KIEAIEFAEAAQKIIDSTESLDKSKKFHFVAATLRPETMYGQ 149

Query: 385 TGVAVHP 391
           T   V P
Sbjct: 150 TCCFVSP 156

>Sklu_2399.6 YGR171C, Contig c2399 15064-16788
          Length = 574

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 60/145 (41%), Gaps = 29/145 (20%)

Query: 639 GWPDKT-----KDLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIPFKEVFCHSLVR 693
           GW + T     KD+++F+             +W S ++   L L  +I    +  H L  
Sbjct: 301 GWWENTTHLIGKDIAKFHTV-----------YWPSFLMAADLPLPKQIV---IHGHWL-- 344

Query: 694 DAQGRKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGN---LDPREVEKAKAGQKE----S 746
            + G KMSKSLGNVVDPL ++     + +   LL  +    D   +E+   G +E     
Sbjct: 345 -SNGVKMSKSLGNVVDPLLMISYYGCDSMRWYLLENSRLETDCDFIEERLHGVRELLSSK 403

Query: 747 YPNGIPQCGTDALRFALCAYTTGGR 771
           + N I +C       A    T   R
Sbjct: 404 WGNLINRCCGPKFNLARGVSTFNNR 428

>ACL093C [956] [Homologous to ScYIR023W (DAL81) - SH]
           (178239..181271) [3033 bp, 1010 aa]
          Length = 1010

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 4/87 (4%)

Query: 887 ILIDNALRLIHPFMPFISEEMW-QRLPKRTSEQSPTIVKASYPVYRK--DFDNQKAGEEY 943
           IL+D   +LIHP+ P + E ++ ++  K   E +  I+ + Y +  +  DF  Q  G + 
Sbjct: 348 ILVDIFFKLIHPYFPILHERVFLEKYSKSYRELTAPILASIYSLALQWWDFHPQAVGFQR 407

Query: 944 ELILDTIKEARSLLAQYGILKNGKVFI 970
             ++D + E  +L   + +L+  K+ I
Sbjct: 408 PDVIDQLNEI-ALRTFFDVLERPKLSI 433

>KLLA0F14971g complement(1386169..1387875) similar to sp|P22438
           Saccharomyces cerevisiae YGR171c MSM1 methionyl-tRNA
           synthetase singleton, hypothetical start
          Length = 568

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (88%)

Query: 697 GRKMSKSLGNVVDPLDVV 714
           G KMSKSLGNVVDP+ ++
Sbjct: 340 GVKMSKSLGNVVDPIQII 357

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 53/135 (39%), Gaps = 18/135 (13%)

Query: 179 FCIPAPPPNVTGALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQV 238
           F I  P        H+GH  +  + D   R+ ++ G+   F  G D  G+  Q   +++ 
Sbjct: 12  FHITTPIFYPNAKPHLGHLYSSLLCDVQNRWKKLAGQDTCFTTGVDEHGLKIQLAAQQKG 71

Query: 239 WAKEKKTRHDYGREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVT 298
           ++  K         AFV+++ E      K          A+  ++R   T  P+   +V 
Sbjct: 72  YSNPK---------AFVDELCEHFVHLDK---------DANIKFTRFIRTTDPDHVNNVK 113

Query: 299 EAFVRLHEKGVIYRA 313
           + +   +  G IY+ 
Sbjct: 114 KLWNLCYNNGYIYKG 128

>Sklu_2208.4 YDR322W, Contig c2208 7462-8532
          Length = 356

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 786 FCNKIYQATKFALIRLGEDYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRDF 844
           + + I  A KF+   +  DY PP  EK +G +     W+  +   Y  SI  A D++DF
Sbjct: 253 YNDNIVDARKFSEQNIVADYLPPVPEKNAGKQRFA-VWVFRQTNPYNNSI--AFDRQDF 308

>AER107W [2612] [Homologous to ScYLR424W - SH]
           complement(838830..840740) [1911 bp, 636 aa]
          Length = 636

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 152 SWYDWWVKSGFFEPEFTKEGEIK 174
           SW++W++ SGF  P  T+  EIK
Sbjct: 491 SWFNWYINSGFHAPTNTQVQEIK 513

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,040,507
Number of extensions: 1551059
Number of successful extensions: 4610
Number of sequences better than 10.0: 54
Number of HSP's gapped: 4703
Number of HSP's successfully gapped: 99
Length of query: 1084
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 972
Effective length of database: 12,718,893
Effective search space: 12362763996
Effective search space used: 12362763996
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)