Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.396922422211541e-163
Sklu_1989.12232227521e-101
YGR095C (RRP46)2232165922e-77
KLLA0D14993g2252245886e-77
Scas_716.302282215765e-75
CAGL0G03113g2332215411e-69
AAR035C2522164065e-49
ACR035W2461361131e-06
Scas_647.72462261112e-06
Sklu_1267.22731391113e-06
Kwal_33.154532452211084e-06
CAGL0G09317g2462211077e-06
YGR195W (SKI6)2462261006e-05
KLLA0D09625g245139900.001
Scas_621.17239125760.063
AFR494W85350652.1
KLLA0F18304g236126632.8
ACR263C224041643.3
Sklu_2331.1222083633.7
YGR158C (MTR3)250146615.4
YHR155W122876617.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3969
         (222 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3969                                                          449   e-163
Sklu_1989.1 YGR095C, Contig c1989 348-1019                            294   e-101
YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein c...   232   2e-77
KLLA0D14993g complement(1266752..1267429) similar to sp|P53256 S...   231   6e-77
Scas_716.30                                                           226   5e-75
CAGL0G03113g complement(289747..290448) similar to sp|P53256 Sac...   213   1e-69
AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH] (406091..40...   160   5e-49
ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH] complement(...    48   1e-06
Scas_647.7                                                             47   2e-06
Sklu_1267.2 YGR195W, Contig c1267 529-1350                             47   3e-06
Kwal_33.15453                                                          46   4e-06
CAGL0G09317g complement(890158..890898) highly similar to sp|P46...    46   7e-06
YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the exo...    43   6e-05
KLLA0D09625g complement(813773..814510) highly similar to sp|P46...    39   0.001
Scas_621.17                                                            34   0.063
AFR494W [3686] [Homologous to ScYLR318W (EST2) - SH] complement(...    30   2.1  
KLLA0F18304g complement(1689187..1689897) similar to sp|P48240 S...    29   2.8  
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    29   3.3  
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            29   3.7  
YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein in...    28   5.4  
YHR155W (YHR155W) [2442] chr8 (407104..410790) Protein containin...    28   7.2  

>Kwal_23.3969
          Length = 224

 Score =  449 bits (1154), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 222/222 (100%), Positives = 222/222 (100%)

Query: 1   MLEAQTGVLDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGVPNT 60
           MLEAQTGVLDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGVPNT
Sbjct: 1   MLEAQTGVLDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGVPNT 60

Query: 61  REKLLEDQIRGVLTPILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALI 120
           REKLLEDQIRGVLTPILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALI
Sbjct: 61  REKLLEDQIRGVLTPILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALI 120

Query: 121 DSGIGLQSSFASVCLSVNGPNNEICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLIE 180
           DSGIGLQSSFASVCLSVNGPNNEICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLIE
Sbjct: 121 DSGIGLQSSFASVCLSVNGPNNEICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLIE 180

Query: 181 SHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISNDFIW 222
           SHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISNDFIW
Sbjct: 181 SHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISNDFIW 222

>Sklu_1989.1 YGR095C, Contig c1989 348-1019
          Length = 223

 Score =  294 bits (752), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 135/222 (60%), Positives = 176/222 (79%), Gaps = 1/222 (0%)

Query: 1   MLEAQTGVLDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGVPNT 60
           M++A T +LDQVDGS +++C  T V+CSVTGP+EPKARQELP+QLALEIVVRP KGVPNT
Sbjct: 1   MIQASTSILDQVDGSSQVECSATKVICSVTGPVEPKARQELPTQLALEIVVRPSKGVPNT 60

Query: 61  REKLLEDQIRGVLTPILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALI 120
           REKL+ED+IRGVLTP+L RYLYPRQLCQ+ FQ+LESGE +E Y+VKEL  CINAAYLAL+
Sbjct: 61  REKLMEDKIRGVLTPVLVRYLYPRQLCQLTFQVLESGESEEQYTVKELGCCINAAYLALV 120

Query: 121 DSGIGLQSSFASVCLSVNGPNNEICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLIE 180
           D+GI L+SSF SV + +    N+I  NP + QL +S S+HL+++E+G G  + + VLL++
Sbjct: 121 DAGIALKSSFVSVPICI-LEQNKIVTNPTAHQLAQSVSTHLISMEVGSGGTQVENVLLVD 179

Query: 181 SHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISNDFIW 222
           S+G F E QL DVL++GE+ C+ VA   R  ++ K+  DFIW
Sbjct: 180 SNGDFQENQLFDVLAEGEKECINVASAFRKIIQEKLQKDFIW 221

>YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein
           component of the exosome 3'-5' exoribonuclease complex
           involved in 3'end processing of multiple small RNA
           species [672 bp, 223 aa]
          Length = 223

 Score =  232 bits (592), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 157/216 (72%)

Query: 2   LEAQTGVLDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGVPNTR 61
           ++A+ G+LD VDGS +    +T V+CSVTGPIEPKARQELP+QLALEI+VRP KGV  TR
Sbjct: 3   VQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTR 62

Query: 62  EKLLEDQIRGVLTPILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121
           EK+LED++R VLTP++ R+ YPRQLCQI  QILESGE +  +S++EL+ CINAA+LAL+D
Sbjct: 63  EKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVD 122

Query: 122 SGIGLQSSFASVCLSVNGPNNEICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLIES 181
           +GI L S  AS+ +++    ++I ++P ++QL  S S H LALE   G K  + VLL++S
Sbjct: 123 AGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDS 182

Query: 182 HGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKIS 217
           +G F E QL  +L  GE+ C ++   +R  ++  IS
Sbjct: 183 NGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNIS 218

>KLLA0D14993g complement(1266752..1267429) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing singleton, hypothetical start
          Length = 225

 Score =  231 bits (588), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 157/224 (70%), Gaps = 4/224 (1%)

Query: 2   LEAQTGVLDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGVPNTR 61
           +E  T VL  VDGS  +    T V+CSV+GP+EPK+RQELP+QLALEI+V+P +GV +TR
Sbjct: 1   METTTHVLGHVDGSSVVSNSGTKVICSVSGPMEPKSRQELPTQLALEIIVKPAEGVQSTR 60

Query: 62  EKLLEDQIRGVLTPILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121
           EKL+EDQIR VLTP+LARYL+PRQ  QIC Q+LE+GE  + Y+VKE++ C+NAA LAL+D
Sbjct: 61  EKLMEDQIRSVLTPVLARYLHPRQFVQICLQVLEAGESRD-YTVKEVSVCVNAAVLALVD 119

Query: 122 SGIGLQSSFASVCLSVNGPNNEICINPASDQLIRSTSSHLLALEMGP---GSKKTQKVLL 178
           +G+ L S  +  C+ +     ++ +NP   QL +  S H+  LE+G    G    + +LL
Sbjct: 120 AGVPLLSMCSGTCIGITTEGKQLVVNPTESQLAKCESVHVYCLELGTNENGDIDVRNLLL 179

Query: 179 IESHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISNDFIW 222
           ++S G+F E QL  VL  GE+ C+++  ELRS ++ K++ DF+W
Sbjct: 180 LDSLGSFDESQLFKVLETGEKECIRLYTELRSVIKDKVAKDFVW 223

>Scas_716.30
          Length = 228

 Score =  226 bits (576), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 156/221 (70%), Gaps = 4/221 (1%)

Query: 4   AQTGVLDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGVPNTREK 63
           AQ G L +VDGS  I+  +T ++CSVTGPIEPK+RQELP+QLALEI++RP  GVPNTREK
Sbjct: 5   AQMGPLTKVDGSSLIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPNTREK 64

Query: 64  LLEDQIRGVLTPILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALIDSG 123
           L+ED++R V+TPI+ RYLYPRQLCQI  QIL SGE +  ++ +EL +CINA  +ALID+G
Sbjct: 65  LMEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALIDAG 124

Query: 124 IGLQSSFASVCLSVNGPNNE----ICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLI 179
           I L S  A V +++          + I+P+ ++L  S S H+LALE+    K  + VLL+
Sbjct: 125 IALNSMCACVPIALTSKEGSDETLLIIDPSDEELKSSNSVHVLALELVDQCKTVKNVLLL 184

Query: 180 ESHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISNDF 220
           +S+G F E+ L ++L  GE   L++ +++R  VE KI++D 
Sbjct: 185 DSNGDFNEKDLFNILESGEVEVLKLGKQIRHIVESKINSDI 225

>CAGL0G03113g complement(289747..290448) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing, hypothetical start
          Length = 233

 Score =  213 bits (541), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 99/221 (44%), Positives = 154/221 (69%), Gaps = 5/221 (2%)

Query: 5   QTGVLDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGVPNTREKL 64
           + G+L +VDGS K+    T+VLC+VTGP+EPKARQELP+++ALE++VRP KGVP  REK 
Sbjct: 8   ELGLLSEVDGSAKLLMNSTNVLCAVTGPVEPKARQELPTEMALEVIVRPAKGVPTPREKY 67

Query: 65  LEDQIRGVLTPILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALIDSGI 124
           LED+IR + TP++ R+ YPRQLCQI  QI+E+GE ++ ++ KEL++C+N+A LAL+++G+
Sbjct: 68  LEDKIRAIFTPLITRHKYPRQLCQITCQIMEAGENEQLHNQKELSACVNSALLALVNAGV 127

Query: 125 GLQSSFASVCLSVNGPNN-----EICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLI 179
            L    A+V ++V    +     +  I P+ ++L +S+S H +A+E+G   KK ++VLLI
Sbjct: 128 ALNDLAAAVTIAVIDDQSQENKAQYIIGPSDEELEKSSSVHTIAMEVGDNGKKVKRVLLI 187

Query: 180 ESHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISNDF 220
           ES+G F ++ + D+L   E ACL +    R  + + I  + 
Sbjct: 188 ESNGIFNDKVIFDILELSESACLNLCSNWRGVLTKHIQKEL 228

>AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH]
           (406091..406849) [759 bp, 252 aa]
          Length = 252

 Score =  160 bits (406), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 136/216 (62%), Gaps = 7/216 (3%)

Query: 7   GVLDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGVPNTREKLLE 66
           G+L  VDGS K      S +C V+GPIEPKARQE+P  LAL+++VRP  G P TREKLLE
Sbjct: 42  GILSHVDGSSKFSTAAASAICGVSGPIEPKARQEIPQHLALDVIVRPAAGPPTTREKLLE 101

Query: 67  DQIRGVLTPILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALIDSGIGL 126
           D++R  +TP++  +L+PRQLCQI  Q+L+S    E     EL   +NAAYLAL+D+G+ L
Sbjct: 102 DKVRATITPVVETFLHPRQLCQITLQVLKSVGQHEHM---ELAVALNAAYLALLDAGVPL 158

Query: 127 QSSFASVCLSVNGPNNEICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLIESHGAFT 186
           ++  ++V ++V+    E+  NP+  +L  + S    A  +  G      +LL++ +G F 
Sbjct: 159 RAVLSAVSIAVST-EGELTQNPSPAELQDARSVFTAAFSVADG---VNTLLLLDGNGTFE 214

Query: 187 EQQLLDVLSKGEEACLQVAQELRSAVERKISNDFIW 222
           E  +  VL   E+ C+++A ELR AV+ K+  DFIW
Sbjct: 215 ESTVSKVLELAEKECVRLAGELRHAVKEKLEKDFIW 250

>ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH]
           complement(422233..422973) [741 bp, 246 aa]
          Length = 246

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 59/136 (43%), Gaps = 18/136 (13%)

Query: 13  DGSCKIQCGETSVLCSVTGPIEPKARQEL-PSQLALEIVVRPCKGVPNTREKLLEDQIRG 71
           DGS  ++ G   ++  VTGP EP  R ++ PS+  L + V   K     R K      R 
Sbjct: 37  DGSSYLEQGNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERR 96

Query: 72  VL---TPILARY-------LYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121
           +L   T ++  +       LYPR    +   +L++           L S IN   LALID
Sbjct: 97  ILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQN-------DGGVLGSMINGITLALID 149

Query: 122 SGIGLQSSFASVCLSV 137
           +GI +    + + + +
Sbjct: 150 AGIAMYEYISGISVGL 165

>Scas_647.7
          Length = 246

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 92/226 (40%), Gaps = 40/226 (17%)

Query: 13  DGSCKIQCGETSVLCSVTGPIEPKARQELPSQLA-LEIVVRPCKGVPNTREKLLEDQIRG 71
           DGS  ++ G   V+  V GP EP  R ++ ++ A L+I V   +     R K      R 
Sbjct: 37  DGSSYLEQGNNKVITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSSHKNERR 96

Query: 72  VL---TPILARY-------LYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121
           VL   T ++  +       +YPR L  I   +L+    D       + S IN   LALID
Sbjct: 97  VLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQQ---DGGI----MGSLINGITLALID 149

Query: 122 SGIGLQSSFASVCLSVNGPNNEICINPASDQLI---------RSTSSHLLALEMGPGSKK 172
           +GI +    + V + +      + +N   +  +         +S    LL +E      +
Sbjct: 150 AGIAMYDYISGVSIGLYDTTPLLDVNSLEENAMSSVTLGVVGKSEKLSLLLVEDKIPLDR 209

Query: 173 TQKVLLIESHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISN 218
            + VL I   GA   + L+D             +ELR   E++++N
Sbjct: 210 LETVLAIGIAGAHRVRDLMD-------------EELRKHAEKRVAN 242

>Sklu_1267.2 YGR195W, Contig c1267 529-1350
          Length = 273

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 58/139 (41%), Gaps = 18/139 (12%)

Query: 10  DQVDGSCKIQCGETSVLCSVTGPIEPKAR-QELPSQLALEIVVRPCKGVPNTREKLLEDQ 68
           +  DGS  ++ G   ++  V GP EP  R Q  PS   + + V   K     R K     
Sbjct: 61  NAADGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKN 120

Query: 69  IRGVL---TPILARY-------LYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLA 118
            R VL   T ++  +       LYPR L  I   +L+    D       + + IN   LA
Sbjct: 121 ERRVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQ---DGGI----MGALINGITLA 173

Query: 119 LIDSGIGLQSSFASVCLSV 137
           LID+GI +    + V + +
Sbjct: 174 LIDAGIAMYDYISGVSIGL 192

>Kwal_33.15453
          Length = 245

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 30/221 (13%)

Query: 13  DGSCKIQCGETSVLCSVTGPIEPKARQELP-SQLALEIVVRPCKGVPNTREKLLEDQIRG 71
           DGS  ++ G   ++  V GP EPK R ++  +Q  L + V   +     R K      R 
Sbjct: 37  DGSSYLEQGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERR 96

Query: 72  VL--TPILAR--------YLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121
           VL     L R        +LYPR    I   +L+    D       + S IN   LALID
Sbjct: 97  VLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQQ---DGGL----MGSLINGITLALID 149

Query: 122 SGIGLQSSFASVCLSVNGPNNEICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLIES 181
           +GI +    + V + +      + +N   +  + S +  ++         K++K+ L+  
Sbjct: 150 AGIAMYDYISGVSIGLYDTTPLLDLNSVEENAMSSVTLGVVG--------KSEKLSLLLV 201

Query: 182 HGAFTEQQLLDVLSKGEEACLQVA----QELRSAVERKISN 218
                  +L  VL+ G     ++     QELR   E++++N
Sbjct: 202 EDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRLAN 242

>CAGL0G09317g complement(890158..890898) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3-5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA, start by similarity
          Length = 246

 Score = 45.8 bits (107), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 95/221 (42%), Gaps = 30/221 (13%)

Query: 13  DGSCKIQCGETSVLCSVTGPIEPKARQELPSQLA-LEIVVRPCKGVPNTREKLLEDQIRG 71
           DGS  ++ G   V+  V GP EP  + ++  Q A L++ V   K     R K      R 
Sbjct: 37  DGSSYLEQGNNKVITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERR 96

Query: 72  VL--TPILAR--------YLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121
           VL     L R        ++YPR L  I   +L+    D       + + +N   LALID
Sbjct: 97  VLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQQ---DGGI----MGTLLNGISLALID 149

Query: 122 SGIGLQSSFASVCLSVNGPNNEICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLIES 181
           +GI +    + + + +      + IN   +  + + +  ++         K++K+ L++ 
Sbjct: 150 AGIAMYDYVSGISVGLYDTTPLLDINSLEENAMSAVTLGVVG--------KSEKLSLLQI 201

Query: 182 HGAFTEQQLLDVLSKGEEACLQVA----QELRSAVERKISN 218
                  ++ +VL+ G     ++     QE+R+  E++++N
Sbjct: 202 EDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRVAN 242

>YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the
           exosome 3'-5' exoribonuclease complex involved in 3'
           processing of ribosomal 5.8S rRNA, of snoRNAs and of U4
           snRNA, and in degradation of poly(A)- mRNAs, confers
           antiviral activity by repressing replication of
           double-stranded RNA viruses [741 bp, 246 aa]
          Length = 246

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 92/226 (40%), Gaps = 40/226 (17%)

Query: 13  DGSCKIQCGETSVLCSVTGPIEPKARQELPSQLA-LEIVVRPCKGVPNTREKLLEDQIRG 71
           DGS  ++ G   ++  V GP EP+ + ++ +  A L + V   K     R K      R 
Sbjct: 37  DGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERR 96

Query: 72  VL---TPILARY-------LYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121
           VL   T ++  +       +YPR +  I   +LE    D       + S IN   LALID
Sbjct: 97  VLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLEQ---DGGI----MGSLINGITLALID 149

Query: 122 SGIGLQSSFA--SVCLSVNGP---NNEICINPASDQLI----RSTSSHLLALEMGPGSKK 172
           +GI +    +  SV L    P    N +  N  S   +    +S    LL +E      +
Sbjct: 150 AGISMFDYISGISVGLYDTTPLLDTNSLEENAMSTVTLGVVGKSEKLSLLLVEDKIPLDR 209

Query: 173 TQKVLLIESHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISN 218
            + VL I   GA   + L+D             +ELR   ++++SN
Sbjct: 210 LENVLAIGIAGAHRVRDLMD-------------EELRKHAQKRVSN 242

>KLLA0D09625g complement(813773..814510) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3 -5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA singleton, start by similarity
          Length = 245

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 57/139 (41%), Gaps = 18/139 (12%)

Query: 10  DQVDGSCKIQCGETSVLCSVTGPIEPKARQELPS-QLALEIVVRPCKGVPNTREK----- 63
           +  DGS  ++ G   ++  V GP EP +R ++ + Q  L + +   K     R K     
Sbjct: 34  NAADGSSYLEQGNNKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKN 93

Query: 64  ---LLEDQIRGVLT--PILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLA 118
               LE Q   V T    L  +LYPR    +    L+            L + +N   LA
Sbjct: 94  ERRTLEWQASLVRTFEKNLMLHLYPRTSIDVQVHALQ-------LDGGILGAMLNGITLA 146

Query: 119 LIDSGIGLQSSFASVCLSV 137
           LID+GI +    + V + +
Sbjct: 147 LIDAGIAMYDFVSGVSVGL 165

>Scas_621.17
          Length = 239

 Score = 33.9 bits (76), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 55/125 (44%), Gaps = 7/125 (5%)

Query: 2   LEAQTGVLDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRP--CKGVPN 59
           L  ++GV++  +GS  I+  + S+L SV GP     R    SQ  + I ++    +    
Sbjct: 46  LTIKSGVVENCNGSTLIESSKFSLLTSVYGP--KSIRGSFTSQGTITIQLKNGVVENYQT 103

Query: 60  TREKLLEDQIRGVLTPILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLAL 119
           T  K +   + G+   ++    YP+    I   ++   + D S   K +   I    LAL
Sbjct: 104 TELKEVSSWLVGIFNSVVNLENYPKSGIDIFVNLIIDKQGDIS---KLIPFLIMGICLAL 160

Query: 120 IDSGI 124
           +D GI
Sbjct: 161 VDGGI 165

>AFR494W [3686] [Homologous to ScYLR318W (EST2) - SH]
           complement(1326584..1329145) [2562 bp, 853 aa]
          Length = 853

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%)

Query: 47  LEIVVRPCKGVPNTREKLLEDQIRGVLTPILARYLYPRQLCQICFQILES 96
             ++  PCKG+    ++  ED +R V+ P+     Y R    + FQ L S
Sbjct: 421 FRVLAIPCKGIDEEDKREYEDYVRTVIKPVQQILEYLRMRRAVRFQRLYS 470

>KLLA0F18304g complement(1689187..1689897) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport singleton, start by similarity
          Length = 236

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 21/126 (16%)

Query: 9   LDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGVPNTREKLLEDQ 68
           L+ +DG+      +  V+ SV GP  P  R    S+ ++ I  +       T E L   +
Sbjct: 61  LEYMDGTSD----QVLVMSSVFGP-RP-LRGSFQSKASVSIQFKEV-----TLEHLNTGE 109

Query: 69  IR-------GVLTPILARYLYPRQLCQICFQILE---SGEPDESYSVKELNSCINAAYLA 118
           I+        V   ++    YP+    I   +++   S   +E+  V  L +CIN+  +A
Sbjct: 110 IKEICTFLTNVFNAVINVEKYPKSGIDIFIDLIQHSNSNPTEEANIVNILPTCINSITMA 169

Query: 119 LIDSGI 124
           L+D+GI
Sbjct: 170 LVDAGI 175

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..834552)
            [6723 bp, 2240 aa]
          Length = 2240

 Score = 29.3 bits (64), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 178  LIESHGAFTEQQLLDV--LSKGE-EACLQVAQELRSAVERK 215
            L+ +H  F  + +L V    + +  A   VAQELR+AVER+
Sbjct: 1927 LVRAHNPFRGRNILSVNQFKRSDFHALFAVAQELRAAVERE 1967

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 10/83 (12%)

Query: 136  SVNGPNNEICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLIESHGAFTEQQLLDV-- 193
            S++G  + +   P   +L+ S     LA    PG+       LI S   F  + +L V  
Sbjct: 1872 SMDGEEDALVDQPLEQRLMSSRPPKELA---APGAIYN----LIRSKNPFLNRNILSVKQ 1924

Query: 194  LSKGE-EACLQVAQELRSAVERK 215
              + +  A   VAQELR+AVER+
Sbjct: 1925 FKRSDFHALFAVAQELRAAVERE 1947

>YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein
           involved in mRNA transport, component of the exosome
           complex responsible for 3'-5' degradation of mRNA and
           for 3'-end processing of multiple small RNA species [753
           bp, 250 aa]
          Length = 250

 Score = 28.1 bits (61), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 62/146 (42%), Gaps = 25/146 (17%)

Query: 2   LEAQTGVLDQVDGSCKIQC----GETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGV 57
           L   TG ++  +GS  ++      +TS++ +V GP     R    SQ  + I ++   G+
Sbjct: 46  LSLHTGFIENCNGSALVEARSLGHQTSLITAVYGP--RSIRGSFTSQGTISIQLK--NGL 101

Query: 58  ---PNTRE-KLLEDQIRGVLTPILARYLYPRQLCQICFQI-----LESGEPDESYSVKEL 108
               NT E K +   + G+   ++    YP+    I   +     L +   D+    K +
Sbjct: 102 LEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMM 161

Query: 109 NS--------CINAAYLALIDSGIGL 126
           +S        CI +  LAL D+GI L
Sbjct: 162 SSQISSLIPHCITSITLALADAGIEL 187

>YHR155W (YHR155W) [2442] chr8 (407104..410790) Protein containing a
           pleckstrin homology (PH) domain, which mediate
           protein-protein and protein-lipid interactions, has
           moderate similarity to S. cerevisiae Sip3p, which
           interacts with S. cerevisiae Snf1p [3687 bp, 1228 aa]
          Length = 1228

 Score = 28.1 bits (61), Expect = 7.2,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 151 DQLIRSTSSHLLALEMGPGSKKTQKVLLIESHGAFTEQQLLDV-----LSKGEEACLQVA 205
           D+  +  SS +L ++ G G +    V   +     ++ Q L       + KGE+  L++ 
Sbjct: 654 DKSPKHVSSRMLHMQRGDGLRFNMSVFFTDRRAVASKLQFLIENKAMHIPKGEKEVLEIF 713

Query: 206 QELRSAV--ERKISND 219
           QEL   +  E+KI  D
Sbjct: 714 QELDEEIENEKKIIKD 729

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,681,174
Number of extensions: 260494
Number of successful extensions: 732
Number of sequences better than 10.0: 23
Number of HSP's gapped: 718
Number of HSP's successfully gapped: 23
Length of query: 222
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 124
Effective length of database: 13,203,545
Effective search space: 1637239580
Effective search space used: 1637239580
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)