Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.396530730315150.0
AAR036W3173016701e-86
Scas_716.293163006571e-84
KLLA0D15015g3173006343e-81
YGR096W (TPC1)3143045986e-76
CAGL0G03135g3073055612e-70
Sklu_2363.23233052537e-25
CAGL0J01661g3273212511e-24
YPR011C3263252475e-24
Kwal_14.22103153022396e-23
AGL047C3163132212e-20
Kwal_55.208683802982127e-19
Scas_578.3*5243212137e-19
YKR052C (MRS4)3043081948e-17
ADL009W3792991951e-16
Sklu_2037.23103121912e-16
Kwal_23.47313143161912e-16
CAGL0J05522g5193231862e-15
YOR130C (ORT1)2923161814e-15
YJL133W (MRS3)3143081791e-14
Scas_717.203563451782e-14
YNL083W5453231783e-14
Kwal_23.30425423241774e-14
CAGL0K11616g3203251736e-14
Kwal_55.213353172951736e-14
KLLA0C11363g5173241756e-14
Scas_379.23013131736e-14
YEL006W3353191721e-13
YIL006W3733021702e-13
Scas_721.1293233171692e-13
YIL134W (FLX1)3113271683e-13
CAGL0J02002g3612981684e-13
YJR095W (SFC1)3223011674e-13
Kwal_23.29133201541666e-13
Sklu_2334.23192991666e-13
Sklu_2374.75133261677e-13
AGL064W296851648e-13
AGL311C3623201659e-13
CAGL0K02915g3423281659e-13
KLLA0F04697g3073131631e-12
Kwal_33.154463051621631e-12
Sklu_2127.52782921612e-12
CAGL0G08910g2893001612e-12
Kwal_26.76533253221612e-12
KLLA0B12826g3193231603e-12
Scas_691.43343111603e-12
Sklu_2075.33451721604e-12
YHR002W (LEU5)3573281604e-12
KLLA0D04290g1881711544e-12
YOR222W (ODC2)3073131594e-12
Kwal_33.140503143161585e-12
CAGL0K10362g3013111585e-12
Sklu_2430.103243241577e-12
Kwal_26.86692963041577e-12
AGR383W2933171568e-12
YBR085W (AAC3)3073111569e-12
YBL030C (PET9)3183041561e-11
Scas_697.473281601551e-11
YKL120W (OAC1)3243141552e-11
Scas_718.243373061552e-11
Scas_632.92923081532e-11
Scas_709.93652981542e-11
YOR100C (CRC1)3271681542e-11
CAGL0K08250g2972951532e-11
YMR056C (AAC1)3093081514e-11
KLLA0E08877g2943051505e-11
Kwal_47.182163333371515e-11
Scas_640.253063091506e-11
AER184W3053021481e-10
AER419W4933121501e-10
YMR166C3682941491e-10
KLLA0E02772g2842621471e-10
CAGL0K02365g9193081501e-10
Scas_562.123001591481e-10
AEL253W3653091481e-10
AGL065C3353371481e-10
Kwal_47.173218813071482e-10
Scas_721.273743161463e-10
CAGL0F04213g3063071453e-10
Kwal_27.124813042981443e-10
CAGL0K12210g3111711444e-10
Sklu_2431.53703121454e-10
CAGL0D01606g3051611434e-10
Sklu_1149.22963121435e-10
YPR021C (AGC1)9021751455e-10
YLR348C (DIC1)2982261435e-10
Scas_667.43083041426e-10
KLLA0D07073g2972981426e-10
Scas_589.103162401427e-10
CAGL0L02079g2973111418e-10
Kwal_27.114192983131419e-10
KLLA0E09680g3071571401e-09
Sklu_2432.52882831401e-09
CAGL0L05742g3053191401e-09
YGR257C (MTM1)3662771401e-09
KLLA0E23705g3683111402e-09
KLLA0E13453g9061771412e-09
KLLA0F03212g3053141392e-09
YDL198C (YHM1)3001711382e-09
Kwal_26.79723581471382e-09
CAGL0M09020g3481681383e-09
Kwal_26.7967297951373e-09
Sklu_2359.69021641393e-09
ACR109W2993021364e-09
Kwal_27.120813693121374e-09
ACR260W3113151364e-09
CAGL0J09790g3001591364e-09
KLLA0E12353g3053001354e-09
KLLA0E18810g377951364e-09
ADL049W9123111376e-09
KLLA0D14036g4313291349e-09
Scas_702.103022801339e-09
Scas_645.93911821341e-08
YBR104W (YMC2)3291721321e-08
KLLA0C13431g3281731312e-08
Sklu_2117.22981591302e-08
Kwal_27.116262991591302e-08
Scas_489.4297951302e-08
CAGL0B03883g3061731302e-08
ADL264C3292411302e-08
KLLA0E18788g3811361303e-08
KLLA0E15532g3263251293e-08
CAGL0C02013g3291911293e-08
YBR291C (CTP1)2993201293e-08
AFR146W2813141283e-08
CAGL0J04114g3031651283e-08
Sklu_2398.43091641284e-08
Scas_582.73293041276e-08
Sklu_1926.23051771266e-08
Scas_715.453051491266e-08
KLLA0F13464g3001591267e-08
AGR191W2981591267e-08
Sklu_2115.42993061259e-08
Scas_718.53241601241e-07
CAGL0B04543g3172421222e-07
AFR131C3442661223e-07
KLLA0D04312g1031061133e-07
Kwal_47.192282811141204e-07
Scas_669.63731351205e-07
YPL134C (ODC1)3101541196e-07
AFL196W3611781197e-07
Scas_602.88853091207e-07
Sklu_2260.53021481188e-07
CAGL0H10538g2973111171e-06
Kwal_33.155973051551161e-06
Scas_558.22891681161e-06
YER053C3001601161e-06
Scas_667.223061611152e-06
CAGL0F08305g3742671152e-06
CAGL0M05225g3813171152e-06
CAGL0G01166g2952861142e-06
Sklu_2127.43232691142e-06
YBR192W (RIM2)3773191142e-06
Scas_662.123083151143e-06
YNL003C (PET8)2841531133e-06
AAL014C2711641123e-06
Scas_714.183053291124e-06
Kwal_23.43543433541125e-06
Sklu_1119.13071541115e-06
AER450C3081531116e-06
Kwal_33.129883031491107e-06
Kwal_56.230113031661108e-06
KLLA0F17864g3071651108e-06
Sklu_1275.13111731108e-06
YJR077C (MIR1)3112221099e-06
Kwal_27.125993041611091e-05
CAGL0F00231g3072261091e-05
Scas_687.15*3282081091e-05
Kwal_23.57573071491091e-05
CAGL0H03839g2821981081e-05
AFR253W344861081e-05
YPR058W (YMC1)3071631072e-05
Kwal_0.2322742901072e-05
Kwal_55.213383232661072e-05
KLLA0B14454g3051401062e-05
CAGL0D04774g3221671036e-05
KLLA0A09383g3661901028e-05
CAGL0F07711g3682451028e-05
KLLA0A00979g3431151028e-05
Scas_328.12271191001e-04
Scas_673.173141611011e-04
KLLA0B08503g3031671001e-04
Sklu_2433.84201101011e-04
AER366W293314992e-04
KLLA0D04950g274196973e-04
Sklu_2442.8275193964e-04
AFR147C315163964e-04
YFR045W285187964e-04
Scas_613.24177162935e-04
Scas_705.932374930.001
YPR128C (ANT1)32880910.002
Sklu_2435.234488910.002
Kwal_23.3529395173900.003
Kwal_55.2110632887870.006
YDL119C30755860.007
KLLA0D09889g364182860.009
KLLA0B11319g35564800.048
ABL023W309105790.060
ADR036C340195790.065
Scas_671.1*123101710.23
CAGL0K06545g51287710.72
KLLA0E02750g304193700.75
Kwal_26.7264819118681.4
KLLA0E22880g43663662.3
AFR542W31082653.1
YMR241W (YHM2)314165643.8
KLLA0D08734g30730627.0
ACL027C42057619.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3965
         (303 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3965                                                          588   0.0  
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....   262   1e-86
Scas_716.29                                                           257   1e-84
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...   248   3e-81
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...   234   6e-76
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...   220   2e-70
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                         102   7e-25
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...   101   1e-24
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...   100   5e-24
Kwal_14.2210                                                           97   6e-23
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    90   2e-20
Kwal_55.20868                                                          86   7e-19
Scas_578.3*                                                            87   7e-19
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    79   8e-17
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    80   1e-16
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         78   2e-16
Kwal_23.4731                                                           78   2e-16
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    76   2e-15
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    74   4e-15
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    74   1e-14
Scas_717.20                                                            73   2e-14
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    73   3e-14
Kwal_23.3042                                                           73   4e-14
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    71   6e-14
Kwal_55.21335                                                          71   6e-14
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    72   6e-14
Scas_379.2                                                             71   6e-14
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    71   1e-13
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    70   2e-13
Scas_721.129                                                           70   2e-13
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    69   3e-13
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    69   4e-13
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    69   4e-13
Kwal_23.2913                                                           69   6e-13
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         69   6e-13
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       69   7e-13
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    68   8e-13
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    68   9e-13
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    68   9e-13
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    67   1e-12
Kwal_33.15446                                                          67   1e-12
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         67   2e-12
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    67   2e-12
Kwal_26.7653                                                           67   2e-12
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    66   3e-12
Scas_691.4                                                             66   3e-12
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                66   4e-12
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    66   4e-12
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    64   4e-12
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    66   4e-12
Kwal_33.14050                                                          65   5e-12
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    65   5e-12
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         65   7e-12
Kwal_26.8669                                                           65   7e-12
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    65   8e-12
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    65   9e-12
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    65   1e-11
Scas_697.47                                                            64   1e-11
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    64   2e-11
Scas_718.24                                                            64   2e-11
Scas_632.9                                                             64   2e-11
Scas_709.9                                                             64   2e-11
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    64   2e-11
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    64   2e-11
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    63   4e-11
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    62   5e-11
Kwal_47.18216                                                          63   5e-11
Scas_640.25                                                            62   6e-11
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    62   1e-10
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    62   1e-10
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    62   1e-10
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    61   1e-10
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    62   1e-10
Scas_562.12                                                            62   1e-10
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    62   1e-10
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    62   1e-10
Kwal_47.17321                                                          62   2e-10
Scas_721.27                                                            61   3e-10
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    60   3e-10
Kwal_27.12481                                                          60   3e-10
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    60   4e-10
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            60   4e-10
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    60   4e-10
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         60   5e-10
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    60   5e-10
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    60   5e-10
Scas_667.4                                                             59   6e-10
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    59   6e-10
Scas_589.10                                                            59   7e-10
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    59   8e-10
Kwal_27.11419                                                          59   9e-10
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    59   1e-09
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       59   1e-09
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    59   1e-09
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    59   1e-09
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    59   2e-09
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    59   2e-09
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    58   2e-09
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    58   2e-09
Kwal_26.7972                                                           58   2e-09
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    58   3e-09
Kwal_26.7967                                                           57   3e-09
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          58   3e-09
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    57   4e-09
Kwal_27.12081                                                          57   4e-09
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    57   4e-09
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    57   4e-09
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    57   4e-09
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    57   4e-09
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    57   6e-09
KLLA0D14036g complement(1203522..1204817) some similarities with...    56   9e-09
Scas_702.10                                                            56   9e-09
Scas_645.9                                                             56   1e-08
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    55   1e-08
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    55   2e-08
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            55   2e-08
Kwal_27.11626                                                          55   2e-08
Scas_489.4                                                             55   2e-08
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    55   2e-08
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    55   2e-08
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    55   3e-08
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    54   3e-08
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    54   3e-08
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    54   3e-08
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    54   3e-08
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    54   3e-08
Sklu_2398.4 , Contig c2398 9476-10405                                  54   4e-08
Scas_582.7                                                             54   6e-08
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          53   6e-08
Scas_715.45                                                            53   6e-08
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    53   7e-08
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    53   7e-08
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            53   9e-08
Scas_718.5                                                             52   1e-07
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    52   2e-07
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    52   3e-07
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    48   3e-07
Kwal_47.19228                                                          51   4e-07
Scas_669.6                                                             51   5e-07
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    50   6e-07
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    50   7e-07
Scas_602.8                                                             51   7e-07
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         50   8e-07
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    50   1e-06
Kwal_33.15597                                                          49   1e-06
Scas_558.2                                                             49   1e-06
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    49   1e-06
Scas_667.22                                                            49   2e-06
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    49   2e-06
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    49   2e-06
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    49   2e-06
Sklu_2127.4 , Contig c2127 6322-7293                                   49   2e-06
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    49   2e-06
Scas_662.12                                                            49   3e-06
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    48   3e-06
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    48   3e-06
Scas_714.18                                                            48   4e-06
Kwal_23.4354                                                           48   5e-06
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             47   5e-06
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    47   6e-06
Kwal_33.12988                                                          47   7e-06
Kwal_56.23011                                                          47   8e-06
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    47   8e-06
Sklu_1275.1 , Contig c1275 314-1249                                    47   8e-06
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    47   9e-06
Kwal_27.12599                                                          47   1e-05
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    47   1e-05
Scas_687.15*                                                           47   1e-05
Kwal_23.5757                                                           47   1e-05
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    46   1e-05
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    46   1e-05
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    46   2e-05
Kwal_0.232                                                             46   2e-05
Kwal_55.21338                                                          46   2e-05
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    45   2e-05
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    44   6e-05
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    44   8e-05
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    44   8e-05
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    44   8e-05
Scas_328.1                                                             43   1e-04
Scas_673.17                                                            44   1e-04
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    43   1e-04
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       44   1e-04
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    43   2e-04
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    42   3e-04
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          42   4e-04
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    42   4e-04
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    42   4e-04
Scas_613.24                                                            40   5e-04
Scas_705.9                                                             40   0.001
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    40   0.002
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         40   0.002
Kwal_23.3529                                                           39   0.003
Kwal_55.21106                                                          38   0.006
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    38   0.007
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    38   0.009
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    35   0.048
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    35   0.060
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    35   0.065
Scas_671.1*                                                            32   0.23 
CAGL0K06545g complement(641129..642667) similar to tr|Q03327 Sac...    32   0.72 
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    32   0.75 
Kwal_26.7264                                                           31   1.4  
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    30   2.3  
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    30   3.1  
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    29   3.8  
KLLA0D08734g complement(742009..742932) weakly similar to sgd|S0...    28   7.0  
ACL027C [1022] [Homologous to ScYIL071C (PCI8) - SH] (316464..31...    28   9.1  

>Kwal_23.3965
          Length = 307

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/303 (94%), Positives = 285/303 (94%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFK 60
           MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFK
Sbjct: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFK 60

Query: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGT 120
           RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGT
Sbjct: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGT 120

Query: 121 CSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXX 180
           CSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG              
Sbjct: 121 CSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSS 180

Query: 181 XXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQL 240
               YESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQL
Sbjct: 181 ILATYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQL 240

Query: 241 GHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           GHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE
Sbjct: 241 GHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300

Query: 301 WCL 303
           WCL
Sbjct: 301 WCL 303

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score =  262 bits (670), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 140/301 (46%), Positives = 190/301 (63%), Gaps = 9/301 (2%)

Query: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62
           EDHLRKG+ V    ++VAG +SG+ AR VTAP+DT+KIR QLQLA+E +Y GIL TF+ +
Sbjct: 13  EDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTV 72

Query: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCS 122
            R+EGVRALWKGNVPA AMY+LYGS QF +YA LN   + + LP Q H+  VGAL+G  S
Sbjct: 73  AREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVS 132

Query: 123 AIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXX 182
           ++ +YP D+LRTR +AN S    ++   A+ IW  EG  GFF+G                
Sbjct: 133 SLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIF 192

Query: 183 XXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGH 242
             YE+  I        D+  +  L ++AS  AG+VSK  VFP+DTVR+R Q++D + +  
Sbjct: 193 GIYETCTIAA------DTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHI-- 244

Query: 243 PGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
           P  T     AY +   T FL LA+ +V  EG+ +LY G T+ + KS P+TV++L VY+ C
Sbjct: 245 PFFTRDP-GAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRC 303

Query: 303 L 303
           L
Sbjct: 304 L 304

>Scas_716.29
          Length = 316

 Score =  257 bits (657), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 187/300 (62%), Gaps = 4/300 (1%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQY-GGILVTFKRL 62
           DHLRKG++V V QSLVAG +SG+ AR V APLDTLKIRLQL+ +   Q   G+L   K +
Sbjct: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM 71

Query: 63  VRQEG-VRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK-SQLPAQIHTGMVGALSGT 120
           +  EG +R+ WKGNVP   MY+LYG  QF+SY+  N L  + S +  Q+ + +VGAL+G 
Sbjct: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGM 131

Query: 121 CSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXX 180
            S+  SYP DVLRTRFIAN    LS++    +EIW  EG  GFF+G              
Sbjct: 132 TSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASI 191

Query: 181 XXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQL 240
               YES+KI+C++   ++S     L  SAS I+G+ SK + +P+DT+R+R QV +   +
Sbjct: 192 LFGTYESIKIYCDEY-SKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYV 250

Query: 241 GHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
            H        + Y+SY   +F+R+ L I+ +EGLL+LY G ++ + K+VPSTVVSL  YE
Sbjct: 251 QHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score =  248 bits (634), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 187/300 (62%), Gaps = 7/300 (2%)

Query: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62
           +DHLRKG+ V  + S++AG +SG+ AR+ TAP+DT+KIR QLQ   E +Y GI  T + +
Sbjct: 7   KDHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTI 66

Query: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS--QLPAQIHTGMVGALSGT 120
           +++EG+RALWKGN+PA AMY++YG+ QF SY+  N + S    +   Q  T  VGAL+G 
Sbjct: 67  MKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGALAGM 126

Query: 121 CSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXX 180
            S++ SYP D+LRTR IAN +   +++    +++W +EG RGFF G              
Sbjct: 127 TSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAI 186

Query: 181 XXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQL 240
               YE+V I CE       S  + + +S+ +IAG VSKT+VFPIDT+R+R QV++ ++ 
Sbjct: 187 MFLTYETVNIVCENHEKEFWS--RPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRT 244

Query: 241 GHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
            H       Y  Y+  +ST  +     I+ +EG+ ALY G T+G+ KSVP+T +SL VYE
Sbjct: 245 VHFTKFPAVYHEYRYKSSTAII---YKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYE 301

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 16/92 (17%)

Query: 210 ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIV 269
           A  ++G+ ++    P+DTV+ RYQ+        P   +K    YK   ST        I+
Sbjct: 24  AGSVSGVFARMATAPMDTVKIRYQL-------QPVQEDK----YKGIAST-----VRTIM 67

Query: 270 EKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
           ++EGL AL+ G     A  V    V  G Y W
Sbjct: 68  KEEGLRALWKGNIPATAMYVVYGAVQFGSYSW 99

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score =  234 bits (598), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 114/304 (37%), Positives = 186/304 (61%), Gaps = 9/304 (2%)

Query: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGG--ILVTFK 60
           ED LRKGQ V  +++L+AG +SG+ AR +TAP+DT+KIRLQL  AN  +  G  ++   +
Sbjct: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR 64

Query: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGT 120
            +++ EG+R+ WKGN+P   +Y+ YGS QF+SY++ N+ L+   L A++H+ +VGA +G 
Sbjct: 65  SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGI 124

Query: 121 CSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXX 180
            S+I SYP DVLRTR +AN+     ++    ++IW+ EG  GFFKG              
Sbjct: 125 TSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASI 184

Query: 181 XXXXYESVKIFCEQRPDRDSS----VIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVID 236
               YE+++I+C++     ++     +  L  SA  I G+++K I FP++T+R+R Q ++
Sbjct: 185 MFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMN 244

Query: 237 WQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSL 296
            + L      +  Y +YK Y    F R+ L I+++EG+ +LY G  + ++K++P+T VS 
Sbjct: 245 SKHLEKFSRHSSVYGSYKGY---GFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301

Query: 297 GVYE 300
             YE
Sbjct: 302 WGYE 305

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score =  220 bits (561), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 127/305 (41%), Positives = 172/305 (56%), Gaps = 15/305 (4%)

Query: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62
           +DHLRK +EV    SLVAG LSG+ AR   APLDT+KI+LQ+   N+     +L+    +
Sbjct: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN--ANVLIN---I 58

Query: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS---QLPAQIHTGMVGALSG 119
           +++EG+R  WKGNVP   MYI+YG  QF SY  +   L       +  Q+++ +VG+L+G
Sbjct: 59  LKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAG 118

Query: 120 TCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXX 179
             S++ASYP DVLRTRF AN   +L  +      IW HEG  GFF G             
Sbjct: 119 MTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTA 178

Query: 180 XXXXXYESVKIFCEQR---PDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVID 236
                YES+KIF E+R    DR      LL   A  I+G  SK   FP+DTVR+R Q+ +
Sbjct: 179 IMFGVYESIKIFTEERSKLSDRRDP-FTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN 237

Query: 237 WQQLGHPGHTNKAYKA-YKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVS 295
                   H  +  K  YKSY +  FL + + +V++EG L+LY G T+ + KSVPST +S
Sbjct: 238 SPN--EERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAIS 295

Query: 296 LGVYE 300
           L  YE
Sbjct: 296 LWSYE 300

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score =  102 bits (253), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 136/305 (44%), Gaps = 36/305 (11%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76
           + +AG L+G  +R V +P + +KI LQ+Q +  A   GI+   +++ R+EG   L++GN 
Sbjct: 25  AFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNG 84

Query: 77  PAMAMYILYGSTQFTSYAILNKLL-----SKSQLPAQIHTGMV-GALSGTCSAIASYPCD 130
                   Y + QF  Y    K       SK +   Q    +  GAL G CS +A+YP D
Sbjct: 85  LNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLD 144

Query: 131 VLRTRF------IANHSRELSTMLSTAQEIW--------RHEGFRGFFKGXXXXXXXXXX 176
           ++RTR       +   S+  +  +S    +W           G +G ++G          
Sbjct: 145 LVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVP 204

Query: 177 XXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVID 236
                   YE  K F  +    D+++    + S   ++G V++T+ +P D +R+R+QV+ 
Sbjct: 205 YVALNFAVYEQFKEFMPE--GTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLA 262

Query: 237 WQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEK-EGLLALYHGYTLGIAKSVPSTVVS 295
                  G     ++ YKS         AL+ + K EG    Y G T  + K +PST VS
Sbjct: 263 M------GGNELGFR-YKSVMD------ALITIGKTEGFRGYYKGLTANLFKVIPSTAVS 309

Query: 296 LGVYE 300
             VYE
Sbjct: 310 WLVYE 314

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQL--ANEA--QYGGILVTFKRLVRQEGVRA 70
           F  L  G LSG  A+ VT P D L+ R Q+     NE   +Y  ++     + + EG R 
Sbjct: 231 FYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG 290

Query: 71  LWKG 74
            +KG
Sbjct: 291 YYKG 294

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 42/105 (40%), Gaps = 20/105 (19%)

Query: 198 RDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYT 257
            DS+V  L    A  +AG VS+T+V P + V+   QV +     + G      + Y+   
Sbjct: 20  NDSNVAFL----AGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYR--- 72

Query: 258 STNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
                        +EG   L+ G  L   +  P + V   VYE C
Sbjct: 73  -------------EEGTPGLFRGNGLNCIRIFPYSAVQFVVYEAC 104

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score =  101 bits (251), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 141/321 (43%), Gaps = 37/321 (11%)

Query: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62
           E+ L+   +     + +AG ++G  +R V +P + +KI LQ+Q +  A   G+     ++
Sbjct: 12  ENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQV 71

Query: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL------SKSQLPAQIHTGMVGA 116
            ++E ++ L++GN         Y + QF  +    K +       K +          GA
Sbjct: 72  YKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGA 131

Query: 117 LSGTCSAIASYPCDVLRTRF------IANHSRELSTMLSTAQEIWR--------HEGFRG 162
           L G CS +A+YP D++RTR       ++  S+  ++ ++    +W+          G  G
Sbjct: 132 LCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMG 191

Query: 163 FFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSV-IQLLESSASVIAGIVSKTI 221
            ++G                  YE +K F     + +SS+   L + S   I+G V++TI
Sbjct: 192 LYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTI 251

Query: 222 VFPIDTVRKRYQVI--DWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYH 279
            +P D +R+R+QV+     +LG   H N  + A             + I + EG    Y 
Sbjct: 252 TYPFDLLRRRFQVLAMGGNELGF--HYNSVWDAL------------VTIGKTEGFKGYYK 297

Query: 280 GYTLGIAKSVPSTVVSLGVYE 300
           G T  + K VPST VS  VYE
Sbjct: 298 GLTANLFKVVPSTAVSWLVYE 318

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 99.8 bits (247), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 83/325 (25%), Positives = 144/325 (44%), Gaps = 49/325 (15%)

Query: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62
           +D L++   +    + +AG ++G  +R V +P + +KI LQ+Q +  +   GI  + +++
Sbjct: 15  KDFLKQDSNI----AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQV 70

Query: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL-------SKSQLPAQIHTGMVG 115
             +EG + L++GN         Y + QF  Y    K L        + QL         G
Sbjct: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL-TNTQRLFSG 129

Query: 116 ALSGTCSAIASYPCDVLRTRF------IANHSRELSTMLSTAQEIWR--------HEGFR 161
           AL G CS +A+YP D+++TR       +++ +R  +  +S    IW+          G R
Sbjct: 130 ALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLR 189

Query: 162 GFFKGXXXXXXXXXXXXXXXXXXYESVKIF----CEQRPDRDSSVIQLLESSASVIAGIV 217
           G ++G                  YE ++ F     + +P   S++ +L   +   I+G V
Sbjct: 190 GLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKL---TIGAISGGV 246

Query: 218 SKTIVFPIDTVRKRYQVI--DWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLL 275
           ++TI +P D +R+R+QV+     +LG              +  T+     + I   EG+ 
Sbjct: 247 AQTITYPFDLLRRRFQVLAMGGNELG--------------FRYTSVWDALVTIGRAEGVS 292

Query: 276 ALYHGYTLGIAKSVPSTVVSLGVYE 300
             Y G    + K VPST VS  VYE
Sbjct: 293 GYYKGLAANLFKVVPSTAVSWLVYE 317

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 48/117 (41%), Gaps = 24/117 (20%)

Query: 186 ESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGH 245
            S+K F +Q    DS++  L    A  +AG VS+T+V P + V+   QV           
Sbjct: 12  NSIKDFLKQ----DSNIAFL----AGGVAGAVSRTVVSPFERVKILLQV----------- 52

Query: 246 TNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
                 +  SY    F  +   +  +EG   L+ G  L   +  P + V   VYE C
Sbjct: 53  ----QSSTTSYNRGIFSSIR-QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEAC 104

>Kwal_14.2210
          Length = 315

 Score = 96.7 bits (239), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 86/302 (28%), Positives = 130/302 (43%), Gaps = 33/302 (10%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76
           +  AG ++G  +R V +P + +KI LQ+Q +  A   G+    K++  +EGV  L +GN 
Sbjct: 20  AFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNG 79

Query: 77  PAMAMYILYGSTQFTSYAILNKLLSKSQLPAQI----HTGMVGALSGTCSAIASYPCDVL 132
                   Y + QF  Y    K   + Q P  +    H  + GAL G CS +A+YP D++
Sbjct: 80  LNCIRIFPYSAVQFLVYEFCKKQWFQ-QNPDTVVLNWHRLVSGALCGGCSVLATYPLDLV 138

Query: 133 RTRF---IANHSR---ELSTMLSTAQEIW--------RHEGFRGFFKGXXXXXXXXXXXX 178
           RTR     AN +R     +   +    +W        +  G  G ++G            
Sbjct: 139 RTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYV 198

Query: 179 XXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQ 238
                 YE ++ +     D  S+   L + S   I+G V++TI +P D +R+R+QV+   
Sbjct: 199 ALNFAVYEQLREYIPASFDPASA--SLYKLSIGAISGGVAQTITYPFDLLRRRFQVLAMG 256

Query: 239 QLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGV 298
           Q     H       YKS          + I   EG    Y G T  + K VPST VS  V
Sbjct: 257 QSELGFH-------YKSVPDA-----LITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVV 304

Query: 299 YE 300
           YE
Sbjct: 305 YE 306

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 89/199 (44%), Gaps = 20/199 (10%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQY-----------GGILVTFKRLV 63
           +  LV+G L G  + + T PLD ++ RL +Q AN A+             G+    ++  
Sbjct: 115 WHRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTY 174

Query: 64  RQE-GVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLP--AQIHTGMVGALSGT 120
            QE G+  L++G  P     + Y +  F  Y  L + +  S  P  A ++   +GA+SG 
Sbjct: 175 TQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGG 234

Query: 121 CSAIASYPCDVLRTRF--IANHSRELSTMLSTAQE----IWRHEGFRGFFKGXXXXXXXX 174
            +   +YP D+LR RF  +A    EL     +  +    I R EGF+G++KG        
Sbjct: 235 VAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKV 294

Query: 175 XXXXXXXXXXYESVKIFCE 193
                     YE+V+ + +
Sbjct: 295 VPSTAVSWVVYETVRDYMQ 313

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 16/93 (17%)

Query: 210 ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIV 269
           A  IAG VS+T+V P + V+   QV   Q   H  + +  ++A K             + 
Sbjct: 23  AGGIAGAVSRTVVSPFERVKILLQV---QSSTH-AYNHGLFRAVKQ------------VY 66

Query: 270 EKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
            +EG+  L  G  L   +  P + V   VYE+C
Sbjct: 67  LEEGVPGLLRGNGLNCIRIFPYSAVQFLVYEFC 99

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/313 (25%), Positives = 138/313 (44%), Gaps = 49/313 (15%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG 74
           F + VAG + G  +R V +P++ +KI LQ+Q +  A  GG++   K++ ++EGV+ L++G
Sbjct: 17  FIAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRG 76

Query: 75  NVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVG-------------ALSGTC 121
           N         Y + Q+  Y        K+++    H G  G             AL G  
Sbjct: 77  NGINCLRIFPYSAVQYAVYE-----FCKTRV---FHVGQSGHEQLRSWERLVGGALGGGA 128

Query: 122 SAIASYPCDVLRTRFI-------------ANHSRELSTMLSTAQEIWRHE-GFRGFFKGX 167
           S + +YP D++RTR               A+  R    ++   + I+R E G RG+++G 
Sbjct: 129 SVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGV 188

Query: 168 XXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDT 227
                            YE +K       D D+  +   + +   ++G +++T+V+P D 
Sbjct: 189 YPTSLGVVPFVALNFALYERLKALIPH--DYDAGSVAAAKLAIGAVSGGIAQTVVYPFDL 246

Query: 228 VRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAK 287
           +R+R+QV+        G +   ++ Y S     +      I  +EGL   Y G T  + K
Sbjct: 247 LRRRFQVLTM------GQSELGFR-YASVADALW-----TIGRQEGLRGYYKGLTANLVK 294

Query: 288 SVPSTVVSLGVYE 300
            VP+  V   VYE
Sbjct: 295 VVPAMAVQWFVYE 307

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 16/93 (17%)

Query: 210 ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIV 269
           A  + G VS+T+V P++ V+   QV       + G  +   + YK               
Sbjct: 22  AGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYK--------------- 66

Query: 270 EKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
            +EG+  L+ G  +   +  P + V   VYE+C
Sbjct: 67  -EEGVKGLFRGNGINCLRIFPYSAVQYAVYEFC 98

>Kwal_55.20868
          Length = 380

 Score = 86.3 bits (212), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 134/298 (44%), Gaps = 26/298 (8%)

Query: 19  VAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQY-GGILVTFKRLVRQEGVRALWKGN 75
           ++G ++G  A +   PLD  K RLQ Q   +N + Y  GIL T   ++R EG R L+KG 
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGL 139

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALS-GTCSAIASYPCDVLRT 134
           VP +  Y       F+ Y    KL  +        +    AL+ GT S I + P  V++T
Sbjct: 140 VPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASALTAGTVSTILTNPVWVVKT 199

Query: 135 RF-----IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK 189
           R      +  +S   ++      +++  EG R F+ G                  YE +K
Sbjct: 200 RLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAG-LLPSLLGLFHVAIHFPIYEKLK 258

Query: 190 IFCEQRP------DRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHP 243
           ++    P      D + ++ +L+ +S++  + +V+ T+ +P + +R R Q+         
Sbjct: 259 VWLHCTPSMSRTEDHNLNLARLIIASSA--SKMVASTLTYPHEILRTRMQL--------K 308

Query: 244 GHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
            +      A +  +    +RL     + EGL   Y G+T  +A+++P++ ++L  +E+
Sbjct: 309 AYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEY 366

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 69/176 (39%), Gaps = 23/176 (13%)

Query: 111 TGMVGALSGTCSAIASYPCDVLRTRFIA-----NHSRELSTMLSTAQEIWRHEGFRGFFK 165
           T + GA++G  + +   P DV +TR  A     N S     +L T   I R EG RG +K
Sbjct: 78  TALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYK 137

Query: 166 GXXXXXXXXXXXXXXXXXXYE-SVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFP 224
           G                  YE S K++    P  D     +  S++++ AG VS  +  P
Sbjct: 138 GLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDF----ISHSASALTAGTVSTILTNP 193

Query: 225 IDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHG 280
           +  V+ R  +          H NK    Y S T   F ++       EGL   Y G
Sbjct: 194 VWVVKTRLML--------QTHVNKNSTHYTS-TFDAFHKM----YTTEGLRTFYAG 236

>Scas_578.3*
          Length = 524

 Score = 86.7 bits (213), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 140/321 (43%), Gaps = 49/321 (15%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKI-----------------RLQLQLANEAQY-GGIL 56
           F   +AG LSG+ +R  TAPLD +K+                  L++Q  N A+    I+
Sbjct: 209 FGYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPII 268

Query: 57  VTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKL---LSKSQLP---AQIH 110
              + L RQ G+RA + GN  ++       S +F ++ +  +L   LS  +L    +++ 
Sbjct: 269 KAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQ 328

Query: 111 TGMVGALSGTCSAIASYPCDVLRTRF----IANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           T + G ++G  + I+ YP D L+ R     +  + +  + ++STA+E+++  G R F++G
Sbjct: 329 TYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYRG 388

Query: 167 XXXXXXXXXXXXXXXXXXYESVKIFCEQR-------PDRDSSVIQLLESSASVIAGIVSK 219
                             + ++K +  +R       P++D  +  LL       +G V  
Sbjct: 389 VLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGA 448

Query: 220 TIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYH 279
           T V+PI+ +R R Q        HP            YT T F  + +  +++EG+   Y 
Sbjct: 449 TAVYPINLLRTRLQA--QGTYAHP------------YTYTGFRDVFMQTLKREGVPGFYK 494

Query: 280 GYTLGIAKSVPSTVVSLGVYE 300
           G    + K  P+  +    YE
Sbjct: 495 GLVPTLVKVCPAVSIGYLCYE 515

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 79.3 bits (194), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 126/308 (40%), Gaps = 36/308 (11%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLV 63
           D+       P+   L+AG  +GI    +  P+D LK R+Q    N+A   G++    ++ 
Sbjct: 13  DYEALPSHAPLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKIS 72

Query: 64  RQEGVRALWK-------GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGA 116
             EG  ALWK       G  PA A+Y  +G+ +F       +L+S   +  Q H  M  A
Sbjct: 73  TMEGSMALWKGVQSVILGAGPAHAVY--FGTYEFCK----ARLISPEDM--QTHQPMKTA 124

Query: 117 LSGTCSAIASYPCDVLRTRFIANHSR-ELSTML---STAQEIWRHEGFRGFFKGXXXXXX 172
           LSGT + IA+   D L   F     R +L T L   +  ++I+++EGF  F+        
Sbjct: 125 LSGTIATIAA---DALMNPFDTVKQRLQLDTNLRVWNVTKQIYQNEGFAAFYYSYPTTLA 181

Query: 173 XXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRY 232
                       YES   F     +  +S   L+      I+G     +  P+D ++   
Sbjct: 182 MNIPFAAFNFMIYESASKFF----NPQNSYNPLIHCLCGGISGATCAALTTPLDCIKTVL 237

Query: 233 QVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPST 292
           QV         G    + +  K   +  F R +  I+E  G    + G    I  ++P+T
Sbjct: 238 QV--------RGSETVSIEIMKD--ANTFGRASRAILEVHGWKGFWRGLKPRIVANIPAT 287

Query: 293 VVSLGVYE 300
            +S   YE
Sbjct: 288 AISWTAYE 295

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 40/93 (43%), Gaps = 16/93 (17%)

Query: 210 ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIV 269
           A   AGI+  +++FPID ++ R Q             NKA        ST  +     I 
Sbjct: 29  AGAFAGIMEHSLMFPIDALKTRVQA---------AGLNKA-------ASTGMISQISKIS 72

Query: 270 EKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
             EG +AL+ G    I  + P+  V  G YE+C
Sbjct: 73  TMEGSMALWKGVQSVILGAGPAHAVYFGTYEFC 105

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 9/98 (9%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILV---TFKRLVRQ---- 65
           P+   L  G +SG +   +T PLD +K  LQ++  +E     I+    TF R  R     
Sbjct: 209 PLIHCLCGG-ISGATCAALTTPLDCIKTVLQVR-GSETVSIEIMKDANTFGRASRAILEV 266

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS 103
            G +  W+G  P +   I   +  +T+Y      L K+
Sbjct: 267 HGWKGFWRGLKPRIVANIPATAISWTAYECAKHFLMKN 304

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 128/299 (42%), Gaps = 37/299 (12%)

Query: 19  VAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLVRQEGVRALWKGNV 76
           V+G L+G  + I+  PLD  K RLQ Q A   E  Y GI+ T   ++R EGV  L+KG  
Sbjct: 89  VSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLA 148

Query: 77  PAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALS-GTCSAIASYPCDVLRTR 135
           P +  Y       F+ Y    K    S LP    +    AL+ G  S   + P  V++TR
Sbjct: 149 PIVLGYFPTWMLYFSVYEKC-KQRYPSYLPGGFVSHAASALTAGAISTALTNPIWVVKTR 207

Query: 136 F-----IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKI 190
                 ++  S    + L   ++++R EG + F+ G                  YE +KI
Sbjct: 208 LMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSG-LVPSLFGLFHVAIHFPVYEKLKI 266

Query: 191 FCE--------QRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGH 242
           +          QR D +   +  L   AS ++ +V+  I +P + +R R QV   +  G 
Sbjct: 267 WLHRNTPAADGQRLDHNKLQLDRL-IVASCLSKVVASVITYPHEILRTRMQV---RHSGV 322

Query: 243 PGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
           P                + L L   I   EG +  Y G+   + ++VP++V++L  +E+
Sbjct: 323 P---------------PSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFEY 366

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 77/164 (46%), Gaps = 19/164 (11%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLA---NEAQYGGILVTFKRLVRQEGVRALWK 73
           +L AG +S      +T P+  +K RL +Q     +   Y   L  F+++ R EG++  + 
Sbjct: 187 ALTAGAIS----TALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYS 242

Query: 74  GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPA----------QIHTGMVGA-LSGTCS 122
           G VP++   + + +  F  Y  L   L ++   A          Q+   +V + LS   +
Sbjct: 243 GLVPSL-FGLFHVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVA 301

Query: 123 AIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           ++ +YP ++LRTR    HS    ++L+    I   EG+ GF+ G
Sbjct: 302 SVITYPHEILRTRMQVRHSGVPPSLLNLLGRIRASEGYVGFYSG 345

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 58/141 (41%), Gaps = 13/141 (9%)

Query: 98  KLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHS----RELSTMLSTAQE 153
           +LL  +Q+     T + GAL+G  S I   P DV +TR  A  +    R    ++ T   
Sbjct: 79  QLLDDTQV-----TAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSA 133

Query: 154 IWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVI 213
           I R EG  G +KG                  YE     C+QR         +  +++++ 
Sbjct: 134 ILRDEGVAGLYKGLAPIVLGYFPTWMLYFSVYEK----CKQRYPSYLPGGFVSHAASALT 189

Query: 214 AGIVSKTIVFPIDTVRKRYQV 234
           AG +S  +  PI  V+ R  +
Sbjct: 190 AGAISTALTNPIWVVKTRLMI 210

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 43/107 (40%), Gaps = 19/107 (17%)

Query: 201 SVIQLLESS-----ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKS 255
           S +QLL+ +     +  +AG VS  +V P+D  + R Q          G   + Y+    
Sbjct: 76  SALQLLDDTQVTAVSGALAGFVSGIMVCPLDVAKTRLQA------QGAGSGERYYRGIVG 129

Query: 256 YTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
             S         I+  EG+  LY G    +    P+ ++   VYE C
Sbjct: 130 TLSA--------ILRDEGVAGLYKGLAPIVLGYFPTWMLYFSVYEKC 168

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/312 (21%), Positives = 138/312 (44%), Gaps = 38/312 (12%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALW 72
           PV + +++G  +G    + T PLD +K+RLQL LA   +  G     KR+V+     + +
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQL-LATNKKPQGYYDVVKRIVKDSKQHSFF 65

Query: 73  K-----------GNVPAMAMYI-LYGSTQ-------FTSYAILNKLLSKSQLPAQIHTGM 113
           +           GN  A  +Y  LY +++        T     N  ++  +    +   +
Sbjct: 66  RETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLL 125

Query: 114 VGALSGTCSAIASYPCDVLRTRFIAN---HSRELSTMLSTAQEIWRHEGFRGFFKGXXXX 170
             A+SG  +++ + P  V++TR ++     SR   + +   ++++R EG  GF++G    
Sbjct: 126 AAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRG-LVP 184

Query: 171 XXXXXXXXXXXXXXYESVK--IFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTV 228
                         Y+++K   F  +  D+   +  L   + + ++ +VS T V+P+  +
Sbjct: 185 SLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQLL 244

Query: 229 RKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKS 288
           +   Q  +   + +P  +++ +K            L   I  ++G+  LY G    + ++
Sbjct: 245 KSNLQSFEVSTVINPKTSHRVWK------------LITTIYVRDGVTGLYKGLLANLIRA 292

Query: 289 VPSTVVSLGVYE 300
           VPST ++  VYE
Sbjct: 293 VPSTCITFCVYE 304

>Kwal_23.4731
          Length = 314

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 136/316 (43%), Gaps = 47/316 (14%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVR-------- 64
           P+ + ++AG  +G    I T PLD +K+RLQL L N     G     K ++R        
Sbjct: 12  PLQREIIAGLAAGTLTTIATHPLDLVKLRLQL-LVNTTHSHGYKEVIKTIIRDSKADSNV 70

Query: 65  -QEGVRAL---WKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQI---HTGMVG-- 115
            +E  R L     GN  A  +Y  +G  +FT   +    +++ + P Q        +G  
Sbjct: 71  FREAYRGLGVNLIGNSIAWGLY--FGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPS 128

Query: 116 ------ALSGTCSAIASYPCDVLRTRFIANHSR---ELSTMLSTAQEIWRHEGFRGFFKG 166
                 ALSG  +AI + P  V++TR ++  S+      T     ++++ HEGF GF++G
Sbjct: 129 LYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRG 188

Query: 167 XXXXXXXXXXXXXXXXXXYESVK--IFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFP 224
                             Y+S++   F  +    D  +  L   + + ++ ++S T V+P
Sbjct: 189 LVPSLFGVAQGAIYFTI-YDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYP 247

Query: 225 IDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLG 284
              ++   Q               ++ A +   S  F  L   I +KEGL  LY G +  
Sbjct: 248 FQLLKSNLQ---------------SFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSAN 292

Query: 285 IAKSVPSTVVSLGVYE 300
           + +++PST ++  +YE
Sbjct: 293 LLRAIPSTCITFCIYE 308

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/323 (23%), Positives = 127/323 (39%), Gaps = 51/323 (15%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKI------RLQLQLANEAQ--------------YGG 54
           F   +AG +SG+ +R  TAP D LK+       L   L N  +                 
Sbjct: 201 FGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSP 260

Query: 55  ILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK------SQLPAQ 108
           ++     L RQ G+++ + GN           S +F S+ I  KL++K      ++  ++
Sbjct: 261 LVKAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSK 320

Query: 109 IHTGMVGALSGTCSAIASYPCDVLRTRF-IANHSRELS---TMLSTAQEIWRHEGFRGFF 164
           + T + G L+G C+  + YP D L+ R   A  + EL     M+ TA+E++   G + F+
Sbjct: 321 LSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFY 380

Query: 165 KGXXX-------XXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIV 217
           +G                         Y S K     + + D  +  L+       +G  
Sbjct: 381 RGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTF 440

Query: 218 SKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLAL 277
             T+V+PI+ +R R Q        HP            Y    F  + L  +++EG   L
Sbjct: 441 GATVVYPINLLRTRLQA--QGTFAHP------------YRYDGFRDVLLKTIQREGYPGL 486

Query: 278 YHGYTLGIAKSVPSTVVSLGVYE 300
           + G    +AK  P+  +S   YE
Sbjct: 487 FKGLVPTLAKVCPAVSISYLCYE 509

 Score = 60.5 bits (145), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 81/180 (45%), Gaps = 17/180 (9%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILV--TFKR 61
           ++ +  +++    + +AG L+G+ A+    P+DTLK R+Q    N    G  L+  T K 
Sbjct: 310 ENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKE 369

Query: 62  LVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILN--------KLLSKSQLPAQIHTGM 113
           +  + G++  ++G    +     Y +    ++++L         K L+K +   ++   +
Sbjct: 370 MYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLV 429

Query: 114 V---GALSGTCSAIASYPCDVLRTRFIAN----HSRELSTMLSTAQEIWRHEGFRGFFKG 166
           V   GA SGT  A   YP ++LRTR  A     H            +  + EG+ G FKG
Sbjct: 430 VLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKG 489

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 5/100 (5%)

Query: 6   LRKGQEVPVFQSLVA---GCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFK 60
           L K +E     +LV    G  SG     V  P++ L+ RLQ Q   A+  +Y G      
Sbjct: 416 LNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLL 475

Query: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
           + +++EG   L+KG VP +A      S  +  Y  L KL+
Sbjct: 476 KTIQREGYPGLFKGLVPTLAKVCPAVSISYLCYENLKKLM 515

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 74.3 bits (181), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 131/316 (41%), Gaps = 48/316 (15%)

Query: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFK 60
           ED  +KG        ++ G ++G   +++  P DT+K+RLQ Q +N     +  I  T+ 
Sbjct: 2   EDSKKKGLIEGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTY- 60

Query: 61  RLVRQEGV-RALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK--SQLP-AQIHTGMVGA 116
              + EG+ R  ++G    +    L  +T F SY   +K L K  +  P  QI   + G 
Sbjct: 61  ---QNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVFPLGQIL--ISGG 115

Query: 117 LSGTCSAIASYPCDVLRTRF------IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXX 170
           ++G+C+++   P ++++ +       +A+   + + +L T + I    G  G ++G    
Sbjct: 116 VAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGT 175

Query: 171 XXXXXXXXXXXXXXYESVKIFCEQR-----PDRDSSVI-QLLESSASVIAGIVSKTIVFP 224
                         YE VK   + R     P RD S I +LL S  S  AG+     +FP
Sbjct: 176 FIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGS--AGLAFNASIFP 233

Query: 225 IDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLG 284
            DTV+   Q        H   TN   K +  +                GL   Y G  + 
Sbjct: 234 ADTVKSVMQT------EHISLTNAVKKIFGKF----------------GLKGFYRGLGIT 271

Query: 285 IAKSVPSTVVSLGVYE 300
           + ++VP+      ++E
Sbjct: 272 LFRAVPANAAVFYIFE 287

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 115/308 (37%), Gaps = 36/308 (11%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLV 63
           D+       P++  L+AG  +GI    V  P+D LK R+Q   A       +L     + 
Sbjct: 23  DYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHIS 82

Query: 64  RQEGVRALWK-------GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGA 116
             EG  ALWK       G  PA A+Y       F +Y    K L  S    Q H     A
Sbjct: 83  TSEGTLALWKGVQSVILGAGPAHAVY-------FGTYEFCKKNLIDSS-DTQTHHPFKTA 134

Query: 117 LSGTCSAIAS----YPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXX 172
           +SG C+  AS     P D ++ R   N S   +++  T ++I++ EG   F+        
Sbjct: 135 ISGACATTASDALMNPFDTIKQRIQLNTS---ASVWQTTKQIYQSEGLAAFYYSYPTTLV 191

Query: 173 XXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRY 232
                       YES   F     + +     L+      I+G     I  P+D ++   
Sbjct: 192 MNIPFAAFNFVIYESSTKFLNPSNEYN----PLIHCLCGSISGSTCAAITTPLDCIKTVL 247

Query: 233 QVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPST 292
           Q+   Q +          KA        F + A  I +  G    + G+   I  ++P+T
Sbjct: 248 QIRGSQTVS----LEIMRKA------DTFSKAASAIYQVYGWKGFWRGWKPRIVANMPAT 297

Query: 293 VVSLGVYE 300
            +S   YE
Sbjct: 298 AISWTAYE 305

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 16/93 (17%)

Query: 210 ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIV 269
           A   AGI+  +++FPID ++ R Q  +                 KS ++ N L     I 
Sbjct: 39  AGAFAGIMEHSVMFPIDALKTRIQSAN----------------AKSLSAKNMLSQISHIS 82

Query: 270 EKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
             EG LAL+ G    I  + P+  V  G YE+C
Sbjct: 83  TSEGTLALWKGVQSVILGAGPAHAVYFGTYEFC 115

>Scas_717.20
          Length = 356

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/345 (20%), Positives = 135/345 (39%), Gaps = 64/345 (18%)

Query: 7   RKGQEVPV--------FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVT 58
           RK  ++P+         +S +AG +SG  A+ + APLD +KI  Q    +  +Y G LV 
Sbjct: 17  RKRNQMPIDKNSLEYITRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVG 76

Query: 59  FKRLVRQ----EGVRALWKGNVPAMAMYILYGSTQFTSYA-ILNKLLSKSQLPAQIHTGM 113
            K   +     +G+R  ++G+   +     Y + +F +Y  I N L+   +  +     M
Sbjct: 77  LKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRRLM 136

Query: 114 VGALSGTCSAIASYPCDVLRTR--FIANHSRELSTMLSTAQEIWRHEG------------ 159
            G+L+G CS   +YP D++R R  ++  H R   ++L   + I++               
Sbjct: 137 SGSLAGLCSVFTTYPLDLIRVRLAYVTEHKR--ISLLGLVKTIYKEPASTTLEAKGYIPN 194

Query: 160 ----FRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESS------ 209
               +  F++G                  ++ +    +       SV+ L ES       
Sbjct: 195 WFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHF 254

Query: 210 --------------ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKS 255
                         +  +AG+ S+T  +P + +R+R QV           +  +      
Sbjct: 255 KHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQV-----------STLSVSQMYD 303

Query: 256 YTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           +   +   +A +I ++ G    + G ++G  K  P    S  VYE
Sbjct: 304 HRFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYE 348

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 128/323 (39%), Gaps = 51/323 (15%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRL---------------QLQLAN-EAQYGGI--- 55
           F   +AG +SG+ +R  TAP D LK+ L                L   N  A    I   
Sbjct: 228 FGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSP 287

Query: 56  -LVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK------SQLPAQ 108
                K L RQ G++A + GN   +       S +F S+ +  K+++K      ++  ++
Sbjct: 288 LAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSK 347

Query: 109 IHTGMVGALSGTCSAIASYPCDVLRTRF----IANHSRELSTMLSTAQEIWRHEGFRGFF 164
             T + G L+G  +  + YP D L+ R     +    +  + +  TA++++R  G R F+
Sbjct: 348 FSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFY 407

Query: 165 KGXXXXXXXXXXXXXXXXXXYESVKIFCEQR-------PDRDSSVIQLLESSASVIAGIV 217
           +G                  + ++K +   +       P    ++  L+       +G V
Sbjct: 408 RGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTV 467

Query: 218 SKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLAL 277
             ++V+PI+ +R R Q        HP            Y    F  + L  +E+EG   L
Sbjct: 468 GASVVYPINLLRTRLQA--QGTYAHP------------YVYNGFKDVLLKTLEREGYQGL 513

Query: 278 YHGYTLGIAKSVPSTVVSLGVYE 300
           + G    +AK  P+  +S   YE
Sbjct: 514 FKGLVPTLAKVCPAVSISYLCYE 536

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 86/202 (42%), Gaps = 17/202 (8%)

Query: 7   RKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILV--TFKRLVR 64
           R  +++  F + +AG L+G++A+    P+DTLK R+Q    +    G  L+  T K + R
Sbjct: 340 RDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFR 399

Query: 65  QEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQ-----LP------AQIHTGM 113
           + G+R  ++G    +     Y +    +++ L K     Q     LP      + +    
Sbjct: 400 EGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLP 459

Query: 114 VGALSGTCSAIASYPCDVLRTRFIAN----HSRELSTMLSTAQEIWRHEGFRGFFKGXXX 169
           +GA SGT  A   YP ++LRTR  A     H    +       +    EG++G FKG   
Sbjct: 460 MGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVP 519

Query: 170 XXXXXXXXXXXXXXXYESVKIF 191
                          YE++K F
Sbjct: 520 TLAKVCPAVSISYLCYENLKKF 541

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 2/86 (2%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           L  G  SG     V  P++ L+ RLQ Q   A+   Y G      + + +EG + L+KG 
Sbjct: 458 LPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGL 517

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLS 101
           VP +A      S  +  Y  L K ++
Sbjct: 518 VPTLAKVCPAVSISYLCYENLKKFMN 543

>Kwal_23.3042
          Length = 542

 Score = 72.8 bits (177), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/324 (22%), Positives = 134/324 (41%), Gaps = 53/324 (16%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRL--QLQLAN----------EAQYGGILVTFKR- 61
           F   +AG +SG+ +R  TAP D +K+ L  +  L++          E      L   K  
Sbjct: 225 FGFFIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSP 284

Query: 62  -------LVRQEGVRALWKGN-VPAMAMYILYGSTQFTSYAILNKLLSK------SQLPA 107
                  L RQ G+RA + GN + AM ++    + +F S+ +  +L+++      +   +
Sbjct: 285 LVKAATTLYRQGGIRAFYVGNGLNAMKVFP-ESAIKFGSFELAKRLMAQLEGVQDTAGLS 343

Query: 108 QIHTGMVGALSGTCSAIASYPCDVLRTRF----IANHSRELSTMLSTAQEIWRHEGFRGF 163
           +  T + G L G  + ++ YP D L+ R     +   S+    ++STA+++++  G R F
Sbjct: 344 RFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIF 403

Query: 164 FKGXXXXXXXXXXXXXXXXXXYESVKIFCEQR-------PDRDSSVIQLLESSASVIAGI 216
           ++G                  + ++K +   R       P+   ++  +        +G 
Sbjct: 404 YRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGT 463

Query: 217 VSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLA 276
           V  T V+P++ +R R Q        HP   N             F  + L  V++EG   
Sbjct: 464 VGATAVYPVNLLRTRLQA--QGTFAHPHRYN------------GFRDVLLKTVQREGYQG 509

Query: 277 LYHGYTLGIAKSVPSTVVSLGVYE 300
           L+ G    +AK  P+  +S   YE
Sbjct: 510 LFKGLVPNLAKVCPAVSISYLCYE 533

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 80/325 (24%), Positives = 130/325 (40%), Gaps = 45/325 (13%)

Query: 2   AEDHLRK--GQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ----LANEAQYGGI 55
            ED ++K   Q+V  F S  AG L+   A  VT P++ +KIR+QLQ     AN+  Y   
Sbjct: 4   GEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNP 63

Query: 56  LVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY----AILNKLLSKSQLPAQIHT 111
                 + R EG+R L KG V A    I    ++   Y    A++NK     Q   ++ +
Sbjct: 64  FQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQS 123

Query: 112 GMV----GALSGTCSAIASYPCDVLRTRFIA-------NHSRELSTMLSTAQEIWRHEGF 160
             +    GA SG   A+   P  +++TR  +             + + +  + I+  EG 
Sbjct: 124 VGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGV 183

Query: 161 RGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPD--RDSSVIQLLESSASVIAGIVS 218
           +G F+G                  Y + K F   R D   D   + L   +AS I+G+  
Sbjct: 184 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL-LRNDIMEDGPSLHL---TASTISGLGV 239

Query: 219 KTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALY 278
             ++ P D +  R               N+    YK       +   +  V+ EG+ ALY
Sbjct: 240 AVVMNPWDVILTRIY-------------NQKGDLYKGP-----IDCLVKTVKIEGITALY 281

Query: 279 HGYTLGIAKSVPSTVVSLGVYEWCL 303
            G+   + +  P T++ L   E  +
Sbjct: 282 KGFEAQVFRIGPHTILCLTFLEQTM 306

>Kwal_55.21335
          Length = 317

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 126/295 (42%), Gaps = 37/295 (12%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLVRQEG-VRAL 71
            + ++ G ++G + +++  PLDT+K+RLQ Q A+     +  I  T+++    EG V+  
Sbjct: 46  LKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQK----EGFVKGF 101

Query: 72  WKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQI-HTGMVGALSGTCSAIASYPCD 130
           ++G    +    L  +  F ++      L + +  + +  T + GA +G C++    P +
Sbjct: 102 YQGVASPLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQTVLSGAFAGACTSYVLTPVE 161

Query: 131 VLRTRF----IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYE 186
           +++       +   +   S +  T + I +H+G  G ++G                  YE
Sbjct: 162 LIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYE 221

Query: 187 SVKIF-CEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGH 245
           S+K +   +R D ++   +LL S AS  AG+     +FP DT++   Q    Q LG    
Sbjct: 222 SLKSYLARRRNDTENHTWELLASGAS--AGVAFNASIFPADTIKSTAQT---QHLGIVDA 276

Query: 246 TNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           T +                   I+ + G   LY G  + + ++ P+  +    YE
Sbjct: 277 TKR-------------------ILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 79/171 (46%), Gaps = 10/171 (5%)

Query: 2   AEDHLRKGQEV-PVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA--QYGGILVT 58
           A++ L++ + V P+ Q++++G  +G     V  P++ +K  LQ+     A  ++  I  T
Sbjct: 126 AQNFLQQYESVSPLSQTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPT 185

Query: 59  FKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMV---G 115
            K +V+ +G+  LW+G           G+  FT+Y  L   L++ +   + HT  +   G
Sbjct: 186 VKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWELLASG 245

Query: 116 ALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           A +G     + +P D +++     H      ++   + I    G  G ++G
Sbjct: 246 ASAGVAFNASIFPADTIKSTAQTQH----LGIVDATKRILARSGPAGLYRG 292

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 72.0 bits (175), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 132/324 (40%), Gaps = 53/324 (16%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKI------RLQLQLANEAQ--------------YGG 54
           F   +AG  SG+ +R  TAP D +K+       L   L N                    
Sbjct: 200 FGFFIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSP 259

Query: 55  ILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK-------SQLPA 107
           ++     L RQ G+RA + GN   +       + +F S+ +  +++++       S+L +
Sbjct: 260 LIKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSEL-S 318

Query: 108 QIHTGMVGALSGTCSAIASYPCDVLRTRF----IANHSRELSTMLSTAQEIWRHEGFRGF 163
           ++ T + G L G  +  + YP D L+ R     +  + ++ S +L TA+E+++  G R F
Sbjct: 319 RLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLF 378

Query: 164 FKGXXXXXXXXXXXXXXXXXXYESVKIFCEQR-------PDRDSSVIQLLESSASVIAGI 216
           ++G                  + ++K +  ++       P+ +  +  L+       +G 
Sbjct: 379 YRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGT 438

Query: 217 VSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLA 276
           V  T+V+PI+ +R R Q        HP            +T   F  +    +++EG   
Sbjct: 439 VGATLVYPINLLRTRLQA--QGTYAHP------------HTYNGFSDVLKKTIQREGYQG 484

Query: 277 LYHGYTLGIAKSVPSTVVSLGVYE 300
           L+ G    +AK  P+  +S   YE
Sbjct: 485 LFKGLVPNLAKVCPAVSISYLCYE 508

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 88/181 (48%), Gaps = 19/181 (10%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANE--AQYGGILVTFKR 61
           ++++   E+    + +AG L G++A+    P+DTLK R+Q    N    +   +L T K 
Sbjct: 309 ENVKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKE 368

Query: 62  LVRQEGVRALWKG-NVPAMAMYILYGSTQFTSYAILNKLLSKSQ-----LPAQ--IHTGM 113
           + +Q G+R  ++G ++  M ++  Y +    +++ L K   K +     LP    I + +
Sbjct: 369 MYQQGGIRLFYRGVHIGVMGIFP-YAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNL 427

Query: 114 V----GALSGTCSAIASYPCDVLRTRFIAN----HSRELSTMLSTAQEIWRHEGFRGFFK 165
           +    GA SGT  A   YP ++LRTR  A     H    +      ++  + EG++G FK
Sbjct: 428 IVLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFK 487

Query: 166 G 166
           G
Sbjct: 488 G 488

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           L  G  SG     +  P++ L+ RLQ Q   A+   Y G     K+ +++EG + L+KG 
Sbjct: 430 LPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGL 489

Query: 76  VPAMAMYILYGSTQFTSYAILNKLL 100
           VP +A      S  +  Y  L +L+
Sbjct: 490 VPNLAKVCPAVSISYLCYENLKRLM 514

>Scas_379.2
          Length = 301

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 119/313 (38%), Gaps = 48/313 (15%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLV 63
           D+       P+   L+AG  +GI    V  P+D LK R+Q   A       +L    ++ 
Sbjct: 13  DYEALPDSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKST--SNMLSQMAKIS 70

Query: 64  RQEGVRALWK-------GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGA 116
             EG  ALWK       G  PA A+Y       F +Y    K L   +   Q H  +  A
Sbjct: 71  TAEGSLALWKGVQSVILGAGPAHAVY-------FATYEYTKKYLIDEK-DMQTHQPLKTA 122

Query: 117 LSGTCSAIAS----YPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXX 172
           LSGT + IA+     P D L+ R   N +   +T+ +  ++I+++EGF  F+        
Sbjct: 123 LSGTVATIAADALMNPFDTLKQRMQLNTN---TTVWNVTKQIYKNEGFSAFYYSYPTTLA 179

Query: 173 XXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRY 232
                       YES   F     D +     L+   +  ++G     I  P+D ++   
Sbjct: 180 MNIPFAAFNFMIYESATKFFNPTNDYNP----LVHCLSGGLSGATCAAITTPLDCIKTVL 235

Query: 233 QV-----IDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAK 287
           QV     +  Q +       KA KA               I +  G    + G    +  
Sbjct: 236 QVRGSESVSLQVMKEANTFQKATKA---------------IYQVHGAKGFWRGLQPRVFA 280

Query: 288 SVPSTVVSLGVYE 300
           ++P+T ++   YE
Sbjct: 281 NMPATAIAWTAYE 293

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 21/109 (19%)

Query: 193 EQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKA 252
           E  PD      QLL   A   AGI+  +++FPID ++ R Q                  +
Sbjct: 15  EALPDSAPLSHQLL---AGAFAGIMEHSVMFPIDALKTRIQ------------------S 53

Query: 253 YKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
             + +++N L     I   EG LAL+ G    I  + P+  V    YE+
Sbjct: 54  TSAKSTSNMLSQMAKISTAEGSLALWKGVQSVILGAGPAHAVYFATYEY 102

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 136/319 (42%), Gaps = 42/319 (13%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ----LANEAQ-YGGILVT 58
           + L+K  +  V  + ++G LSG  + ++  P D  K RLQ Q    + +++Q Y G   T
Sbjct: 30  NRLKKNADPRV--AAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGT 87

Query: 59  FKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNK----LLSKSQLPAQIHTGMV 114
           F  + + EG   L+KG  P +  YI      F+ Y    K    +   S   +   + + 
Sbjct: 88  FATIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNASSAIT 147

Query: 115 GALSGTCSAIASYPCDVLRTRF-----IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXX 169
              +G  S +A+ P  V++TR      I  +S      + T ++I + EG +  + G   
Sbjct: 148 ---AGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVP 204

Query: 170 XXXXXXXXXXXXXXXYESVKI---FCEQ---RPDRDSSVIQLLESSASVIAGIVSKTIVF 223
                          YE++KI   + E      D  SS  Q L   AS+++ +V+ T+ +
Sbjct: 205 ALLGMLNVAIQFPL-YENLKIRFGYSESTDVSTDVTSSNFQKL-ILASMLSKMVASTVTY 262

Query: 224 PIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTL 283
           P + +R R Q+    +   P    +           + L L  +   +EG    Y G+  
Sbjct: 263 PHEILRTRMQL----KSDLPNTVQR-----------HLLPLIKITYRQEGFAGFYSGFAT 307

Query: 284 GIAKSVPSTVVSLGVYEWC 302
            + ++VP+ VV+L  +E+ 
Sbjct: 308 NLVRTVPAAVVTLVSFEYS 326

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 121/302 (40%), Gaps = 42/302 (13%)

Query: 19  VAGCLSGISARIVTAPLDTLKIRLQLQ----LANEAQYGGILVTFKRLVRQEGVRALWKG 74
           ++G  +G  + +   PLD  K RLQ Q          Y GI+ T   +VR EG R L+KG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 75  NVPAMAMY----ILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCD 130
            VP +  Y    ++Y S    S    + +  +    AQ         +G  S   + P  
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQ---SCAAITAGAASTTLTNPIW 198

Query: 131 VLRTRF-----IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXY 185
           V++TR      +  H           ++++  EGF+  + G                  Y
Sbjct: 199 VVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAG-LVPSLLGLFHVAIHFPIY 257

Query: 186 ESVKI--FCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHP 243
           E +K+   C  R +  +S+       AS ++ +++  + +P + +R R Q+         
Sbjct: 258 EDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQL--------- 308

Query: 244 GHTNKAYKAYKSYTSTNFLRLALMIVE----KEGLLALYHGYTLGIAKSVPSTVVSLGVY 299
                     KS    +  R    +++    +EGL   Y G+T  + +++P++ ++L  +
Sbjct: 309 ----------KSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSF 358

Query: 300 EW 301
           E+
Sbjct: 359 EY 360

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 79/198 (39%), Gaps = 30/198 (15%)

Query: 94  AILNKLLSKSQLP---AQIHTGMVGALSGTCSAIASYPCDVLRTRFIAN------HSREL 144
           +I+   L K  +P    QI T + GA +G  S +A  P DV +TR  A        +   
Sbjct: 61  SIIGTTLRKKWVPLSSTQI-TALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYY 119

Query: 145 STMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYE-SVKIFCEQRPDRDSSVI 203
             ++ T   I R EG RG +KG                  YE S K F    P  D    
Sbjct: 120 RGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDF--- 176

Query: 204 QLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLG-HPGHTNKAYKAYKSYTSTNFL 262
            + +S A++ AG  S T+  PI  V+ R  +     LG HP H    + A++        
Sbjct: 177 -VAQSCAAITAGAASTTLTNPIWVVKTRLML--QSNLGEHPTHYKGTFDAFRK------- 226

Query: 263 RLALMIVEKEGLLALYHG 280
                +  +EG  ALY G
Sbjct: 227 -----LFYQEGFKALYAG 239

>Scas_721.129
          Length = 323

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 82/317 (25%), Positives = 128/317 (40%), Gaps = 47/317 (14%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQ--YGGILVTFKRLVRQ 65
           Q+V  F S +AG ++   A   T P++ +KIR+QLQ  LA   Q  Y   +     + R 
Sbjct: 17  QKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRN 76

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGM--------VGAL 117
           EG+R L KG V A    I    ++   Y  +   L+ +  P +    +         GA 
Sbjct: 77  EGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGAS 136

Query: 118 SGTCSAIASYPCDVLRTRFIA----------NHSRELSTMLSTAQEIWRHEGFRGFFKGX 167
           SG   A+   P  +++TR  +           H R +   LST   I R EGF+G F+G 
Sbjct: 137 SGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLST---IARTEGFKGLFRGI 193

Query: 168 XXXXXXXXXXXXXXXXXYESVKIFCEQRP-DRDSSVIQLLESSASVIAGIVSKTIVFPID 226
                            Y + K F  +    +D   + L   +AS I+G+    ++ P D
Sbjct: 194 DAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHL---TASTISGLGVAVVMNPWD 250

Query: 227 TVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIA 286
            +  R     + Q G+          YK      F++     V  EG+ ALY G+   I 
Sbjct: 251 VILTRI----YNQKGN---------LYKGPVDC-FVK----TVRTEGISALYKGFQAQIL 292

Query: 287 KSVPSTVVSLGVYEWCL 303
           +  P T++ L   E  +
Sbjct: 293 RIAPHTIICLTFMEQTM 309

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 79/327 (24%), Positives = 143/327 (43%), Gaps = 54/327 (16%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQL--ANEAQYGGILVTFKR 61
           DH    Q  P+ + +++G  +G    +V  PLD LK+RLQL    A +A YG  +V  K 
Sbjct: 3   DH----QWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMV-IKE 57

Query: 62  LVRQ-------------EGVRALWKGNVPAMAMYI-LYGSTQFTSYAILNK--------L 99
           ++R               G+     GN  A  +Y  LYG T+   Y  + K        +
Sbjct: 58  IIRSSANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGV 117

Query: 100 LSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRE---LSTMLSTAQEIWR 156
            +  ++ + I+    GA SG  +AI + P  V++TR ++         ++M +  Q++ R
Sbjct: 118 GNDHKMNSLIYLS-AGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLR 176

Query: 157 HEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQL--LES-SASVI 213
            +GF+G +KG                  Y+++K    +R   +   I L  LE+   + +
Sbjct: 177 TDGFQGLWKGLVPALFGVSQGALYFAV-YDTLKQRKLRRKRENGLDIHLTNLETIEITSL 235

Query: 214 AGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEG 273
             +VS T+V+P   ++   Q               +++A +         L  +I+  +G
Sbjct: 236 GKMVSVTLVYPFQLLKSNLQ---------------SFRANEQ--KFRLFPLIKLIIANDG 278

Query: 274 LLALYHGYTLGIAKSVPSTVVSLGVYE 300
            + LY G +  + +++PST ++  VYE
Sbjct: 279 FVGLYKGLSANLVRAIPSTCITFCVYE 305

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 125/298 (41%), Gaps = 32/298 (10%)

Query: 19  VAGCLSGISARIVTAPLDTLKIRLQLQ-----LANEAQYGGILVTFKRLVRQEGVRALWK 73
           ++G L+G+ + IV  PLD  K RLQ Q           Y G + T   +VR EGVR L+K
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 74  GNVPAMAMYILYGSTQFTSYAIL-NKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVL 132
           G VP +  Y       F+ Y    + L + S   + +        +G  S + + P  V+
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVTNPIWVV 192

Query: 133 RTRF-----IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYES 187
           +TR      I +++          ++I   EG +  + G                  YE 
Sbjct: 193 KTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAG-LVPSLLGLLHVAIHFPVYER 251

Query: 188 VKIF--CEQRPD-RDSSVIQLLE-SSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHP 243
           +K+   C QR +  + S I L     AS ++ +V+  + +P + +R R Q+    +   P
Sbjct: 252 LKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQL----KSDLP 307

Query: 244 GHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
            H  +             + L  +   +EG+   Y G+   + +++P++ ++L  +E+
Sbjct: 308 SHQRR------------LIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEY 353

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 40/93 (43%), Gaps = 11/93 (11%)

Query: 210 ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIV 269
           +  +AG++S  +V P+D  + R Q    Q L      N  Y+      +T        IV
Sbjct: 74  SGALAGLLSGIVVCPLDVAKTRLQA---QGLQTRTTENLYYRGSIGTMTT--------IV 122

Query: 270 EKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
             EG+  LY G    I    P+ ++   VYE+C
Sbjct: 123 RDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFC 155

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 129/301 (42%), Gaps = 30/301 (9%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQL--QLA--NEAQYGGILVTFKRLVRQEGVRALW 72
           +L+AG  +G+   +   PLDT+K+R+Q+  ++A     +  G + T + + ++EG  AL+
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 73  KGNVPAMAMYILYGSTQFTSYAILNKLL--SKSQLPAQIHTGMVGALSGTCSAI-ASYPC 129
           KG    +   I   + +F+SY     LL   +S + +  +T + G  +G   A+    P 
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPM 132

Query: 130 DVLRTRFIANH--------SRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXX 181
           +V++ R  A H          + +  +  A  I + EG    ++G               
Sbjct: 133 EVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGAN 192

Query: 182 XXXYESVKIFCEQRPDRDSSVIQLLESSA-SVIAGIVSKTIVFPIDTVRKRYQVIDWQQL 240
              Y  +K F +     D  V+   E+S   +I+G +      P+DT++ R Q       
Sbjct: 193 FTVYSKLKEFLQNYHQMD--VLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ------- 243

Query: 241 GHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
                 +K+    K       + +   ++++EG  ALY G T  + +  P   V+  VYE
Sbjct: 244 -----KDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

Query: 301 W 301
           +
Sbjct: 299 Y 299

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 12  VPVFQSLVAGCLSGISARIVTAPLDTLKIRLQ----LQLANEAQYGGILVTFKRLVRQEG 67
           +P +++   G +SG       APLDT+K RLQ    + L  ++    I+    +L+++EG
Sbjct: 212 LPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEG 271

Query: 68  VRALWKGNVPAMAMYILYGSTQFTSY 93
            RAL+KG  P +       +  FT Y
Sbjct: 272 FRALYKGITPRVMRVAPGQAVTFTVY 297

>Kwal_23.2913
          Length = 320

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 81/154 (52%), Gaps = 10/154 (6%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           Q  +AG  S I   ++TAP + +K+ LQ      ++ G  L   + L+R+ GVR+L++G 
Sbjct: 143 QLALAGFFSAIPTTLITAPTERVKVVLQ-----TSESGSFLGAARTLIREGGVRSLFQGT 197

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLSKSQLP---AQIHTGMVGALSGTCSAIASYPCDVL 132
           +  +A      +  F SY +  + LS++Q     + +   + G ++G    I  +P D +
Sbjct: 198 LATLARDGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTI 257

Query: 133 RTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           +T+ + + SR  S M+  A+EI+   G RGFF G
Sbjct: 258 KTK-LQSSSRSQS-MVQAAREIYTRAGLRGFFPG 289

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 117/307 (38%), Gaps = 50/307 (16%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQ--------- 65
           F+SL AG + G+ A +   P D LK+R Q   +N+A   G L    R++ +         
Sbjct: 29  FESLAAGGVGGVCAVLTGHPFDLLKVRCQ---SNQAS--GTLDAISRVLHEAKSKSGPLP 83

Query: 66  -EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVG--------- 115
              ++  ++G +P +       +  F  Y +  +L++    P     G            
Sbjct: 84  LNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQ 143

Query: 116 -ALSGTCSAIASYPCDVLRTRF-IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXX 173
            AL+G  SAI +        R  +   + E  + L  A+ + R  G R  F+G       
Sbjct: 144 LALAGFFSAIPTTLITAPTERVKVVLQTSESGSFLGAARTLIREGGVRSLFQGTLATLAR 203

Query: 174 XXXXXXXXXXXYESVKIFCEQRPDRDS-SVIQLLESSASVIAGIVSKTIVFPIDTVRKRY 232
                      YE  K F  +  D D+ SV+ +    A  +AG+     VFPIDT++ + 
Sbjct: 204 DGPGSALYFASYEVSKRFLSRNQDTDALSVVSIC--VAGGVAGMSMWIGVFPIDTIKTKL 261

Query: 233 QVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPST 292
           Q                     S  S + ++ A  I  + GL   + G    + +S P+ 
Sbjct: 262 Q--------------------SSSRSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPAN 301

Query: 293 VVS-LGV 298
             + LGV
Sbjct: 302 AATFLGV 308

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 126/299 (42%), Gaps = 30/299 (10%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQL--QLANEA-QYGGILVTFKRLVRQEGVRALWK 73
           +L+AG  +G+   +   PLDT+K+R+Q+  + A E  +  G + T + +  +EG+ AL+K
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYK 72

Query: 74  GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG---MVGALSGTCSAI-ASYPC 129
           G    +   I   + +F+SY      L+  Q    + TG   + G  +GT  A+    P 
Sbjct: 73  GLGAVVIGIIPKMAIRFSSYEFYRSALADKQT-GSVSTGNTFLAGVGAGTTEAVLVVNPM 131

Query: 130 DVLRTRFIANH-------SRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXX 182
           +V++ R  A H       S      L     I + EG    ++G                
Sbjct: 132 EVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGANF 191

Query: 183 XXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGH 242
             Y  +K F ++    D+ +     S   +I+G +      P+DT++ R Q         
Sbjct: 192 TVYSKLKEFLQEHHKTDA-LPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ--------- 241

Query: 243 PGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
               +K+      ++    + +   ++++EG  ALY G T  + +  P   V+  VYE+
Sbjct: 242 ---KDKSTANMSGWS--RIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 295

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (50%), Gaps = 4/102 (3%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVT 58
           + E H  K   +P +++   G +SG       APLDT+K RLQ     AN + +  I+  
Sbjct: 201 LQEHH--KTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRIVTI 258

Query: 59  FKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
            K+L+++EG RAL+KG  P +       +  FT Y  + + L
Sbjct: 259 GKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHL 300

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 68.9 bits (167), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 129/326 (39%), Gaps = 57/326 (17%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRL--QLQLANEAQYGGILVTFKR----------- 61
           F   +AG  SG+ +R  TAP D +K+ L  +  L++        V  K            
Sbjct: 196 FGFFIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSP 255

Query: 62  -------LVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK-------SQLPA 107
                  L RQ G+RA + GN   +       + +F S+ +  +L++        S+L +
Sbjct: 256 LIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSEL-S 314

Query: 108 QIHTGMVGALSGTCSAIASYPCDVLRTRF------IANHSRELSTMLSTAQEIWRHEGFR 161
           +  T + G + G  +  + YP D L+ R        A    EL  ++STA++++R  G +
Sbjct: 315 KFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNEL--LISTARQMYRDGGLK 372

Query: 162 GFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQR-------PDRDSSVIQLLESSASVIA 214
            F++G                  + ++K +   R       P    ++   +       +
Sbjct: 373 LFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFS 432

Query: 215 GIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGL 274
           G V  T+V+PI+ +R R Q        HP            +T T F  +    V++EG 
Sbjct: 433 GTVGATVVYPINLLRTRLQA--QGTYAHP------------HTYTGFRDVLWKTVQREGY 478

Query: 275 LALYHGYTLGIAKSVPSTVVSLGVYE 300
             L+ G    +AK  P+  +S   YE
Sbjct: 479 QGLFKGLVPNLAKVCPAVSISYLCYE 504

 Score = 60.1 bits (144), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 78/173 (45%), Gaps = 17/173 (9%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILV--TFKRLVRQEGV 68
           E+  F + +AG + G+ A+    P+DTLK R+Q    + A  G  L+  T +++ R  G+
Sbjct: 312 ELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGL 371

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQ-----LPAQ---IHTGMV---GAL 117
           +  ++G    +     Y +    +++ L K     Q     +P     I   +V   GA 
Sbjct: 372 KLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAF 431

Query: 118 SGTCSAIASYPCDVLRTRFIAN----HSRELSTMLSTAQEIWRHEGFRGFFKG 166
           SGT  A   YP ++LRTR  A     H    +       +  + EG++G FKG
Sbjct: 432 SGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKG 484

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 2/88 (2%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFKRLVRQEGVRALW 72
           F  L  G  SG     V  P++ L+ RLQ Q   A+   Y G      + V++EG + L+
Sbjct: 423 FIVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLF 482

Query: 73  KGNVPAMAMYILYGSTQFTSYAILNKLL 100
           KG VP +A      S  +  Y    +L+
Sbjct: 483 KGLVPNLAKVCPAVSISYLCYENFKRLM 510

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           Q+ + G LSGI     T P+DT+K R+Q    + A+YG  +  F+ +VR+EGVRALW+G 
Sbjct: 213 QTFLVGALSGIVTVYATMPVDTVKTRMQA--LDAARYGSTVGCFRAVVREEGVRALWRGA 270

Query: 76  VPAMAMYILYGSTQFTSYAILNKLL 100
            P +   +L G   FT+Y  L  LL
Sbjct: 271 TPRLGRLVLSGGIVFTAYEKLLVLL 295

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 64/293 (21%), Positives = 105/293 (35%), Gaps = 47/293 (16%)

Query: 31  VTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQF 90
           VT P +  K RLQL      +    LV   R  R +G  AL+ G    +         +F
Sbjct: 27  VTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRF 86

Query: 91  TSYAILNKLLSKSQLPAQIHTGMVGALSGTC--SAIASYPCDVLRTRFIANHSRELSTML 148
             +  L + L   +       GM+  L      S +A  P + ++T  I +         
Sbjct: 87  LGFDALRRALQDERGALSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDR-------- 138

Query: 149 STAQEIWRHEGFRGFFKGXXXXXXXXXXX--------XXXXXXXYESVKIFC----EQRP 196
             A+  ++H G RG  +                            ++V+  C    +Q  
Sbjct: 139 QAARPRYQHNG-RGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAV 197

Query: 197 DR--DSSVIQLLESSAS----VIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAY 250
            R   +   Q L S  +     ++GIV+     P+DTV+ R Q +D  +    G T   +
Sbjct: 198 QRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQALDAARY---GSTVGCF 254

Query: 251 KAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWCL 303
           +A               +V +EG+ AL+ G T  + + V S  +    YE  L
Sbjct: 255 RA---------------VVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLL 292

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 68.2 bits (165), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 135/320 (42%), Gaps = 46/320 (14%)

Query: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQL-QLANEA-QYGGILVTFK 60
           ++H+   +      +LVAG  +G+   +   PLDT+K+R+Q+ + ANE  +  G L T  
Sbjct: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA 105

Query: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG---MVGAL 117
            +   EG+ A +KG    +   I   + +F+SY     LL+  Q    + TG   + G  
Sbjct: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQT-GVVSTGNTFLAGVG 164

Query: 118 SGTCSAI-ASYPCDVLRTRFIANH------SRELSTMLSTAQEIWRHEGFRGFFKGXXXX 170
           +G   A+    P +V++ R  A H       ++    +  A  I + EG    ++G    
Sbjct: 165 AGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLT 224

Query: 171 XXXXXXXXXXXXXXY----ESVKIF--CEQRPDRDSSVIQLLESSASVIAGIVSKTIVFP 224
                         Y    E ++ +   +  P  ++S+I L       ++G +      P
Sbjct: 225 AARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGL-------VSGAIGPFSNAP 277

Query: 225 IDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALM---IVEKEGLLALYHGY 281
           +DT++ R Q                 K   +   +N++R+  +   +V++EG  ALY G 
Sbjct: 278 LDTIKTRLQ-----------------KDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGI 320

Query: 282 TLGIAKSVPSTVVSLGVYEW 301
           T  + +  P   V+  VYE+
Sbjct: 321 TPRVMRVAPGQAVTFTVYEF 340

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 2/93 (2%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLA--NEAQYGGILVTFKRLVRQEG 67
           Q +P +++ + G +SG       APLDT+K RLQ   +  N + +  I    ++LV++EG
Sbjct: 253 QNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEG 312

Query: 68  VRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
            RAL+KG  P +       +  FT Y  + + L
Sbjct: 313 FRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 68.2 bits (165), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 74/328 (22%), Positives = 133/328 (40%), Gaps = 52/328 (15%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTF----KRLVRQEGVR 69
           V +S +AG +SG  A+ + APLD +KI  Q    + ++Y G LV      K +   +G+R
Sbjct: 18  VVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIR 77

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS-QLPAQIHTGMVGALSGTCSAIASYP 128
             ++G+   +     Y + +F +Y  +  +L  S +  +       G+L+G CS   +YP
Sbjct: 78  GFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLASGSLAGLCSVFITYP 137

Query: 129 CDVLRTR--FIANHSR-ELSTMLSTAQEIWRHEGFR-------------GFFKGXXXXXX 172
            D+ R R  ++  H R +L  ++ T       EG                F++G      
Sbjct: 138 LDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTVL 197

Query: 173 XXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQL----------------LESSASVIA-- 214
                       ++ +    +       +V QL                L + A ++A  
Sbjct: 198 GMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAGG 257

Query: 215 --GIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKE 272
             GI+S+T  +P++ +R+R QV           T    K Y  +   +   +A +I +++
Sbjct: 258 LSGILSQTAAYPLEIIRRRLQV----------STLSPRKMY-DHKFQSISSIARIIYQEK 306

Query: 273 GLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           G    + G ++G  K  P    S  VYE
Sbjct: 307 GWRGFFVGLSIGYIKVTPMVACSFFVYE 334

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 60/138 (43%), Gaps = 9/138 (6%)

Query: 100 LSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRF------IANHSRELSTMLSTAQE 153
           + K+ L   + +G+ G +SG+C+     P D ++  F       + ++  L  +   A+ 
Sbjct: 10  VDKNSLDYVVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKH 69

Query: 154 IWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVI 213
           IW ++G RGFF+G                  YE ++       + +S   +L   S   +
Sbjct: 70  IWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLASGS---L 126

Query: 214 AGIVSKTIVFPIDTVRKR 231
           AG+ S  I +P+D  R R
Sbjct: 127 AGLCSVFITYPLDLTRVR 144

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQL 44
           +    LR+   +  +  LVAG LSGI ++    PL+ ++ RLQ+
Sbjct: 236 LERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQV 279

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 139/313 (44%), Gaps = 47/313 (15%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQL---QLANEAQYGGILVTFKRLVRQ-EGV 68
           P+ + +++G  +G    IVT PLD +K+RLQL    L   + Y  +    +R+++   G 
Sbjct: 11  PLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQV----QRIIKDGSGT 66

Query: 69  RALWK-----------GNVPAMAMYI-LYGSTQFTSY------AILNKLLSKSQLPAQIH 110
           + L K           GN  A  +Y  LY  ++   Y      A+ NK ++  ++ + ++
Sbjct: 67  QQLLKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMY 126

Query: 111 TGMVGALSGTCSAIASYPCDVLRTRFIANHSRE-LSTMLSTAQEIWRHEGFRGFFKGXXX 169
               GA SG  +A+ + P  V++TR ++  S +  +++L+    I+  EG + F++G   
Sbjct: 127 LVSAGA-SGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRG-LV 184

Query: 170 XXXXXXXXXXXXXXXYESVKI-FCEQRPDRDSSVIQLLESSASV-IAGIVSKTIVFPIDT 227
                          Y+++K+ +   R D     +  +E+   + ++ ++S + V+P+  
Sbjct: 185 PSLFGVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQL 244

Query: 228 VRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAK 287
           ++   Q    +        +K     +S   TN            G+   Y G    + +
Sbjct: 245 LKTNLQTFRTEH----NENSKMNSLIRSIWHTN------------GIAGFYKGLFANLVR 288

Query: 288 SVPSTVVSLGVYE 300
           ++PST ++ GVYE
Sbjct: 289 AIPSTCITFGVYE 301

>Kwal_33.15446
          Length = 305

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 82/162 (50%), Gaps = 6/162 (3%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQL-ANEAQYGGILVTFKRLVRQEGV 68
           +++P+   +++G L+G S   + AP++  K +LQ+Q  A   +Y G L   K++   +G+
Sbjct: 112 EKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGI 171

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKLL-SKSQLPAQIHTGMVGALSGTCS-AIAS 126
           R ++KG V  + ++  +    + SY +L +   + + L         G  S +      +
Sbjct: 172 RGMYKGLVSTL-IFRTHFVYWWGSYELLTRWFKANTNLSDTAINFWAGGFSASFGFWTTA 230

Query: 127 YPCDVLRTRFIANHSRE--LSTMLSTAQEIWRHEGFRGFFKG 166
           YP DV++   + N   +  L +  + A +IWR  G RGFFKG
Sbjct: 231 YPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKG 272

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/297 (20%), Positives = 114/297 (38%), Gaps = 34/297 (11%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77
            V+G  SGI+   V  P DT+K+RLQ    +  ++ G L    + +RQ+G+R  + G  P
Sbjct: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTS-QDTGRFKGPLDCVYQTMRQQGIRGFYLGFTP 80

Query: 78  AMAMYILYGSTQFTSYAILNKLLSK------SQLPAQIHTGMV--GALSGTCSAIASYPC 129
            +  +IL  S           LL K       +LP    +G +  G L+G   +  + P 
Sbjct: 81  PLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPL---SGCILSGVLAGWSVSFIAAPV 137

Query: 130 DVLRTRFIANHSRELSTM---LSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYE 186
           ++ + +    +  + +     L   ++++  +G RG +KG                  YE
Sbjct: 138 ELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKG-LVSTLIFRTHFVYWWGSYE 196

Query: 187 SVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHT 246
            +  + +   +   + I       S   G    T  +P D ++   QVI           
Sbjct: 197 LLTRWFKANTNLSDTAINFWAGGFSASFGFW--TTAYPSDVIK---QVI---------LC 242

Query: 247 NKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWCL 303
           N  Y      +  ++   A  I    G+   + G+     +S P+   +L  +E+ L
Sbjct: 243 NDKYDG----SLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVL 295

 Score = 32.0 bits (71), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 5/71 (7%)

Query: 101 SKSQLPAQIHTGMVGALSGTCSAIA----SYPCDVLRTRF-IANHSRELSTMLSTAQEIW 155
           S + +P + ++ M+G +SG  S IA     +P D ++ R   +  +      L    +  
Sbjct: 7   SNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTM 66

Query: 156 RHEGFRGFFKG 166
           R +G RGF+ G
Sbjct: 67  RQQGIRGFYLG 77

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 121/292 (41%), Gaps = 33/292 (11%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGV-RALWKG 74
           + ++ G ++G   +++  P DT+K+RLQ Q A+   +       K     EG+ R  ++G
Sbjct: 8   KDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAH--MFPTTWSCIKFTYDNEGLWRGFYQG 65

Query: 75  NVPAMAMYILYGSTQFTSYAILNKLLS-KSQLPAQIHTGMVGALSGTCSAIASYPCDVLR 133
               +A   L  +  F S+    +LL  +S L     T   GA +G C++    P ++++
Sbjct: 66  IGSPLAGAALENAVLFVSFNQAKRLLDVESLLSPLSKTVWAGAFAGACASFVLTPVELIK 125

Query: 134 TRF-IANHSRELST---MLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK 189
            +  ++N S   ++   +L T + +    GF G ++G                  YE VK
Sbjct: 126 CKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVK 185

Query: 190 IF-CEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNK 248
            +   +R    ++  +LL S AS  AG+     +FP DT++   Q           H + 
Sbjct: 186 NYLASRRQAEQNTTWELLASGAS--AGLAFNASIFPADTIKSTMQT---------DHIDL 234

Query: 249 AYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           +    K Y              ++G+   Y G  + + ++VP+       YE
Sbjct: 235 SSATRKIYA-------------RQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 139/300 (46%), Gaps = 35/300 (11%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYG------GILVTFKRLVRQ- 65
           P+ + +++G  +G    ++  PLD  K+RLQL + +  + G       I+ +   L R+ 
Sbjct: 7   PLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTREL 66

Query: 66  -EGVRALWKGNVPAMAMYILYGSTQFTSYAILN---KLLSKSQLPAQIHTGMVGALSGTC 121
             G+     GN  A  +Y  + S +     ++N   ++ +   L + ++     A SG  
Sbjct: 67  YRGLTVNLVGNTIAWGLY--FASYRVAKDYLINYNHRIRNDKDLSSWMYLS-ASASSGML 123

Query: 122 SAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXX 181
           + + + P  V++TR ++  + +L++M    +++ +++G +G +KG               
Sbjct: 124 TTVLTNPLWVIKTRMMSKANSDLTSM-KVLRDLIKNDGVQGLWKGLVPALVGVSQGALHF 182

Query: 182 XXXYESVKIFCEQRPDRDSSVIQLLESSA-SVIAGIVSKTIVFPIDTVRKRYQVIDWQQL 240
              Y+++K     + +RDS  I  LE+ A + ++ ++S + V+P   ++   Q       
Sbjct: 183 TC-YDTLKHKLVLK-NRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQ------- 233

Query: 241 GHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
                   +++A  S      L L+ MI  + GLL  Y G +  + +SVPST ++  +YE
Sbjct: 234 --------SFQA--SENDFKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

>Kwal_26.7653
          Length = 325

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 132/322 (40%), Gaps = 41/322 (12%)

Query: 2   AEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQ--YGGILV 57
           AE      Q+V    S +AG ++   A  VT P++ +K R+QLQ  ++ +AQ  Y   + 
Sbjct: 12  AEADKPAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQ 71

Query: 58  TFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY----AILNKLLSKSQLPAQIHTGM 113
             K + + EG+R L KG   A    I    ++   Y    ++LNK    +  P ++    
Sbjct: 72  ALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVA 131

Query: 114 V----GALSGTCSAIASYPCDVLRTRFIA-------NHSRELSTMLSTAQEIWRHEGFRG 162
           V    GA SG   AI   P  +++TR  +             +++ +    I+R EGF+G
Sbjct: 132 VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG 191

Query: 163 FFKGXXXXXXXXXXXXXXXXXXYESVKIF-CEQRPDRDSSVIQLLESSASVIAGIVSKTI 221
            ++G                  Y + K F  +    ++ + + L+   AS ++G     +
Sbjct: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLV---ASTVSGFGVGVV 248

Query: 222 VFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGY 281
           + P D +  R     + Q G+       YK          L   +  V  EG+ ALY G+
Sbjct: 249 MNPWDVILTRV----YNQKGN------LYKGP--------LDCFVKTVRIEGIGALYKGF 290

Query: 282 TLGIAKSVPSTVVSLGVYEWCL 303
              I +  P T++ L   E  +
Sbjct: 291 EAQIFRIAPHTILCLTFMEQTM 312

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 85/323 (26%), Positives = 125/323 (38%), Gaps = 43/323 (13%)

Query: 3   EDHLRK--GQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ---LANEAQ-YGGIL 56
           E H +K    +V  F S VAG L+   A  VT P D +K R+QLQ    AN A+ Y   +
Sbjct: 7   EKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPI 66

Query: 57  VTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY----AILNKLLSKSQLPAQI-HT 111
             F  + + EG+  L KG   A    I    ++   Y     ILN +   +    ++ H 
Sbjct: 67  QAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHI 126

Query: 112 GM---VGALSGTCSAIASYPCDVLRTRFIA-------NHSRELSTMLSTAQEIWRHEGFR 161
           G+    GA SG   A    P  +++TR  +             ++  +    I+R EG +
Sbjct: 127 GINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIK 186

Query: 162 GFFKGXXXXXXXXXXXXXXXXXXYESVKIF-CEQRPDRDSSVIQLLESSASVIAGIVSKT 220
           G F+G                  Y   K F  +     D + + LL S+   IAG     
Sbjct: 187 GLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSST---IAGFGVGV 243

Query: 221 IVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHG 280
            + P D V  R     + Q G+             Y+    +   +  V  EGL ALY G
Sbjct: 244 AMNPWDVVLTRV----YNQKGN------------LYSGP--IDCFIKTVRNEGLSALYKG 285

Query: 281 YTLGIAKSVPSTVVSLGVYEWCL 303
           +   I +  P TV+ L   E  L
Sbjct: 286 FGAQILRIGPHTVLCLTFMEQTL 308

>Scas_691.4
          Length = 334

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 127/311 (40%), Gaps = 42/311 (13%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA-QYGGILVTFKRLVRQEGVRALWKGN 75
           +LVAG  +G+   +   PLDT+K+R+Q+    E  +  G + T + +   EG  AL+KG 
Sbjct: 16  NLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGL 75

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG---MVGALSGTCSAI-ASYPCDV 131
              +   I   + +F+SY      L+  +    I TG   + G  +G   A+    P +V
Sbjct: 76  GAVVIGIIPKMAIRFSSYEFYRNALTDKET-RTITTGNTFLAGVGAGITEAVLVVNPMEV 134

Query: 132 LRTRFIANHSREL---------------------STMLSTAQEIWRHEGFRGFFKGXXXX 170
           ++ R  A H  +L                     +  +  A  I + EG    ++G    
Sbjct: 135 VKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSLT 194

Query: 171 XXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRK 230
                         Y  +K + ++  +R+ S+     S   +I+G +      P+DT++ 
Sbjct: 195 AARQATNQGANFTVYSYLKDYLQKYHNRE-SLPSWETSCIGLISGAIGPFSNAPLDTIKT 253

Query: 231 RYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVP 290
           R Q            +N A+K  K Y       +   ++++EG  ALY G T  + +  P
Sbjct: 254 RLQKDKSIS------SNSAWK--KIYI------IGTQLIKEEGFRALYKGITPRVMRVAP 299

Query: 291 STVVSLGVYEW 301
              V+  VYE+
Sbjct: 300 GQAVTFTVYEF 310

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 55/103 (53%), Gaps = 5/103 (4%)

Query: 3   EDHLRK---GQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILV 57
           +D+L+K    + +P +++   G +SG       APLDT+K RLQ    +++ + +  I +
Sbjct: 213 KDYLQKYHNRESLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYI 272

Query: 58  TFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
              +L+++EG RAL+KG  P +       +  FT Y  + K L
Sbjct: 273 IGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKHL 315

 Score = 31.6 bits (70), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 37/108 (34%), Gaps = 15/108 (13%)

Query: 194 QRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAY 253
           Q+   D     L+   A   AG+       P+DT++ R Q+    +   P          
Sbjct: 3   QKNPNDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRP---------- 52

Query: 254 KSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
                  F+     I   EG LALY G    +   +P   +    YE+
Sbjct: 53  -----HGFITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSSYEF 95

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 83/172 (48%), Gaps = 26/172 (15%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQL-ANEAQYGGILVTFKRLVRQEGV 68
           +++P+   +++G ++G S   + AP++  K +LQ+Q  A   +Y G +   K++    GV
Sbjct: 154 EKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGV 213

Query: 69  RALWKGNVPAMAM---YILYGSTQFTSYAILNKLLSKSQLPAQIHTGM----VGALSGTC 121
           R L+KG    +     ++ +    + SY +L +   +       HT M    +   SG  
Sbjct: 214 RGLYKGLTSTLIFRTNFVFW----WGSYELLTRWFKE-------HTNMSDTAINFWSGGF 262

Query: 122 SA-----IASYPCDVLRTRFIANHSRE--LSTMLSTAQEIWRHEGFRGFFKG 166
           SA       +YP DV++   + N   +    +    A++IWR  G+RGFFKG
Sbjct: 263 SASFGFWTTAYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKG 314

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 70/160 (43%), Gaps = 15/160 (9%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77
            V+G  SGI+   V  P DT+K+RLQ    +  ++ G L    +   Q+G+R  + G  P
Sbjct: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTS-QDSTRFKGPLDCVYKTFTQQGIRGFYLGFTP 122

Query: 78  AMAMYILYGSTQFTSYAILNKLLSK------SQLPAQIHTGMV--GALSGTCSAIASYPC 129
            +  +IL  S           LL K       +LP    +G +  G ++G   +  + P 
Sbjct: 123 PLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPL---SGCIISGVMAGWSVSFIAAPV 179

Query: 130 DVLRTRFIANHSRELSTM---LSTAQEIWRHEGFRGFFKG 166
           ++ + +    +  + +     +   ++++   G RG +KG
Sbjct: 180 ELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG 219

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/328 (20%), Positives = 129/328 (39%), Gaps = 52/328 (15%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTF----KRLVRQEGVR 69
           + +S +AG +SG  A+ + APLD +KI  Q    +  +Y G L+      K +   +GVR
Sbjct: 33  IVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVR 92

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYA-ILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYP 128
             ++G+   +     Y + +F +Y  I N L+   +  +     + G+L+G CS   +YP
Sbjct: 93  GFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRRLVSGSLAGLCSVFITYP 152

Query: 129 CDVLRTRFIANHSRELSTMLSTAQEIWRHEG----------------FRGFFKGXXXXXX 172
            D++R R       +   +    ++I++                   +  F++G      
Sbjct: 153 LDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVL 212

Query: 173 XXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESS----------------ASVIAG- 215
                       ++ +    +       SV++L E                  A +I+G 
Sbjct: 213 GMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELISGG 272

Query: 216 ---IVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKE 272
              + S+T  +P + +R+R QV           +  + K    +   +   +A +I ++ 
Sbjct: 273 LAGMASQTAAYPFEIIRRRLQV-----------SALSPKTMYDHKFQSISEIAHIIFKER 321

Query: 273 GLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           G+   + G ++G  K  P    S  VYE
Sbjct: 322 GVRGFFVGLSIGYIKVTPMVACSFFVYE 349

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 63.9 bits (154), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 78/171 (45%), Gaps = 22/171 (12%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76
           + +AG ++G  +R V +P + +KI LQ+Q +  A   GI+    ++ ++EGV  L++GN 
Sbjct: 14  AFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNG 73

Query: 77  PAMAMYILYGSTQFTSYAILNK-------LLSKSQLPAQIHTGMVGALSGTCSAIASYPC 129
                   Y + QF  Y    K        + K QL         GAL G  S +A+YP 
Sbjct: 74  LNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQL-LNWQRLSAGALCGGMSVLATYPL 132

Query: 130 DVLRTRF------IANHSRELSTMLSTAQEIW--------RHEGFRGFFKG 166
           D++RTR       +A  S+  +  ++    +W           G RG ++G
Sbjct: 133 DLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRG 183

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 39/93 (41%), Gaps = 16/93 (17%)

Query: 210 ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIV 269
           A  +AG VS+T+V P + V+   QV       + G  N   + YK               
Sbjct: 17  AGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYK--------------- 61

Query: 270 EKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
            +EG+  L+ G  L   +  P + V   VYEWC
Sbjct: 62  -EEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWC 93

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 123/313 (39%), Gaps = 34/313 (10%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA---------Q 51
           M+ D     + +P     ++G ++GIS   V  PLD +K R QL++             +
Sbjct: 1   MSSDS--NAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVER 58

Query: 52  YGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY----AILNKLLSKSQLPA 107
           Y G++   K++V++EG   L++G    M M     +T+F        I   L + ++   
Sbjct: 59  YNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQ 118

Query: 108 QIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGX 167
           +I     GA +G   A    P ++++ R     S  L  M    + I ++EG  G +KG 
Sbjct: 119 KISIA-AGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTI-KNEGIMGLYKGI 176

Query: 168 XXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDT 227
                               V+        +       L + A  I G V   +  P D 
Sbjct: 177 ESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGA--IGGTVGTMLNTPFDV 234

Query: 228 VRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIV-EKEGLLALYHGYTLGIA 286
           V+ R Q +D          + A K Y      N+   +L+++  +EG  ALY G+   + 
Sbjct: 235 VKSRIQSVD--------AVSSAVKKY------NWCLPSLLVIYREEGFRALYKGFVPKVC 280

Query: 287 KSVPSTVVSLGVY 299
           +  P   + L V+
Sbjct: 281 RLAPGGSLMLVVF 293

>Kwal_33.14050
          Length = 314

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 118/316 (37%), Gaps = 43/316 (13%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQ-----LQLANEAQY--GGIL 56
           D+       P+   L AG  +GI    +  P+D +K R+Q     +  AN A      I+
Sbjct: 6   DYESLPTNAPLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIV 65

Query: 57  VTFKRLVRQEGVRALWK-------GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQI 109
               R+   EG  ALWK       G  PA A+Y       F +Y +    L   Q   Q 
Sbjct: 66  QQIARISTTEGSMALWKGVQSVILGAGPAHAVY-------FATYEMCKSYLIDPQ-DFQT 117

Query: 110 HTGMVGALSGTCSAIAS----YPCDVLRTRF-IANHSRELSTMLSTAQEIWRHEGFRGFF 164
           H  +  A SG  + +A+     P D ++ R  +   S++   M S A  I+R+EG   FF
Sbjct: 118 HQPLKTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKD--RMWSVASRIYRNEGLAAFF 175

Query: 165 KGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFP 224
                               YES   F     + +++   L+      I+G     I  P
Sbjct: 176 YSYPTTIAMNIPFAAFNFAIYESATKFF----NPENTYNPLIHCLCGGISGATCAAITTP 231

Query: 225 IDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLG 284
           +D ++   QV   + +  P              +  F R A  I +  G    + G    
Sbjct: 232 LDCIKTVLQVRGSESVVDPLFRQ----------ADTFSRAASAISKVYGWSGFWRGLKPR 281

Query: 285 IAKSVPSTVVSLGVYE 300
           I  ++P+T +S   YE
Sbjct: 282 IISNMPATAISWTAYE 297

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 79/178 (44%), Gaps = 16/178 (8%)

Query: 1   MAEDHLRKGQEVPVFQSL---VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILV 57
           M + +L   Q+    Q L    +G  + ++A ++  P DT+K R+QL+  ++ +   +  
Sbjct: 104 MCKSYLIDPQDFQTHQPLKTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRMWSVA- 162

Query: 58  TFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGAL 117
              R+ R EG+ A +      +AM I + +  F  Y    K  +       +   + G +
Sbjct: 163 --SRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFFNPENTYNPLIHCLCGGI 220

Query: 118 SG-TCSAIASYPCDVLRTRFIANHS--------RELSTMLSTAQEIWRHEGFRGFFKG 166
           SG TC+AI + P D ++T      S        R+  T    A  I +  G+ GF++G
Sbjct: 221 SGATCAAITT-PLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRG 277

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/311 (21%), Positives = 129/311 (41%), Gaps = 53/311 (17%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLVRQEG-VRAL 71
           F+ ++ G ++G   +++  P DT+K+RLQ Q  +     +  I  T+K     EG ++  
Sbjct: 14  FRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYK----NEGIIKGF 69

Query: 72  WKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMV-GALSGTCSAIASYPCD 130
           ++G    +A   +  +  F SY   +K L      + +   ++ GA +G+C++    P +
Sbjct: 70  FQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTNILISGAFAGSCASFVLTPVE 129

Query: 131 VLRTRFIANHSREL--------------STMLSTAQEIWRHEGFRGFFKGXXXXXXXXXX 176
           +++ +   ++ + L              + ++ T Q + ++ GF G ++G          
Sbjct: 130 LIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESF 189

Query: 177 XXXXXXXXYESVKIFCEQRPD-------RDSSVIQLLESSASVIAGIVSKTIVFPIDTVR 229
                   YE +K + + R +        D+   +LL S AS  AG+     +FP DTV+
Sbjct: 190 GGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGAS--AGLAFNASIFPADTVK 247

Query: 230 KRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSV 289
              Q    + LG      K +                  VEK GL   Y G  + + +++
Sbjct: 248 SMMQT---EHLGLKTAIKKIF------------------VEK-GLRGFYRGLGITLIRAI 285

Query: 290 PSTVVSLGVYE 300
           P+      VYE
Sbjct: 286 PANATVFYVYE 296

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/137 (20%), Positives = 53/137 (38%), Gaps = 4/137 (2%)

Query: 105 LPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEG-FRGF 163
           L A     + G+++G    +  YP D ++ R             S     +++EG  +GF
Sbjct: 10  LAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGF 69

Query: 164 FKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVF 223
           F+G                  Y     F +   +  S +  +L S A   AG  +  ++ 
Sbjct: 70  FQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNV-SDLTNILISGA--FAGSCASFVLT 126

Query: 224 PIDTVRKRYQVIDWQQL 240
           P++ ++ + QV + Q L
Sbjct: 127 PVELIKCKLQVSNLQSL 143

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 78/324 (24%), Positives = 124/324 (38%), Gaps = 47/324 (14%)

Query: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ----LANEAQYGGILVT 58
           E      Q+V    S +AG L+   A  VT P + +K R+QLQ      N+  Y      
Sbjct: 12  EHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQA 71

Query: 59  FKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY----AILNKLLSKSQLPAQIHTGMV 114
              + + EGV+ L +G V A    I    ++   Y     +LNK       P ++    V
Sbjct: 72  LGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAV 131

Query: 115 ----GALSGTCSAIASYPCDVLRTRFIA----------NHSRELSTMLSTAQEIWRHEGF 160
               GA SG   AI   P  +++TR  +           H   +S  L+T   I++ EG 
Sbjct: 132 NVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLAT---IFKKEGV 188

Query: 161 RGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRP-DRDSSVIQLLESSASVIAGIVSK 219
            G F+G                  Y + K F  Q    ++ + + LL S+   + G+   
Sbjct: 189 LGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLLSST---VTGLGVG 245

Query: 220 TIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYH 279
            ++ P D V  R     + Q G+          YK      F  + +     EG+ ALY 
Sbjct: 246 IVMNPWDVVLTRV----YNQKGN---------TYKGPIDCMFKTIKI-----EGIGALYK 287

Query: 280 GYTLGIAKSVPSTVVSLGVYEWCL 303
           G+   + +  P T++ L   E  +
Sbjct: 288 GFGAQLFRIAPHTILCLTFMEQTM 311

>Kwal_26.8669
          Length = 296

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 120/304 (39%), Gaps = 23/304 (7%)

Query: 6   LRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLV 63
           +   + +P F    AG ++GIS  +V  PLD +K R+QLQ++     QY G++   K++V
Sbjct: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60

Query: 64  RQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS---QLPAQIHTGMVGALSGT 120
            +EG   L+KG    + M     +T+F       K+  +    +   Q  + + GA +G 
Sbjct: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120

Query: 121 CSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXX 180
           C A    P ++++ R + + S      +   ++I   EG    + G              
Sbjct: 121 CEAFVVVPFELVKIR-LQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAG 179

Query: 181 XXXXYESVK-IFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQ 239
                  V+ +  E +     +   L+  S   I G +   +  P D V+ R Q      
Sbjct: 180 YFGIIFQVRALLPEAKSKSQQTRNDLIAGS---IGGTIGSLMSTPFDVVKSRIQ------ 230

Query: 240 LGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVY 299
                  N A  A  +            I ++EG  ALY G+   + +  P   + L V+
Sbjct: 231 -------NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283

Query: 300 EWCL 303
             C+
Sbjct: 284 TGCM 287

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 64.7 bits (156), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 76/317 (23%), Positives = 125/317 (39%), Gaps = 70/317 (22%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77
           LV+G   G+++     PLD LK RLQ   A+       L +  R VR    R LW+G +P
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQASS------LRSVLREVRT--TRELWRGTLP 63

Query: 78  AM-------AMYI----------LYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGT 120
           +        A+Y+            GS   T  ++L +L S   L       + GALS  
Sbjct: 64  SALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNL-------LTGALSRA 116

Query: 121 CSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXX 180
              + + P  V++ R+ +      + +    + IWR EG RGFFKG              
Sbjct: 117 AVGLVTMPITVIKVRYESTLY-AYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGL 175

Query: 181 XXXXYESVKIFCEQRPDRDSSVI-------QLLESSASVIAGI-------VSKTIVFPID 226
               YE  K   E  P    + +       +L   +++++ G+       ++ T+  P D
Sbjct: 176 YVLLYEQAK---EMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFD 232

Query: 227 TVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIA 286
           T++ R Q+       HP                 F++    IV +E    L+ G +L + 
Sbjct: 233 TIKTRMQLQS-----HP---------------VGFVQTLRHIVCEERARTLFDGLSLRLC 272

Query: 287 KSVPSTVVSLGVYEWCL 303
           +   S  ++ G+YE  L
Sbjct: 273 RKAMSACIAWGIYEELL 289

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 60/137 (43%), Gaps = 18/137 (13%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG 74
           +Q+L+ G LS  +  +VT P+  +K+R +  L     Y G+    + + R EG R  +KG
Sbjct: 105 YQNLLTGALSRAAVGLVTMPITVIKVRYESTL---YAYNGLAEATRHIWRSEGARGFFKG 161

Query: 75  -------NVPAMAMYILY--GSTQFTSYAILNKLLSKSQ-----LPAQIHTGMVGA-LSG 119
                  + P   +Y+L    + +    A+   LL   +      PA      V A LS 
Sbjct: 162 AAATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSA 221

Query: 120 TCSAIASYPCDVLRTRF 136
           + +   + P D ++TR 
Sbjct: 222 SLATTLTAPFDTIKTRM 238

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 126/311 (40%), Gaps = 50/311 (16%)

Query: 8   KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN------EAQYGGILVTFKR 61
           K QE     + + G +S   A+   +P++ +KI +Q Q         + +Y GI+  FKR
Sbjct: 6   KQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKR 65

Query: 62  LVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKL-----LSKSQLPAQIHTGMV-- 114
             +QEG+ + W+GN    A  I Y  TQ  ++A  +K+       K +   +   G +  
Sbjct: 66  TAKQEGLISFWRGNT---ANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLAS 122

Query: 115 GALSGTCSAIASYPCDVLRTRFIAN-------HSRELSTMLSTAQEIWRHEGFRGFFKGX 167
           G  +G  S +  Y  D  RTR  A+        +R+ + +    ++  + +G  G ++G 
Sbjct: 123 GGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGF 182

Query: 168 XXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIV----SKTIVF 223
                            ++S+K         D S +      AS + G V    + T  +
Sbjct: 183 MPSVVGIVVYRGLYFGMFDSLKPLVLT-GSLDGSFL------ASFLLGWVVTTGASTCSY 235

Query: 224 PIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTL 283
           P+DTVR+R  +   Q + + G  +   K                IV  EG+ +L+ G   
Sbjct: 236 PLDTVRRRMMMTSGQAVKYNGAIDCLKK----------------IVASEGVGSLFKGCGA 279

Query: 284 GIAKSVPSTVV 294
            I +SV    V
Sbjct: 280 NILRSVAGAGV 290

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 123/304 (40%), Gaps = 54/304 (17%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLAN------EAQYGGILVTFKRLVRQEGVRA 70
             + G +S   A+   +P++ +K+ +Q Q         + +Y GIL  FKR   QEGV +
Sbjct: 26  DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVIS 85

Query: 71  LWKGNVPAMAMYILYGSTQFTSYAILNKL-----LSKSQLPAQIHTGMV--GALSGTCSA 123
            W+GN    A  I Y  TQ  ++A  +K+       K +  A+   G +  G  +G  S 
Sbjct: 86  FWRGNT---ANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSL 142

Query: 124 IASYPCDVLRTRFIANH-------SRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXX 176
           +  Y  D  RTR  A+        +R+ + ++   ++  + +G  G ++G          
Sbjct: 143 LFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVV 202

Query: 177 XXXXXXXXYESVKIFCEQRPDRDSSVIQLLESS--ASVIAGIV----SKTIVFPIDTVRK 230
                   Y+S+K            +   LE S  AS + G V    + T  +P+DTVR+
Sbjct: 203 YRGLYFGMYDSLKPLL---------LTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRR 253

Query: 231 RYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVP 290
           R  +   Q + + G  +   K                IV  EG+ +L+ G    I + V 
Sbjct: 254 RMMMTSGQAVKYDGAFDCLRK----------------IVAAEGVGSLFKGCGANILRGVA 297

Query: 291 STVV 294
              V
Sbjct: 298 GAGV 301

>Scas_697.47
          Length = 328

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 79/160 (49%), Gaps = 13/160 (8%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           Q   AG +S I   +VTAP + +K+ LQ   AN       +   K +V+  GV++L+KG+
Sbjct: 142 QMAAAGFISAIPTTLVTAPTERIKVVLQTAGANSKT--SFIGAAKNIVKDGGVKSLFKGS 199

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMV--------GALSGTCSAIASY 127
           +  +A      +  F SY I  K L+     A+  TG V        G ++G    +  +
Sbjct: 200 LATLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVF 259

Query: 128 PCDVLRTRFIANHSRELSTMLSTAQEIW-RHEGFRGFFKG 166
           P D ++T+  ++   +  +M++  +EI+ +  G +GFF G
Sbjct: 260 PIDTIKTKLQSSSGSQ--SMVAATREIYVKRGGIKGFFPG 297

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 96/233 (41%), Gaps = 14/233 (6%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYG-GILVTFKRLVRQ-----EGV 68
            +SLVAG + G+ A +   P D +K+R Q   A+   +   I++   R +         V
Sbjct: 37  LKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSV 96

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQ-LPAQIHTGMVGA---LSGTCSAI 124
           +  +KG +P +       +  F  Y +  K++++S    AQ+  G + A   +S   + +
Sbjct: 97  KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFISAIPTTL 156

Query: 125 ASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXX 184
            + P + ++       +   ++ +  A+ I +  G +  FKG                  
Sbjct: 157 VTAPTERIKVVLQTAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYFAS 216

Query: 185 YESVKIFCEQRPDRDSSVIQLLESS----ASVIAGIVSKTIVFPIDTVRKRYQ 233
           YE  K F   R     S    +  +    A  IAG+    +VFPIDT++ + Q
Sbjct: 217 YEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQ 269

 Score = 35.0 bits (79), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 8   KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEG 67
           K  EV +    +AG ++G+S  +V  P+DT+K +LQ    +++    +  T +  V++ G
Sbjct: 234 KTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSSSGSQSM---VAATREIYVKRGG 290

Query: 68  VRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK 102
           ++  + G  PA+       +  F    + + L  K
Sbjct: 291 IKGFFPGLGPALLRSFPANAATFLGVELTHSLFKK 325

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 126/314 (40%), Gaps = 41/314 (13%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQ----YGGILVTFKRLVRQ 65
           Q++  F S VAG L+   A  VT P++ +KIR+QLQ    A     Y   +     + + 
Sbjct: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSY----AILNKLLSKSQLPAQIHTGMV----GAL 117
           EG++ L KG   A    I    ++   Y    + LN+L    Q P ++ +  V    GA 
Sbjct: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAA 137

Query: 118 SGTCSAIASYPCDVLRTR------FIA-NHSRELSTMLSTAQEIWRHEGFRGFFKGXXXX 170
           SG   A+   P  +++TR      FI        + + +    I++ EG +G F+G    
Sbjct: 138 SGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197

Query: 171 XXXXXXXXXXXXXXYESVK-IFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVR 229
                         Y + K I  +    +D   + L   +AS I+G+    ++ P D + 
Sbjct: 198 ILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHL---TASTISGLGVAVVMNPWDVIL 254

Query: 230 KRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSV 289
            R     + Q G        YK          +   +  V  EG+ ALY G+   + +  
Sbjct: 255 TRI----YNQKGD------LYKGP--------IDCLVKTVRIEGVTALYKGFAAQVFRIA 296

Query: 290 PSTVVSLGVYEWCL 303
           P T++ L   E  +
Sbjct: 297 PHTIMCLTFMEQTM 310

>Scas_718.24
          Length = 337

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 125/306 (40%), Gaps = 58/306 (18%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANE--------AQYGGILVTFKRLVRQEGV 68
             + G +S   A+   +P++ +K+ +Q Q  NE         +Y GI+  F+R  +QEG+
Sbjct: 45  DFLMGGVSAAVAKTAASPIERVKLLIQNQ--NEMLKQGTLDTKYKGIVDCFRRTAQQEGI 102

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKL-----LSKSQLPAQIHTGMV--GALSGTC 121
            + W+GN    A  I Y  TQ  ++A  +K+       K     +   G +  G  +G  
Sbjct: 103 ISFWRGNT---ANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGKWFAGNLASGGAAGGL 159

Query: 122 SAIASYPCDVLRTRFIANH-------SRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXX 174
           S +  Y  D  RTR  A+        SR+ + ++   ++  + +G  G ++G        
Sbjct: 160 SLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGI 219

Query: 175 XXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESS--ASVIAGIV----SKTIVFPIDTV 228
                     Y+S+K            +   LE S  AS + G V    + T  +P+DTV
Sbjct: 220 IVYRGLYFGLYDSIKPVL---------LTGSLEGSFLASFLLGWVVTTGASTCSYPLDTV 270

Query: 229 RKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKS 288
           R++  +   Q + + G    A+  +K             IV  EG+ +L+ G    I + 
Sbjct: 271 RRKMMMTSGQAVKYKG----AFDCFKK------------IVAAEGVASLFKGCGANILRG 314

Query: 289 VPSTVV 294
           V    V
Sbjct: 315 VAGAGV 320

>Scas_632.9
          Length = 292

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 125/308 (40%), Gaps = 37/308 (12%)

Query: 4   DH-LRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62
           DH + K         +V G ++G   +I+  P DT+K+RLQ Q ++   +       K  
Sbjct: 6   DHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSH--IFPTTWSCIKYT 63

Query: 63  VRQEGV-RALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK-SQLPAQIHTGMVGALSGT 120
              EGV R  ++G    +    L  +T F SY   + +L K + +    +  + GA +G+
Sbjct: 64  YHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVSPLSNILLSGAFAGS 123

Query: 121 CSAIASYPCDVLRTRF-IANHSREL------STMLSTAQEIWRHEGFRGFFKGXXXXXXX 173
           C++    P ++++ +  ++N    +      + ++ T   + R +G  G ++G       
Sbjct: 124 CASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIR 183

Query: 174 XXXXXXXXXXXYESVKI-FCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRY 232
                      YE +K    ++R D ++   +LL S AS  AG+     +FP DTV+   
Sbjct: 184 ESLGGVAWFATYEVMKQGLKDRRKDTENKTWELLVSGAS--AGLAFNASIFPADTVKSMM 241

Query: 233 QVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPST 292
           Q        H    N   K   +Y                G+   Y G  + + ++VP+ 
Sbjct: 242 QT------EHITLINAVKKVLTTY----------------GITGFYRGLGITLIRAVPAN 279

Query: 293 VVSLGVYE 300
                +YE
Sbjct: 280 ATVFYMYE 287

>Scas_709.9
          Length = 365

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/298 (23%), Positives = 119/298 (39%), Gaps = 31/298 (10%)

Query: 19  VAGCLSGISARIVTAPLDTLKIRLQ---LQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           ++G L+G  + I+  PLD  K RLQ   +Q      Y G+L T   +V  EGVR L+KG 
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALS-GTCSAIASYPCDVLRT 134
           +P +  Y       F+ Y     L  +    +   +    A++ G  S + + P  V++T
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAITAGAASTVLTNPIWVVKT 188

Query: 135 RFIAN----HSR-ELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK 189
           R +       SR      +   ++I   EG R  + G                  YE +K
Sbjct: 189 RLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTG-LVPSMFGLLHVAIHFPVYEKLK 247

Query: 190 --IFCEQRPDRDSSVIQLLESSASVIAGIVSKT----IVFPIDTVRKRYQVIDWQQLGHP 243
             + C+      +S    L  +  +IA   SK     + +P + +R R Q+   + L   
Sbjct: 248 NRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDKLL--- 304

Query: 244 GHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
                        +    L L       EGLL  Y G+   + ++VP++ ++L  +E+
Sbjct: 305 ------------ISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEY 350

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 51/127 (40%), Gaps = 10/127 (7%)

Query: 111 TGMVGALSGTCSAIASYPCDVLRTRFIANHSRELST-----MLSTAQEIWRHEGFRGFFK 165
           T + GAL+G  S I   P DV +TR  A   + +       +L T   I   EG RG +K
Sbjct: 67  TALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYK 126

Query: 166 GXXXXXXXXXXXXXXXXXXYESVK-IFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFP 224
           G                  YE  K ++    P+ D     +  S +++ AG  S  +  P
Sbjct: 127 GLIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDF----ISHSCSAITAGAASTVLTNP 182

Query: 225 IDTVRKR 231
           I  V+ R
Sbjct: 183 IWVVKTR 189

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 84/168 (50%), Gaps = 19/168 (11%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVR 69
            E+ + Q   AG +S I   +VTAP + +K+ LQ      +  G  +   K +V++ G+ 
Sbjct: 137 NELTMGQMAAAGFISAIPTTLVTAPTERVKVVLQ-----TSSKGSFIQAAKTIVKEGGIA 191

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQ----------IHTGMVGALSG 119
           +L+KG++  +A      +  F SY I    L+  Q P Q          ++  + G ++G
Sbjct: 192 SLFKGSLATLARDGPGSALYFASYEISKNYLNSRQ-PRQDAGKDEPVNILNVCLAGGIAG 250

Query: 120 TCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIW-RHEGFRGFFKG 166
               +A +P D ++T+  A+ +R+   MLS  +EI+ +  G +GFF G
Sbjct: 251 MSMWLAVFPIDTIKTKLQASSTRQ--NMLSATKEIYLQRGGIKGFFPG 296

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 94/241 (39%), Gaps = 20/241 (8%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYG--GILVTFKRLVR----QEGVR 69
           +S VAG + G+ A     P D +K+R Q   AN   +    I+   K  V+       V+
Sbjct: 37  KSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVK 96

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKLLS---KSQLPAQIHTGMVGA---LSGTCSA 123
             +KG +P +       +  F  Y +  KL++   K     ++  G + A   +S   + 
Sbjct: 97  GFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPTT 156

Query: 124 IASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXX 183
           + + P +  R + +   S +  + +  A+ I +  G    FKG                 
Sbjct: 157 LVTAPTE--RVKVVLQTSSK-GSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSALYFA 213

Query: 184 XYESVKIFCEQRPDR-----DSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQ 238
            YE  K +   R  R     D  V  L    A  IAG+     VFPIDT++ + Q    +
Sbjct: 214 SYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTR 273

Query: 239 Q 239
           Q
Sbjct: 274 Q 274

 Score = 31.2 bits (69), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 45/95 (47%), Gaps = 3/95 (3%)

Query: 8   KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEG 67
           K + V +    +AG ++G+S  +   P+DT+K +LQ   A+  +   +  T +  +++ G
Sbjct: 233 KDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQ---ASSTRQNMLSATKEIYLQRGG 289

Query: 68  VRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK 102
           ++  + G  PA+       +  F    + + L  K
Sbjct: 290 IKGFFPGLGPALLRSFPANAATFLGVEMTHSLFKK 324

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 116/295 (39%), Gaps = 29/295 (9%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALW 72
           P+   L+AG  +GI    V  P+D +K R+Q   +  A   G++    ++   EG  ALW
Sbjct: 15  PLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQ-GLIKQISKITTAEGSLALW 73

Query: 73  K-------GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAIA 125
           K       G  PA A+Y  + + +F+   +++     +  P  I T + G  + T +   
Sbjct: 74  KGVQSVILGAGPAHAVY--FATYEFSKSKLIDPQDMHTHQP--IKTAISGMAATTVADAL 129

Query: 126 SYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXY 185
             P DV++ R   N +RE  ++    + I+  EGF  F+                    Y
Sbjct: 130 MNPFDVIKQRMQLN-TRE--SVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIY 186

Query: 186 ESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGH 245
           ES   F     + +      +   +  ++G     I  P+D ++   QV      G    
Sbjct: 187 ESATKFMNPSNEYNP----FIHCISGGLSGATCAAITTPLDCIKTVLQV-----RGSETV 237

Query: 246 TNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           +N+  K      +  F R A  I +  G      G    +  ++P+T +S   YE
Sbjct: 238 SNEIMK-----QANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYE 287

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 39/98 (39%), Gaps = 20/98 (20%)

Query: 204 QLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLR 263
           QLL   A   AGI+  +++FP+D ++ R Q                  +     +   ++
Sbjct: 19  QLL---AGAFAGIMEHSVLFPVDAIKTRIQ-----------------SSSSGAATQGLIK 58

Query: 264 LALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
               I   EG LAL+ G    I  + P+  V    YE+
Sbjct: 59  QISKITTAEGSLALWKGVQSVILGAGPAHAVYFATYEF 96

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 46/109 (42%), Gaps = 8/109 (7%)

Query: 2   AEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILV---T 58
           A   +    E   F   ++G LSG +   +T PLD +K  LQ++  +E     I+    T
Sbjct: 189 ATKFMNPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVR-GSETVSNEIMKQANT 247

Query: 59  FKR----LVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS 103
           F+R    + +  G +   +G  P +   +   +  +TSY      L  S
Sbjct: 248 FQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFLVNS 296

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 125/308 (40%), Gaps = 56/308 (18%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQ------LQLANEAQYGGILVTFKRLVRQEGVRA 70
             + G +S   A+   AP++ +K+ +Q       Q + + +Y GIL  FKR    EG+ +
Sbjct: 16  DFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVS 75

Query: 71  LWKGNVPAMAMYILYGSTQFTSYAILNKLLS------KSQLPAQIHTGMV--GALSGTCS 122
            W+GN   +  Y     TQ  ++A  +K+ S      +    A+   G +  G  +G  S
Sbjct: 76  FWRGNTANVLRYF---PTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLS 132

Query: 123 AIASYPCDVLRTRFIAN-------HSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXX 175
            +  Y  D  RTR  A+         R+ + +L   ++  + +G  G ++G         
Sbjct: 133 LLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGII 192

Query: 176 XXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESS--ASVIAGIV----SKTIVFPIDTVR 229
                    Y+S K            +   LE S  AS + G V    + T  +P+DTVR
Sbjct: 193 VYRGLYFGLYDSFKPVL---------LTGALEGSFVASFLLGWVITMGASTASYPLDTVR 243

Query: 230 KRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSV 289
           +R  +   Q + + G  +   K                IV+KEG  +L+ G    I + V
Sbjct: 244 RRMMMTSGQTIKYDGALDCLRK----------------IVQKEGAYSLFKGCGANIFRGV 287

Query: 290 PST-VVSL 296
            +  V+SL
Sbjct: 288 AAAGVISL 295

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 123/305 (40%), Gaps = 50/305 (16%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77
           L+ G   G+ + I+  P D LK RLQ    +          +K L   E    LW+G +P
Sbjct: 11  LIGGFSGGLVSAIILQPFDLLKTRLQQDKTS--------TLWKTLKSIETPSQLWRGALP 62

Query: 78  ---------AMAMYILYGSTQFTSYAILNKLLSKSQLPA-QIHTGMV-GALSGTCSAIAS 126
                    AM + +L    Q  S          S LP   ++  M  GA++   + + +
Sbjct: 63  SCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLIT 122

Query: 127 YPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYE 186
            P  V++ R+ +   +  S   +T+  I+R EG RGFF+G                  Y+
Sbjct: 123 MPITVIKVRYESTLYQYTSLRYATSH-IFRTEGLRGFFRGFGATALRDAPYAGLYMLFYD 181

Query: 187 SVKIFCE----------QRPDRDSSVIQ-LLESSASVIAGIVSKTIVFPIDTVRKRYQVI 235
            +K+                +R S+    L+  S++  A +++ +I  P DTV+ R Q+ 
Sbjct: 182 RMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRMQL- 240

Query: 236 DWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVS 295
                  P         + S+TST +      I  KE +  L+ G +L + +   S  ++
Sbjct: 241 ------EPAK-------FHSFTSTFW-----HIATKESVRNLFAGISLRLTRKAFSAGIA 282

Query: 296 LGVYE 300
            G+YE
Sbjct: 283 WGIYE 287

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 75/173 (43%), Gaps = 23/173 (13%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRA 70
           ++ +++++ +G ++     ++T P+  +K+R +  L    QY  +      + R EG+R 
Sbjct: 101 QLNMYENMFSGAVTRALTGLITMPITVIKVRYESTL---YQYTSLRYATSHIFRTEGLRG 157

Query: 71  LWKG-------NVPAMAMYILYGS-------TQFTSYAILNKLLSKSQLPAQIHTGMVGA 116
            ++G       + P   +Y+L+         T   S  +  KL S ++      T + G+
Sbjct: 158 FFRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVV--KLNSDNRYSTYASTLINGS 215

Query: 117 LSGTCSAIASY---PCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
            + + + IA+    P D ++TR     ++   +  ST   I   E  R  F G
Sbjct: 216 SAFSAAVIATSITAPFDTVKTRMQLEPAK-FHSFTSTFWHIATKESVRNLFAG 267

>Kwal_47.18216
          Length = 333

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 76/337 (22%), Positives = 129/337 (38%), Gaps = 63/337 (18%)

Query: 7   RKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQL--QLANEAQYG-GILVTFKRLV 63
           RK    P   +LVAG  +G+   +   PLDT+K+R+Q+  +   + Q   G + T + + 
Sbjct: 4   RKNSSHPAI-NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62

Query: 64  RQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQ--LPAQIHTGMVGALSGTC 121
            QEG  AL+KG    +   I   + +FTSY     LL+  Q  + +  +T + G  +G  
Sbjct: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGIT 122

Query: 122 SAI-ASYPCDVLRTRFIANHSR---------------------------------ELSTM 147
            A+    P +V++ R  A H R                                 +    
Sbjct: 123 EAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNA 182

Query: 148 LSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLE 207
           +  A  I + EG R  ++G                  Y ++K   ++    D     +L 
Sbjct: 183 IQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTD-----MLP 237

Query: 208 SSASVIAGIVSKTI----VFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLR 263
           S  + + G++S  +      P+DT++ R Q              K     K    +  L 
Sbjct: 238 SWETSLIGLISGALGPFSNAPLDTIKTRLQ--------------KDKSTSKDSGWSRILA 283

Query: 264 LALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           +   ++ +EG  ALY G T  + +  P   V+  VYE
Sbjct: 284 IGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYE 320

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 2/97 (2%)

Query: 12  VPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFKRLVRQEGVR 69
           +P +++ + G +SG       APLDT+K RLQ     + ++ +  IL   ++L+R+EG R
Sbjct: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFR 295

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLP 106
           AL+KG  P +       +  FT Y ++ K L     P
Sbjct: 296 ALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGLTAP 332

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 41/105 (39%), Gaps = 13/105 (12%)

Query: 197 DRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSY 256
           +R +S    +   A   AG+       P+DT++ R Q+  + +    G   +        
Sbjct: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQI--YSRAREQGQRARG------- 53

Query: 257 TSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
               F+  A  I  +EG LALY G    +   +P   +    YE+
Sbjct: 54  ----FIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEF 94

>Scas_640.25
          Length = 306

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 119/309 (38%), Gaps = 27/309 (8%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQL------ANEAQYGG 54
           M+ +H  +   +P     +AG ++GIS  +V  PLD +K R+QLQ+      A+   Y G
Sbjct: 1   MSSNHNTQA-PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKG 59

Query: 55  ILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKL----LSKSQLPAQIH 110
           ++    ++V++EG   ++KG    M M     + +F S     KL        QL  QI 
Sbjct: 60  VIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS 119

Query: 111 TGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXX 170
             + GA +G   A+   P ++++ R + + + +    +   + I + +G +G + G    
Sbjct: 120 V-LSGASAGITEALVIVPFELVKIR-LQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVEST 177

Query: 171 XXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRK 230
                            V+        +       L   A  + G        P D V+ 
Sbjct: 178 VWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDL--CAGFVGGTFGVMFNTPFDVVKS 235

Query: 231 RYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVP 290
           R Q             N+     + Y  T      + I  +EG  ALY G+   + +  P
Sbjct: 236 RIQ----------SDGNEIINGVRKYNWT--WPSVMKIYHEEGFRALYKGFVPKVLRLGP 283

Query: 291 STVVSLGVY 299
              V L V+
Sbjct: 284 GGAVLLVVF 292

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 126/302 (41%), Gaps = 44/302 (14%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQ------LQLANEAQYGGILVTFKRLVRQEGVRA 70
           + + G +S   ++   AP++ +K+ +Q       Q + + +Y GI+  FKR    EGV +
Sbjct: 12  NFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVIS 71

Query: 71  LWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIH------TGMV--GALSGTCS 122
            W+GN    A  I Y  TQ  ++A  +K+ +      ++        G +  G  +G  S
Sbjct: 72  FWRGNT---ANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLASGGAAGGLS 128

Query: 123 AIASYPCDVLRTRFIANH-------SRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXX 175
            +  Y  D  RTR  A+         R+ + ++   ++    +G  G ++G         
Sbjct: 129 LLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIV 188

Query: 176 XXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVI 235
                    Y+S+K       + +SS I       +V  G  + T  +P+DTVR+R  + 
Sbjct: 189 VYRGLYFGMYDSLKPLLLT-GNLESSFIASFLLGWAVTTG--ASTASYPLDTVRRRMMMT 245

Query: 236 DWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPST-VV 294
             Q + + G    A+ A++             IV  EG+ +L+ G    I + V    V+
Sbjct: 246 SGQAVKYDG----AFDAFRK------------IVAAEGVKSLFKGCGANILRGVAGAGVI 289

Query: 295 SL 296
           SL
Sbjct: 290 SL 291

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/312 (22%), Positives = 125/312 (40%), Gaps = 51/312 (16%)

Query: 26  ISARIVTAPLDTLKI----RLQL---------QL------ANEAQYGGILV-TFKRLVRQ 65
           + +R  TAP D +K+    R  L         QL      A+ A+    LV     L RQ
Sbjct: 187 VVSRTCTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQ 246

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLS------KSQLPAQIHTGMVGALSG 119
            G+RA + GN   +       + +F S+ +  ++L+      ++   +++ T + G L G
Sbjct: 247 GGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAGGLGG 306

Query: 120 TCSAIASYPCDVLRTRF----IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXX 175
             +  + YP D L+ R     +    R L  ++ TA++++R  G R F++G         
Sbjct: 307 IMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILGVF 366

Query: 176 XXXXXXXXXYESVKIFCEQR-------PDRDSSVIQLLESSASVIAGIVSKTIVFPIDTV 228
                    + ++K +   R        + +  +  L+       +G V  T+V+PI+ +
Sbjct: 367 PYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPINLL 426

Query: 229 RKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKS 288
           R R Q        HP   +     ++              V++EGL  LY G    +AK 
Sbjct: 427 RTRLQA--QGTYAHPHRYDGFQDVFRK------------TVQREGLPGLYKGLVPTLAKV 472

Query: 289 VPSTVVSLGVYE 300
            P+  +S   YE
Sbjct: 473 CPAVAISYLCYE 484

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 80/176 (45%), Gaps = 23/176 (13%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILV--TFKRLVRQEGV 68
           E+    + VAG L GI A+    P+DTLK R+Q    +    G  L+  T K + R+ G+
Sbjct: 292 ELSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGL 351

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKL----------LSKSQLPAQIHTGMV---- 114
           R  ++G    +     Y +    +++ L +           +S++++   + + +V    
Sbjct: 352 RLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEV---VMSNLVVLPM 408

Query: 115 GALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWR----HEGFRGFFKG 166
           GA SGT  A   YP ++LRTR  A  +          Q+++R     EG  G +KG
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKG 464

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           L  G  SG     V  P++ L+ RLQ Q   A+  +Y G    F++ V++EG+  L+KG 
Sbjct: 406 LPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGL 465

Query: 76  VPAMA 80
           VP +A
Sbjct: 466 VPTLA 470

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 117/294 (39%), Gaps = 36/294 (12%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVR-AL 71
           P++  +V+G + G         LDT+K R Q    N  +Y  ++  ++ +  +EGVR  L
Sbjct: 52  PIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQ-GAPNVKKYRNMISAYRTIWLEEGVRRGL 110

Query: 72  WKGNVPAM-----AMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAIAS 126
           + G + AM     +  I +G+ ++T   ++       Q+   I     G L    S+   
Sbjct: 111 YGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDW----QINDTITHLSAGFLGDFISSFVY 166

Query: 127 YPCDVLRTRF---------IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXX 177
            P +VL+TR                  S + +  + + + EGFR  F G           
Sbjct: 167 VPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPF 226

Query: 178 XXXXXXXYESVKIFC---EQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQV 234
                  YE  +      EQ+  RD  +    E      AG ++  I  P+D V+ R Q 
Sbjct: 227 SALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQT 286

Query: 235 IDWQQLGHPGHTNKAYKAYKSYTS-------TNFLRLALMIV-EKEGLLALYHG 280
              QQ   P  +NK+Y     + +       +N + L+L  V + EG+L  + G
Sbjct: 287 ---QQ--PPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSG 335

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 75/193 (38%), Gaps = 14/193 (7%)

Query: 110 HTGMVGALSGTCSAIASYPCDVLRTRFI-ANHSRELSTMLSTAQEIWRHEGFR-GFFKGX 167
           H  + G + G     A +  D ++TR   A + ++   M+S  + IW  EG R G + G 
Sbjct: 55  HCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGY 114

Query: 168 XXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDT 227
                            YE  K    +    + ++  L   SA  +   +S  +  P + 
Sbjct: 115 MAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHL---SAGFLGDFISSFVYVPSEV 171

Query: 228 VRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAK 287
           ++ R Q+         G  N  +     Y  +N       ++++EG  +L+ GY   +A+
Sbjct: 172 LKTRLQL--------QGRFNNPF-FQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLAR 222

Query: 288 SVPSTVVSLGVYE 300
            +P + +    YE
Sbjct: 223 DLPFSALQFAFYE 235

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ 45
           E+ +   ++ G  +G  A I+T P+D +K R+Q Q
Sbjct: 253 ELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQ 287

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 112/262 (42%), Gaps = 27/262 (10%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           + +  G ++G   +++  P DT+K+RLQ Q A+   Y       +     EG+   WKG 
Sbjct: 9   KDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAH--LYPTTWSCIRSTYTDEGI---WKGF 63

Query: 76  VPAMAMYI----LYGSTQFTSYAILNKLLSK-SQLPAQIHTGMVGALSGTCSAIASYPCD 130
              +A  +    L  +  F S+      L + +QL     T   GA +G C++    P +
Sbjct: 64  YQGIASPLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTKTIYSGAFAGACASFILTPVE 123

Query: 131 VLRTRF-IANHSRELS------TMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXX 183
           +++ +  ++N S  LS      ++  T + + + +G  G ++G                 
Sbjct: 124 LVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFT 183

Query: 184 XYESVKI-FCEQRP-DRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLG 241
            YE +K+ F    P ++++   +LL S AS  AG++    VFP DTV+   Q        
Sbjct: 184 TYEIMKMKFASLHPAEKENHTWELLVSGAS--AGVLFNASVFPADTVKSVCQT------E 235

Query: 242 HPGHTNKAYKAYKSYTSTNFLR 263
           H    N   K  +++  T F R
Sbjct: 236 HVSIVNALKKVLRTHGITGFYR 257

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 85/186 (45%), Gaps = 13/186 (6%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ-----LANEAQYGGILVTFKRLVRQEG 67
           P+ +++ +G  +G  A  +  P++ +K +LQ+      L+   ++  +  T K +++++G
Sbjct: 100 PLTKTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKG 159

Query: 68  VRALWKGNVPAMAMYILYGSTQFTSYAILN-KLLSKSQLPAQIHTG---MVGALSGTCSA 123
           +  LW+G +       L G+  FT+Y I+  K  S      + HT    + GA +G    
Sbjct: 160 LLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFN 219

Query: 124 IASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXX 183
            + +P D +++     H     ++++  +++ R  G  GF++G                 
Sbjct: 220 ASVFPADTVKSVCQTEH----VSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFY 275

Query: 184 XYESVK 189
            YE++K
Sbjct: 276 TYETLK 281

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/180 (18%), Positives = 70/180 (38%), Gaps = 17/180 (9%)

Query: 103 SQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEG-FR 161
           S L + +     G+++G    +  YP D ++ R     +    T  S  +  +  EG ++
Sbjct: 2   SDLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWK 61

Query: 162 GFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSAS-VIAGIVSKT 220
           GF++G                  +      C    D  + +  L ++  S   AG  +  
Sbjct: 62  GFYQGIASPLFGAALENAVLFVSFNQ----CTNFLDEFTQLKPLTKTIYSGAFAGACASF 117

Query: 221 IVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHG 280
           I+ P++ V+ + QV           +N +    ++   T+       +++++GLL L+ G
Sbjct: 118 ILTPVELVKCKLQV-----------SNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQG 166

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 72/308 (23%), Positives = 127/308 (41%), Gaps = 45/308 (14%)

Query: 13  PVFQSL-------VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQ 65
           P+F SL       VAGC   I A IV  P+D +K R+Q Q  + +QY   +  F +++ +
Sbjct: 539 PIFDSLYNFSLGSVAGC---IGATIVY-PIDFVKTRMQAQ-RSLSQYKNSIDCFLKILSR 593

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAIL-NKLLSKSQLPAQIHTGMVGALSGTCSAI 124
           EG+R ++ G  P +       + + T    + NKL  K+     +   + GA +G C  I
Sbjct: 594 EGIRGVYSGLGPQLIGVAPEKAIKLTVNDYMRNKLKDKNGKLGLLSEIISGASAGACQVI 653

Query: 125 ASYPCDVLRTR------FIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXX 178
            + P ++++ R      ++A ++        TA +I +  G  G +KG            
Sbjct: 654 FTNPLEIVKIRLQVKGEYVAENAENAKL---TALQIIKRLGLPGLYKGAAACLLRDVPFS 710

Query: 179 XXXXXXYESVK--IFCEQRPDRDS----SVIQLLESSASVIAGIVSKTIVFPIDTVRKRY 232
                 Y  +K  +F     D++     +  +LL  SA  +AG+ +  +  P D ++ R 
Sbjct: 711 AIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELL--SAGALAGMPAAYLTTPFDVIKTRL 768

Query: 233 QVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPST 292
           Q+        P      YK          +  A  I+ +E   + + G    + +S P  
Sbjct: 769 QI-------DPKKGETIYKG--------IIHAARTILREESFKSFFKGGAARVLRSSPQF 813

Query: 293 VVSLGVYE 300
             +L  YE
Sbjct: 814 GFTLAAYE 821

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 46/182 (25%), Positives = 93/182 (51%), Gaps = 21/182 (11%)

Query: 4   DHLR-----KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ---LANEAQYGGI 55
           D++R     K  ++ +   +++G  +G    I T PL+ +KIRLQ++   +A  A+   +
Sbjct: 622 DYMRNKLKDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKL 681

Query: 56  LVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL-----SKSQLPAQIH 110
             T  +++++ G+  L+KG    +   + + +  F +YA L + L     +     ++++
Sbjct: 682 --TALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLN 739

Query: 111 TGMV---GALSGTCSAIASYPCDVLRTRFIANHSRELST---MLSTAQEIWRHEGFRGFF 164
           T  +   GAL+G  +A  + P DV++TR   +  +  +    ++  A+ I R E F+ FF
Sbjct: 740 TWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFF 799

Query: 165 KG 166
           KG
Sbjct: 800 KG 801

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 8   KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ-LANEAQYGGILVTFKRLVRQE 66
           K   +  ++ L AG L+G+ A  +T P D +K RLQ+     E  Y GI+   + ++R+E
Sbjct: 734 KRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREE 793

Query: 67  GVRALWKGNVPAMAMYILYGSTQF 90
             ++ +KG     A  +L  S QF
Sbjct: 794 SFKSFFKGG----AARVLRSSPQF 813

 Score = 34.7 bits (78), Expect = 0.092,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 40/97 (41%), Gaps = 17/97 (17%)

Query: 205 LLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRL 264
           L   S   +AG +  TIV+PID V+ R Q              ++   YK     N +  
Sbjct: 544 LYNFSLGSVAGCIGATIVYPIDFVKTRMQ------------AQRSLSQYK-----NSIDC 586

Query: 265 ALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
            L I+ +EG+  +Y G    +    P   + L V ++
Sbjct: 587 FLKILSREGIRGVYSGLGPQLIGVAPEKAIKLTVNDY 623

>Scas_562.12
          Length = 300

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 75/159 (47%), Gaps = 19/159 (11%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG- 74
           +S  AG L GI   IV  PLD LKI+ Q    N   + G    F ++++ EG+  L++G 
Sbjct: 121 RSATAGSLIGI-GEIVLLPLDVLKIKRQ---TNPEAFKG--RGFVKILKDEGIFNLYRGW 174

Query: 75  ------NVPAMAMYILYGSTQFTSYAILN-KLLSKSQLPAQIHTGMVGALSGTCSAIASY 127
                 N P    + L+G   F    IL  +  S++       + +VGA   +CS I S 
Sbjct: 175 GWTAARNAPGS--FALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGA---SCSLIVSA 229

Query: 128 PCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           P DV++TR          T L+  +  +++EG   FFKG
Sbjct: 230 PLDVIKTRIQNRSFDNPETGLTIVKNTFKNEGITAFFKG 268

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 5/87 (5%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           Q+ ++  +    + IV+APLD +K R+Q +  +  + G  L   K   + EG+ A +KG 
Sbjct: 212 QNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETG--LTIVKNTFKNEGITAFFKGL 269

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLSK 102
            P +   +  G     S+A+   L+ K
Sbjct: 270 TPKL---LTTGPKLVFSFALAQSLIPK 293

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 127/309 (41%), Gaps = 57/309 (18%)

Query: 32  TAPLDTLKIRLQLQLANEAQ-----------YGGILVTFKRLV-------RQEGVRALWK 73
           T P D +K RLQ  + + A            Y G L+ F+  V        QEG R+L+K
Sbjct: 67  TCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQG-LMHFRETVGIIQNVYTQEGFRSLFK 125

Query: 74  GNVPAMAMYILYGSTQFTSYAIL----NKLLSKSQLPAQIHTGMVGALSGTCSAIASYPC 129
           G  P +   I   S  F +Y +     ++LL+  Q    IH  + GA +G  ++ A+ P 
Sbjct: 126 GLGPNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIHF-LAGATAGWATSTATNPI 184

Query: 130 DVLRTRFIAN-----HSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXX 184
            +++TR   +      SR         + + R+EG  G +KG                  
Sbjct: 185 WLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESILQWVL- 243

Query: 185 YESVKIFCEQR---------PDRDSSVIQLLE----SSASVIAGIVSKTIVFPIDTVRKR 231
           YE +K    QR          +  ++ +++ E    S ++  A + +  + +P + VR R
Sbjct: 244 YEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVRTR 303

Query: 232 YQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPS 291
            +              +A K       T   +   +I+++EG  ++Y G T  + ++VP+
Sbjct: 304 LR--------------QAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPN 349

Query: 292 TVVSLGVYE 300
           +++  G +E
Sbjct: 350 SIIMFGTWE 358

 Score = 31.6 bits (70), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 28  ARIVTAPLDTLKIRLQLQLANEA---QYGGILVTFKRLVRQEGVRALWKGNVPAMAMYIL 84
           A I+T P + ++ RL+ Q   E    +Y G+  +F  ++++EG  +++ G  P +   + 
Sbjct: 290 ASILTYPHEVVRTRLR-QAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVP 348

Query: 85  YGSTQFTSYAILNKLLS 101
                F ++ ++ KLL+
Sbjct: 349 NSIIMFGTWELVIKLLA 365

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/337 (20%), Positives = 128/337 (37%), Gaps = 78/337 (23%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQY----GGILVTFKRLVRQEGVR 69
           + +S +AG ++G  A+ + APLD +KI  Q      AQ+    GG++   K ++  +G R
Sbjct: 19  IVKSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPR 78

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG-----MVGALSGTCSAI 124
             ++G+   +     Y + +F +Y  +  ++    +P   H       + G+L+G CS  
Sbjct: 79  GFFQGHSATLLRIFPYAAIKFIAYEQIRSVV----IPTWRHESHWRRLLSGSLAGLCSVF 134

Query: 125 ASYPCDVLRTRF---IANHSRELSTMLSTAQEIWRHEGFR------------GFFKGXXX 169
            +YP D++R R       H  ++  +++        E  R             F++G   
Sbjct: 135 VTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRG--- 191

Query: 170 XXXXXXXXXXXXXXXYESVKIF----CE---QRP----------------DRDSSVIQLL 206
                          Y  V  F    C+   + P                DR   +    
Sbjct: 192 -----YTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWA 246

Query: 207 ESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFL---R 263
           +  A  +AG+ S+T  +P + +R+R QV                 A    T  +F+    
Sbjct: 247 QLVAGGLAGMASQTAAYPFEIIRRRLQV----------------SAITDPTRRHFVGINE 290

Query: 264 LALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           +A +I  + G    + G ++G  K  P    S  +YE
Sbjct: 291 IAKIIYTEGGWRGFFVGLSIGYIKVTPMVACSFFIYE 327

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 81/209 (38%), Gaps = 12/209 (5%)

Query: 100 LSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRF------IANHSRELSTMLSTAQE 153
           + KS +   + +G+ G ++G+C+     P D ++  F       A  +  +  ++  ++ 
Sbjct: 11  VDKSSVDYIVKSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKY 70

Query: 154 IWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVI 213
           I  H+G RGFF+G                  YE ++         +S   +LL  S   +
Sbjct: 71  IMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRLLSGS---L 127

Query: 214 AGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEG 273
           AG+ S  + +P+D VR R   +  +   H     K      +   +  LR   +      
Sbjct: 128 AGLCSVFVTYPLDLVRVRLAYVTER---HDAKVRKIMACIYNERPSEALRKWYIPQWFAH 184

Query: 274 LLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
               Y GYT  +   +P   VS   ++ C
Sbjct: 185 WSNFYRGYTPTVIGMIPYAGVSFFAHDLC 213

>Kwal_47.17321
          Length = 881

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 126/307 (41%), Gaps = 44/307 (14%)

Query: 13  PVFQSL-------VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQ 65
           P+F S+       VAGC+   +      P+D +K R+Q Q  N +QY   +  F ++  +
Sbjct: 496 PIFDSIYNFLLGSVAGCIGATAV----YPIDLVKTRMQAQ-RNFSQYKNSIDCFVKIFSR 550

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL----SKSQLPAQIHTGMVGALSGTC 121
           EG+R ++ G  P +       + + T    + KLL    ++  LP +I   + GA +G C
Sbjct: 551 EGIRGIYSGLGPQLVGVAPEKAIKLTVNDYVRKLLMDENNRLTLPLEI---ISGAAAGAC 607

Query: 122 SAIASYPCDVLRTRFI--ANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXX 179
             I + P ++++ R    + ++  L     TA  + +  G RG +KG             
Sbjct: 608 QVIFTNPLEIVKIRLQVRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSA 667

Query: 180 XXXXXYESVK--IFCEQRPDRDSSVI----QLLESSASVIAGIVSKTIVFPIDTVRKRYQ 233
                Y  +K  IF     D++        +LL  +A  +AG+ +  +  P D ++ R Q
Sbjct: 668 IYFPTYAHLKRDIFNYDPQDKNKRARLHTWELL--TAGGLAGMPAAYLTTPFDVIKTRLQ 725

Query: 234 VIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTV 293
           +        P      Y        T  L  A  I+++E   + + G    + +S P   
Sbjct: 726 I-------DPRKGETRY--------TGILHAARTILKEERFKSFFKGGGARVLRSSPQFG 770

Query: 294 VSLGVYE 300
            +L  YE
Sbjct: 771 FTLAAYE 777

>Scas_721.27
          Length = 374

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 130/316 (41%), Gaps = 61/316 (19%)

Query: 30  IVTAPLDTLKIRLQLQL--------------ANEAQYGGILVT----FKR-------LVR 64
           +VT P D +K RLQ  +              A+ ++    LV     FK        + +
Sbjct: 68  VVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYK 127

Query: 65  QEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS----QLPAQIHTGMVGALSGT 120
           +EG R+L+KG  P +   I   S  F +Y    ++ SK+    Q    IH  M  A +G 
Sbjct: 128 REGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHL-MSAATAGW 186

Query: 121 CSAIASYPCDVLRTRF---IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXX 177
            ++ A+ P  +++TR     A  +R+        + + + EG  G ++G           
Sbjct: 187 ATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLGSIEG 246

Query: 178 XXXXXXXYESVKIFCEQR------------PDRDSSVIQLLESSASV-IAGIVSKTIVFP 224
                  YE +K   +QR              R   + +  + S S  +A  ++  + +P
Sbjct: 247 ILQWLL-YEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYP 305

Query: 225 IDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLG 284
            + VR R + +  +  G P +T               ++   +I+++EGL ++Y G T  
Sbjct: 306 HEVVRTRLRQMPMEN-GKPKYTG-------------LVQSFRVIIKEEGLASMYSGLTPH 351

Query: 285 IAKSVPSTVVSLGVYE 300
           + ++VP++++  G +E
Sbjct: 352 LMRTVPNSIIMFGTWE 367

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 46/76 (60%), Gaps = 2/76 (2%)

Query: 28  ARIVTAPLDTLKIRL-QLQLAN-EAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILY 85
           A IVT P + ++ RL Q+ + N + +Y G++ +F+ ++++EG+ +++ G  P +   +  
Sbjct: 299 ASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPN 358

Query: 86  GSTQFTSYAILNKLLS 101
               F ++ ++ +LLS
Sbjct: 359 SIIMFGTWELVIRLLS 374

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 126/307 (41%), Gaps = 55/307 (17%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQ------LQLANEAQYGGILVTFKRLVRQEGVRA 70
             + G +S   A+   +P++ +K+ +Q       Q + + +Y GI+  F+R  RQEG+ +
Sbjct: 14  DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIIS 73

Query: 71  LWKGNVPAMAMYILYGSTQFTSYAILNKL-----LSKSQLPAQIHTGMV--GALSGTCSA 123
            W+GN    A  I Y  TQ  ++A  +++       K +  A+   G +  G ++G  S 
Sbjct: 74  FWRGNT---ANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAGNLASGGIAGGLSL 130

Query: 124 IASYPCDVLRTRFIAN-------HSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXX 176
           +  Y  D  RTR  A+         R+ + ++   ++    +G  G ++G          
Sbjct: 131 MFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVV 190

Query: 177 XXXXXXXXYESVKIFCEQRPDRDSSVIQLLESS--ASVIAGIV----SKTIVFPIDTVRK 230
                   Y+S K            +   LE S  AS + G V    + T  +P+DTVR+
Sbjct: 191 YRGLYFGLYDSCKPLL---------LTGSLEGSFIASFLLGWVVTTGASTASYPLDTVRR 241

Query: 231 RYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVP 290
           R  +   Q + + G  +   K                IV  EG+ +L+ G    I + V 
Sbjct: 242 RMMMTSGQAVKYKGAMDCLQK----------------IVAAEGVSSLFKGCGANILRGVA 285

Query: 291 ST-VVSL 296
              V+SL
Sbjct: 286 GAGVISL 292

>Kwal_27.12481
          Length = 304

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 118/298 (39%), Gaps = 42/298 (14%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQ------LQLANEAQYGGILVTFKRLVRQEGVRA 70
             + G +S   ++   AP++ +K+ +Q       Q + + +Y GI   FKR    EG+ +
Sbjct: 13  DFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEGIAS 72

Query: 71  LWKGNVPAMAMYILYGSTQFTSYAILNKL-----LSKSQLPAQIHTGMV--GALSGTCSA 123
            W+GN    A  I Y  TQ  ++A  +K+       K +  A+   G +  G  +G  S 
Sbjct: 73  FWRGNT---ANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGGLSL 129

Query: 124 IASYPCDVLRTRFIANH-------SRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXX 176
           +  Y  D  RTR  A+         R+ + ++   ++    +G  G ++G          
Sbjct: 130 MFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVV 189

Query: 177 XXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVID 236
                   Y+S+K          S +   L   A       + T  +P+DTVR+R  +  
Sbjct: 190 YRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAVTTG---ASTASYPLDTVRRRMMMTS 246

Query: 237 WQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVV 294
            Q + +    N A+ A++             IV  EG+ +L+ G    I + V    V
Sbjct: 247 GQAVKY----NGAFDAFRK------------IVAAEGIKSLFKGCGANILRGVAGAGV 288

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 82/171 (47%), Gaps = 16/171 (9%)

Query: 7   RKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLA--NEAQYGGILVTFKRLVR 64
           +K   +P+ Q  + G   G+    + AP++ ++IRLQ Q +  NE Q+ G     K+L +
Sbjct: 119 QKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK 178

Query: 65  QEGVRALWKGNVPAMAMYILYGSTQFTSYAIL-----NKLLSKSQLPAQIHTGMVGALSG 119
               +AL +G +P M        T F +Y  L      K   ++Q+PA       GALSG
Sbjct: 179 ---AKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSF-GALSG 234

Query: 120 TCSAIASYPCD----VLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           T   +  YP D    VL+T  I N   + ++++   + +++  G   FFKG
Sbjct: 235 TILWLTVYPVDVVKSVLQTDSIENPKYK-NSIIKATRALYKQHGIPAFFKG 284

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/306 (18%), Positives = 118/306 (38%), Gaps = 40/306 (13%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73
           V + + AG + G++  +V  P DT K+RLQ          G++   + L+R EG  A +K
Sbjct: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI----GVIEVVQNLLRNEGALAFYK 81

Query: 74  GNVPAMAMYILYGSTQFTSYAILNKLLS---------KSQLPAQIHT-GMVGALSGTCSA 123
           G +  +    +  S QF     + +  +         +  +P  +H   + G   G  ++
Sbjct: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141

Query: 124 IASYPCDVLRTRFIANHS----RELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXX 179
             + P + +R R     S    R+        +++ +    +   +G             
Sbjct: 142 FLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLG 198

Query: 180 XXXXXYES--VKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDW 237
                YE+  VK F +  P       +L   S   ++G +    V+P+D V+    V+  
Sbjct: 199 TYFAAYEALVVKEFEKGTPRNQIPAWKL--CSFGALSGTILWLTVYPVDVVK---SVLQT 253

Query: 238 QQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLG 297
             + +P + N   KA ++            + ++ G+ A + G+   + ++ P+   +  
Sbjct: 254 DSIENPKYKNSIIKATRA------------LYKQHGIPAFFKGFVPTMIRAAPANAATFV 301

Query: 298 VYEWCL 303
            +E  +
Sbjct: 302 SFEMTM 307

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 1/92 (1%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKR-LVRQEGV 68
            ++P ++    G LSG    +   P+D +K  LQ       +Y   ++   R L +Q G+
Sbjct: 219 NQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGI 278

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
            A +KG VP M       +  F S+ +  ++L
Sbjct: 279 PAFFKGFVPTMIRAAPANAATFVSFEMTMRVL 310

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 124/312 (39%), Gaps = 57/312 (18%)

Query: 30  IVTAPLDTLKIRLQ---LQLANEAQYGGI-----------LVTFKR-------LVRQEGV 68
           +VT P D +K RLQ    Q A ++    I           +  FK        + R EG 
Sbjct: 68  VVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGF 127

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYA----ILNKLLSKSQLPAQIHTGMVGALSGTCSAI 124
           R+L+KG  P +   I   S  F +Y     I +K L+  Q    IH  M  A +G  ++ 
Sbjct: 128 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIHL-MAAATAGWATST 186

Query: 125 ASYPCDVLRTRF---IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXX 181
           A+ P  +++TR     A  +++        + + + EG  G +KG               
Sbjct: 187 ATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVEGILQW 246

Query: 182 XXXYESVKIFCEQRPDRDSSVIQLLESSASV-------------IAGIVSKTIVFPIDTV 228
              YE +K   +QR       I  +E S S              +A  V+  I +P + V
Sbjct: 247 VL-YEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVV 305

Query: 229 RKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKS 288
           R R +              +A         T  ++   +I+++EGL ++Y G T  + ++
Sbjct: 306 RTRLR--------------QAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRT 351

Query: 289 VPSTVVSLGVYE 300
           VP++++  G +E
Sbjct: 352 VPNSIIMFGTWE 363

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 46/81 (56%), Gaps = 2/81 (2%)

Query: 23  LSGISARIVTAPLDTLKIRL-QLQLAN-EAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           L+   A I+T P + ++ RL Q  L N + +Y G++ + + ++++EG+ +++ G  P + 
Sbjct: 290 LAKFVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLL 349

Query: 81  MYILYGSTQFTSYAILNKLLS 101
             +      F ++ ++ +LLS
Sbjct: 350 RTVPNSIIMFGTWELVIRLLS 370

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 79/161 (49%), Gaps = 14/161 (8%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLVRQEGVRALWK 73
           Q  + G   G++   + +P++ ++IRLQ Q  +  +A++ G +   K+L  Q+G   L +
Sbjct: 122 QYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKG---LMR 178

Query: 74  GNVPAMAMYILYGSTQFTSYAIL-----NKLLSKSQLPAQIHTGMVGALSGTCSAIASYP 128
           G +P M        T F  Y  L     N+ L ++++P      + GALSGT   +  YP
Sbjct: 179 GLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPW-KLCLYGALSGTALWLMVYP 237

Query: 129 CDVLRTRFIA---NHSRELSTMLSTAQEIWRHEGFRGFFKG 166
            DV+++       N  +    M+  A+ ++  EG + FFKG
Sbjct: 238 IDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKG 278

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 8   KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKR-LVRQE 66
           K  E+P ++  + G LSG +  ++  P+D +K  +Q    N+ Q G  ++   R L  +E
Sbjct: 211 KRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYARE 270

Query: 67  GVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLS 101
           G++A +KG  P M          F ++ +  +LL 
Sbjct: 271 GLKAFFKGFGPTMLRAAPANGGTFATFELAMRLLG 305

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/308 (17%), Positives = 108/308 (35%), Gaps = 28/308 (9%)

Query: 3   EDHLRKGQEVP-VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKR 61
           EDH   GQ+   V + L+AG   GI+  ++  P DT K+RLQ      +         K 
Sbjct: 15  EDH--PGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAA----EVVKN 68

Query: 62  LVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG-----MVGA 116
           L++ EG +  +KG +  +       S QF     + +      +            + G 
Sbjct: 69  LLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGL 128

Query: 117 LSGTCSAIASYPCDVLRTRF-IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXX 175
             G  ++  + P + +R R      S   +        I +    +G  +G         
Sbjct: 129 TGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLMRGLIPTMLREG 188

Query: 176 XXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVI 235
                    YE++      +  + + +          ++G     +V+PID V+   Q  
Sbjct: 189 HGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTD 248

Query: 236 DWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVS 295
           +                 K     N +++A  +  +EGL A + G+   + ++ P+   +
Sbjct: 249 NLN---------------KPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGT 293

Query: 296 LGVYEWCL 303
              +E  +
Sbjct: 294 FATFELAM 301

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 67/312 (21%), Positives = 116/312 (37%), Gaps = 34/312 (10%)

Query: 6   LRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQ 65
           + + ++V   +S +AGCL+G     VT P +  K RLQL           LV      + 
Sbjct: 1   MSQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKT 60

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQL-----PAQIHTGMVGALSGT 120
           +G+ +++ G    +         +F  +  +  LL   +      P  +  G+   L   
Sbjct: 61  QGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVIAGLGAGL--L 118

Query: 121 CSAIASYPCDVLRTRFIAN-------HSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXX 173
            S +A  P + ++T  I +       +      ML     + R +G  G ++G       
Sbjct: 119 ESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMR 178

Query: 174 XXXXXXXXXXXYESVKIFCEQRPD--RDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKR 231
                      Y  +K+  +   +  +D  +   L       +GIV+     PIDTV+ R
Sbjct: 179 QAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTR 238

Query: 232 YQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPS 291
            Q +D                 K Y+ST  +     I ++EGL A + G T  + +   S
Sbjct: 239 MQSLDS----------------KRYSST--INCFTTIFKEEGLKAFWKGATPRLGRLFLS 280

Query: 292 TVVSLGVYEWCL 303
             +   VYE  L
Sbjct: 281 GGIVFTVYEKVL 292

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 1   MAEDHLRKGQEVPVFQSL--VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVT 58
           M +D+    ++ P+   L  V G  SGI     T P+DT+K R+Q    +  +Y   +  
Sbjct: 196 MVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQS--LDSKRYSSTINC 253

Query: 59  FKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY 93
           F  + ++EG++A WKG  P +    L G   FT Y
Sbjct: 254 FTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVY 288

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 60.5 bits (145), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 83/175 (47%), Gaps = 20/175 (11%)

Query: 8   KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILV-----TFKRL 62
           K  ++ +F  +++G  +G    I T PL+ +KIRLQ+Q    + Y G  +     T  ++
Sbjct: 618 KNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQ----SDYVGENIQQANETATQI 673

Query: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMV-------- 114
           V++ G+R L+ G    +   + + +  F +YA L K L       +     +        
Sbjct: 674 VKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTA 733

Query: 115 GALSGTCSAIASYPCDVLRTRFIANHSR---ELSTMLSTAQEIWRHEGFRGFFKG 166
           GA++G  +A  + P DV++TR   +  +   + + +    + I + E FR FFKG
Sbjct: 734 GAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKG 788

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 121/301 (40%), Gaps = 31/301 (10%)

Query: 13  PVFQSLVA---GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVR 69
           P+F SL     G ++G     V  P+D +K R+Q Q +  AQY   +    +++ +EG++
Sbjct: 526 PIFDSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRS-LAQYKNSIDCLLKIISREGIK 584

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAIL-NKLLSKSQLPAQIHTGMVGALSGTCSAIASYP 128
            L+ G  P +       + + T    + N+L  K+   +     + GA +G C  I + P
Sbjct: 585 GLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTNP 644

Query: 129 CDVLRTRFIANHS---RELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXY 185
            ++++ R           +     TA +I +  G RG + G                  Y
Sbjct: 645 LEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTY 704

Query: 186 ESVKIFCEQRPDRDSSVIQLLES----SASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLG 241
             +K         D +    L++    +A  IAG+ +  +  P D ++ R Q ID ++  
Sbjct: 705 AHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQ-IDPRK-- 761

Query: 242 HPGHT--NKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVY 299
             G T  N  + A ++            I+++E   + + G    + +S P    +L  Y
Sbjct: 762 --GETKYNGIFHAIRT------------ILKEESFRSFFKGGGARVLRSSPQFGFTLAAY 807

Query: 300 E 300
           E
Sbjct: 808 E 808

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 40/97 (41%), Gaps = 17/97 (17%)

Query: 205 LLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRL 264
           L   S   IAG +  T+V+PID ++ R Q              ++   YK     N +  
Sbjct: 531 LYNFSLGSIAGCIGATVVYPIDFIKTRMQA------------QRSLAQYK-----NSIDC 573

Query: 265 ALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
            L I+ +EG+  LY G    +    P   + L V ++
Sbjct: 574 LLKIISREGIKGLYSGLGPQLIGVAPEKAIKLTVNDF 610

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 96/226 (42%), Gaps = 26/226 (11%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           G  +GI A +VT PLD  K+RLQ   A       +    + ++  EGV  L+ G   A+ 
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQ---AAPMPKPTLFRMLESILANEGVVGLYSGLSAAVL 76

Query: 81  MYILYGSTQFTSYAILNK-LLSKSQ-------LPAQIHTGMVGALSGTCSAIASYPCDVL 132
               Y + +F +Y +L + ++ + Q       LP  + +G +G L+G  +       DV+
Sbjct: 77  RQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFA-------DVV 129

Query: 133 RTR------FIANHSRELSTMLSTAQEIWRHE-GFRGFFKGXXXXXXXXXXXXXXXXXXY 185
             R        A   R     +    +I+R+E G +  F G                  Y
Sbjct: 130 NIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTY 189

Query: 186 ESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKR 231
           +  K +   + D D+S       +AS++AG+V+ T+  P D ++ R
Sbjct: 190 DVFKNYLVTKLDFDASK-NYTHLTASLLAGLVATTVCSPADVMKTR 234

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG 74
           +  L A  L+G+ A  V +P D +K R+   +     +   L      VR+EG   +++G
Sbjct: 208 YTHLTASLLAGLVATTVCSPADVMKTRI---MNGSGDHQPALKILADAVRKEGPSFMFRG 264

Query: 75  NVPA 78
            +P+
Sbjct: 265 WLPS 268

>Scas_667.4
          Length = 308

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 125/304 (41%), Gaps = 54/304 (17%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQ------LQLANEAQYGGILVTFKRLVRQEGVRA 70
             + G +S   A+   +P++ +K+ +Q       Q + +++Y GI+  F+R  + EG+ A
Sbjct: 16  DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEGIIA 75

Query: 71  LWKGNVPAMAMYILYGSTQFTSYAILNKL-----LSKSQLPAQIHTGMV--GALSGTCSA 123
            W+GN    A  I Y  TQ  ++A  +K+       K +   +   G +  G  +G  S 
Sbjct: 76  FWRGNT---ANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAGNLASGGAAGGLSL 132

Query: 124 IASYPCDVLRTRFIAN-------HSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXX 176
           +  Y  D  RTR  A+        SR+   ++   ++    +G  G ++G          
Sbjct: 133 LFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVVGIIV 192

Query: 177 XXXXXXXXYESVKIFCEQRPDRDSSVIQLLESS--ASVIAGIV----SKTIVFPIDTVRK 230
                   Y+S+K          + +   LE S  AS + G +    + T  +P+DTVR+
Sbjct: 193 YRGLYFGLYDSLK---------PAVLTGSLEGSFLASFLLGWIVTTGASTASYPLDTVRR 243

Query: 231 RYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVP 290
           R  +   Q + + G    A+  ++             +V  EG+ +L+ G    I + V 
Sbjct: 244 RMMMTSGQAVKYDG----AFDCFRK------------VVAAEGVSSLFKGCGANILRGVA 287

Query: 291 STVV 294
              V
Sbjct: 288 GAGV 291

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 123/298 (41%), Gaps = 27/298 (9%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA--QYGGILVTFKRLVRQEG 67
           + +P     +AG ++G+S  +V  PLD +K  +QLQ++  +  QY G+    K++  +EG
Sbjct: 5   KPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEG 64

Query: 68  VRALWKGNVPAMAMYILYGSTQFT---SYAILNKLLSKSQLPAQIHTGMVGALSGTCSAI 124
              L+KG    + M     +T+F     +  + K L  ++   Q  + + GA +G C + 
Sbjct: 65  PSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESF 124

Query: 125 ASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXX 184
              P ++++ R + + S + ++ ++  + I   EG    + G                  
Sbjct: 125 VVVPFELVKIR-LQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGI 183

Query: 185 YESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQ---VIDWQQLG 241
              V+    +   +       L   A  + G +S  +  P D V+ R Q   VI     G
Sbjct: 184 IFQVRALLPKASTKSEQTRNDL--LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP----G 237

Query: 242 HPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVY 299
            P   N ++ A  +            I ++EG  ALY G+   + +  P   + L V+
Sbjct: 238 VPRKYNWSWPALAT------------IYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283

>Scas_589.10
          Length = 316

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/240 (20%), Positives = 104/240 (43%), Gaps = 20/240 (8%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA------------QYGGILVT 58
           ++P     ++G ++G+S  I+  PLD +K R QLQ+  +A            ++  IL  
Sbjct: 10  KLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSC 69

Query: 59  FKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIH---TGMVG 115
             +++++EG + L+KG  P + M +   + +F S     +++ K     ++    T + G
Sbjct: 70  LSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAG 129

Query: 116 ALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXX 175
             +G   ++   P ++++ R + +   +  + +   + I  ++G  G + G         
Sbjct: 130 TFAGITESLIVVPFELVKIR-LQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWRNT 188

Query: 176 XXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASV--IAGIVSKTIVFPIDTVRKRYQ 233
                       VK F  +   + ++  Q + +   V  IAG +S  +  P D V+ R Q
Sbjct: 189 IWNASYFGLIFQVKKFIPR--AKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQ 246

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 79/167 (47%), Gaps = 11/167 (6%)

Query: 8   KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEG 67
           K +EV    +L+AG  +GI+  ++  P + +KIRLQ     ++ Y   +   + ++  +G
Sbjct: 116 KLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQ---DAQSDYRSPIRCTRTIIENQG 172

Query: 68  VRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQI----HTGMVGALSGTCSA 123
           +  ++ G    +    ++ ++ F     + K + +++   +     +  +VGA++G  S 
Sbjct: 173 LFGIYAGFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSC 232

Query: 124 IASYPCDVLRTRFIANHSRELSTMLSTAQE----IWRHEGFRGFFKG 166
             S P DV++TR   +           A +    I+R EG +G +KG
Sbjct: 233 FLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKG 279

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 74/189 (39%), Gaps = 38/189 (20%)

Query: 109 IHTGMVGALSGTCSAIASYPCDVLRTRF--------IANHS------RELSTMLSTAQEI 154
           I+  + GA++G    I  YP DV++TRF        +A  S       E S++LS   +I
Sbjct: 14  IYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKI 73

Query: 155 WRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK--IFCEQRPDRDSSVIQLLESSASV 212
            + EGF+  +KG                   E  +  +  + +    +S + LL   A  
Sbjct: 74  LKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLL---AGT 130

Query: 213 IAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKE 272
            AGI    IV P + V+ R Q                  A   Y S   +R    I+E +
Sbjct: 131 FAGITESLIVVPFELVKIRLQ-----------------DAQSDYRSP--IRCTRTIIENQ 171

Query: 273 GLLALYHGY 281
           GL  +Y G+
Sbjct: 172 GLFGIYAGF 180

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 46/107 (42%), Gaps = 5/107 (4%)

Query: 195 RPDRDSSVIQLL-ESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAY 253
           R D+D   +  + +  +  +AG+    +++P+D V+ R+Q+    Q+        +    
Sbjct: 3   RIDKDPVKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQL----QINKKALATSSVAVP 58

Query: 254 KSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           K    ++ L     I+++EG   LY G +  +   VP   V     E
Sbjct: 59  KQPEHSSILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNE 105

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 19  VAGCLSGISARIVTAPLDTLKIRLQ--LQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76
           +AGC+S      ++ P D +K R+Q   + ++   YG    +   + R EG++ ++KG +
Sbjct: 226 IAGCMSCF----LSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGIL 281

Query: 77  PAMAMYILYGSTQFTSYAILNKLLSKSQ 104
           P +  Y   G      +  +N+L   S 
Sbjct: 282 PIICRYGPGGGLLLVVFNGVNELFRMSD 309

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 120/311 (38%), Gaps = 34/311 (10%)

Query: 7   RKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQE 66
           +  ++V   +S VAG L+G     +T P +  K RLQL   +       LV      + +
Sbjct: 3   KDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQ 62

Query: 67  GVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTC----- 121
           GV A++ G    +       +T+F  Y  +  LL K +   ++ +G  G L+G       
Sbjct: 63  GVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLL-KDKKTGEL-SGPRGVLAGLGAGLLE 120

Query: 122 SAIASYPCDVLRTRFIAN-------HSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXX 174
           S +A  P + ++T  I +       +     +M      + + EGFRG + G        
Sbjct: 121 SVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQ 180

Query: 175 XXXXXXXXXXYESVKIFCEQ--RPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRY 232
                     Y  +K+  +      +D  +   L       +G+V+     PIDTV+ R 
Sbjct: 181 AANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRM 240

Query: 233 QVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPST 292
           Q +   +                Y+ST  L     I ++EGL   + G T  + + + S 
Sbjct: 241 QSLTASK----------------YSST--LNCFTTIYKEEGLKTFWKGATPRLGRLILSG 282

Query: 293 VVSLGVYEWCL 303
            +   +YE  L
Sbjct: 283 GIVFTIYENVL 293

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 4/95 (4%)

Query: 1   MAEDHLRKGQEVPVFQSL--VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVT 58
           + +D+    ++ P+   L  + G  SG+     T P+DT+K R+Q   A  ++Y   L  
Sbjct: 197 LVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQSLTA--SKYSSTLNC 254

Query: 59  FKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY 93
           F  + ++EG++  WKG  P +   IL G   FT Y
Sbjct: 255 FTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIY 289

>Kwal_27.11419
          Length = 298

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 74/313 (23%), Positives = 123/313 (39%), Gaps = 62/313 (19%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77
            + G + G+++ ++  P D LK RLQ   ++       L+   R +   G   LWKG +P
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKSSN------LLDVVRSIETPG--QLWKGTLP 62

Query: 78  AMAMYILYGSTQFTSY------AILNKLL--------SKSQLP--AQIHTGMVGALSGTC 121
           + A+    GS  F S       AI +K +        S S LP  +     + GA++   
Sbjct: 63  S-ALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAA 121

Query: 122 SAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXX 181
             +A+ P  VL+ RF +       ++   A  I+R EG RG F G               
Sbjct: 122 VGVATMPITVLKVRFESTM-YNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLY 180

Query: 182 XXXYESVKIFCEQRP---------DRDSSVIQ-----LLESSASVIAGIVSKTIVFPIDT 227
              YE  K+   Q P           +S V       ++ S A+  +  ++ TI  P DT
Sbjct: 181 VLFYEQSKL---QLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFDT 237

Query: 228 VRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAK 287
           ++ R Q+   Q  G                   F++    I+  E    L+ G +L +++
Sbjct: 238 IKTRMQLNPSQYYG-------------------FIQTFKSIIRYERPRNLFDGLSLRLSR 278

Query: 288 SVPSTVVSLGVYE 300
              S  ++ G+YE
Sbjct: 279 KALSAGIAWGIYE 291

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 76/183 (41%), Gaps = 43/183 (23%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRA 70
           ++ ++++L++G ++  +  + T P+  LK+R +  + N    G        + R EG+R 
Sbjct: 105 QLSMYENLISGAITRAAVGVATMPITVLKVRFESTMYNYKSLGEAAT---HIYRSEGIRG 161

Query: 71  LWKG-------NVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMV-----GALS 118
           L+ G       + P   +Y+L+               SK QLP  +   MV     G  S
Sbjct: 162 LFSGCGATVMRDAPYAGLYVLFYEQ------------SKLQLPRILPVWMVEHNESGVFS 209

Query: 119 GTCS----AIASY-----------PCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGF 163
              S    +IA++           P D ++TR   N S+     + T + I R+E  R  
Sbjct: 210 TKTSTIINSIAAFSSASLATTITSPFDTIKTRMQLNPSQYYG-FIQTFKSIIRYERPRNL 268

Query: 164 FKG 166
           F G
Sbjct: 269 FDG 271

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 70/157 (44%), Gaps = 9/157 (5%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77
            VAG  SG++   V  P DT+K+RLQ    NE ++ G L    +  R +G+R  + G  P
Sbjct: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTS-QNETRFKGPLDCVYKTFRNQGIRGFYLGFTP 85

Query: 78  AMAMYILYGSTQFTSYAILNKLLSKSQLPAQIH---TGMV--GALSGTCSAIASYPCDVL 132
            +  +IL  S           L+ K   P       +G +  G L+G   +  + P ++ 
Sbjct: 86  PLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELA 145

Query: 133 RTRFIANHSRELSTM---LSTAQEIWRHEGFRGFFKG 166
           + +    + +  +     L   ++I+  +G RG +KG
Sbjct: 146 KAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKG 182

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 82/165 (49%), Gaps = 12/165 (7%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQL-ANEAQYGGILVTFKRLVRQEGV 68
           +++P+   +++G L+G S   +  P++  K +LQ+Q      +Y G L   K++   +G+
Sbjct: 117 EKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGI 176

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSA----- 123
           R L+KG +  + ++  +    + SY +L +   ++    ++    +   +G  SA     
Sbjct: 177 RGLYKGLISTL-IFRTHFVYWWGSYELLTRWFREN---TKMSEAAINFWAGGFSASFGFW 232

Query: 124 IASYPCDVLRTRFIANHSRE--LSTMLSTAQEIWRHEGFRGFFKG 166
             +YP DV++   + N   +    +  +  ++I++ +G  GFFKG
Sbjct: 233 TTAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKG 277

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/283 (21%), Positives = 111/283 (39%), Gaps = 33/283 (11%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           G   GI A + T PLD  K+RLQ   A +     ++    +++R EGV  L+ G   A+ 
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPT---LVRMASQILRNEGVPGLYSGLTAAIL 71

Query: 81  MYILYGSTQFTSYAILN-KLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIAN 139
               Y + +F  Y  +  + + K  L + ++       SG    +   P DV+  R   +
Sbjct: 72  RQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGGLIGNPADVVNIRMQND 131

Query: 140 HS------RELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCE 193
            S      R          +I   EG    F G                  Y+  K +  
Sbjct: 132 SSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIAKNYLV 191

Query: 194 QRP--DRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYK 251
           Q    D+D+        ++S++AG+V+ T+  P D ++ R                    
Sbjct: 192 QNVGLDKDNKSTHF---ASSLLAGLVATTVCSPADVIKTR-----------------VMN 231

Query: 252 AYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVV 294
           A+K ++  + +R+ L  V++EG   ++ G+     +  P+T++
Sbjct: 232 AHK-HSHDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGPNTIL 273

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 34/89 (38%), Gaps = 19/89 (21%)

Query: 213 IAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKE 272
             GIV+     P+D  + R Q            T  A K          +R+A  I+  E
Sbjct: 17  FGGIVACVATHPLDLAKVRLQ------------TAPAPKP-------TLVRMASQILRNE 57

Query: 273 GLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
           G+  LY G T  I +    T    GVY++
Sbjct: 58  GVPGLYSGLTAAILRQCTYTTARFGVYDF 86

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 117/319 (36%), Gaps = 48/319 (15%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYG-----GILVT 58
           D+       P+   L+AG  +GI+   V  PLD LK RLQ   A     G      +L  
Sbjct: 8   DYEALPDHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQ 67

Query: 59  FKRLVRQEGVRALWK-------GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHT 111
              +  QEG   LWK       G  PA A+Y       F +Y ++   L         + 
Sbjct: 68  LSSISAQEGSMVLWKGVQSVLLGAGPAHAVY-------FATYEMVKSFLIDEATSTSKYH 120

Query: 112 GMVGALSGTCSAIAS----YPCDVLRTRFIANHSRELSTMLS---TAQEIWRHEGFRGFF 164
               A SG  + IA+     P DV++ R       +L+T +S   TA+ I+  EGF+ F+
Sbjct: 121 FFKTAFSGATATIAADALMNPFDVIKQRI------QLNTNISVWDTAKRIYSKEGFQAFY 174

Query: 165 KGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQ-LLESSASVIAGIVSKTIVF 223
                               Y++       R    S V    +      I+G     +  
Sbjct: 175 SSYPTTLAINIPFAAFNFGIYDTAT-----RYFNPSGVYNPFIHCLCGGISGAACAGLTT 229

Query: 224 PIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTL 283
           P+D ++   QV         G    + + +K   +  F +    I +  G    + G   
Sbjct: 230 PLDCIKTALQV--------RGSEKVSMEVFKQ--ADTFKKATRAIYQVYGWRGFWSGVKP 279

Query: 284 GIAKSVPSTVVSLGVYEWC 302
            I  ++P+T +S   YE+ 
Sbjct: 280 RILANMPATAISWTAYEFA 298

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 107/277 (38%), Gaps = 33/277 (11%)

Query: 43  QLQLANEA-QYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLS 101
           +L   N + ++ G L  F ++   EG+ +LW+G    + M I      F+ Y  +  +  
Sbjct: 92  ELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSP 151

Query: 102 KSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRF--IANHSRELSTML-------STAQ 152
            +     ++    GA++   +A +  P ++++T+   I   S+   T +        T Q
Sbjct: 152 IASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQ 211

Query: 153 EIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQR--------PDRDSSVIQ 204
           E+      R  FKG                  YE     C++R          +D++ + 
Sbjct: 212 EMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYE----LCKERLWLDSTRFASKDANWVH 267

Query: 205 LLESSAS-VIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLR 263
            + S AS  I+G+++     P D  + R+Q I       P   N+         S N  +
Sbjct: 268 FINSFASGCISGMIAAICTHPFDVGKTRWQ-ISMMNNSDPKGGNR---------SRNMFK 317

Query: 264 LALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
               I   EGL ALY G    + K  PS  + +  YE
Sbjct: 318 FLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYE 354

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 79/182 (43%), Gaps = 32/182 (17%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLV---RQE--- 66
           P    L  G ++ + A    APL+ +K +LQ  +   ++     +  K L+   RQE   
Sbjct: 157 PTLNPLFCGAIARVFAATSIAPLELVKTKLQ-SIPRSSKSTKTWMMVKDLLNETRQEMKM 215

Query: 67  --GVRALWKGNVPAMAMYILYGSTQFTSYAILNK--LLSKSQLPAQ-------IHTGMVG 115
               RAL+KG    +   + + +  ++SY +  +   L  ++  ++       I++   G
Sbjct: 216 VGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFASG 275

Query: 116 ALSGTCSAIASYPCDVLRTRFI-----------ANHSRELSTMLSTAQEIWRHEGFRGFF 164
            +SG  +AI ++P DV +TR+             N SR +   L T   IWR EG    +
Sbjct: 276 CISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLET---IWRTEGLAALY 332

Query: 165 KG 166
            G
Sbjct: 333 TG 334

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 6/74 (8%)

Query: 7   RKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGG------ILVTFK 60
           +    V    S  +GC+SG+ A I T P D  K R Q+ + N +   G      +    +
Sbjct: 261 KDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLE 320

Query: 61  RLVRQEGVRALWKG 74
            + R EG+ AL+ G
Sbjct: 321 TIWRTEGLAALYTG 334

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 129/311 (41%), Gaps = 57/311 (18%)

Query: 31  VTAPLDTLKIRLQLQL------ANEAQYGGI---------LVTFKR-------LVRQEGV 68
           VT P D +K RLQ  +      +   Q  G          L+ FK        + RQEG 
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYA----ILNKLLSKSQLPAQIHTGMVGALSGTCSAI 124
           R+L+KG  P +   I   S  F +Y     I ++ L+  Q    IH  +  A +G  ++ 
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHL-LAAATAGWATST 185

Query: 125 ASYPCDVLRTRFIANH--SRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXX 182
            + P  +++TR   +   ++     L   + + ++EG  G +KG                
Sbjct: 186 VTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGILQWI 245

Query: 183 XXYESVKIFCEQR---------PDRDSSVIQLLE----SSASVIAGIVSKTIVFPIDTVR 229
             YE +K   ++R          D  S+  ++ E    S ++ +A  V+  + +P + VR
Sbjct: 246 L-YEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVR 304

Query: 230 KRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSV 289
            R +              +A         T  ++   +I+++EGL+++Y G T  + ++V
Sbjct: 305 TRLR--------------QAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTV 350

Query: 290 PSTVVSLGVYE 300
           P++++  G +E
Sbjct: 351 PNSIIMFGTWE 361

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 81/183 (44%), Gaps = 25/183 (13%)

Query: 6   LRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQ 65
           L  GQE P    L+A   +G +   VT P+  +K RLQL  A    Y   L   K +V+ 
Sbjct: 162 LNNGQEAPWIH-LLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKN 220

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLP--AQIH------------- 110
           EGV  L+KG + A  +  + G  Q+  Y  + +++ +  +     IH             
Sbjct: 221 EGVLGLYKG-LSASYLGSVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEW 279

Query: 111 ---TGMVGALSGTCSAIASYPCDVLRTRF----IANHSRELSTMLSTAQEIWRHEGFRGF 163
              +G  G L+   ++I +YP +V+RTR       N   + + ++ + + I + EG    
Sbjct: 280 CQRSGSAG-LAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSM 338

Query: 164 FKG 166
           + G
Sbjct: 339 YSG 341

 Score = 35.8 bits (81), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 46/81 (56%), Gaps = 2/81 (2%)

Query: 23  LSGISARIVTAPLDTLKIRL-QLQLAN-EAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           L+   A IVT P + ++ RL Q    N + +Y G++ +F+ ++++EG+ +++ G  P + 
Sbjct: 288 LAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLL 347

Query: 81  MYILYGSTQFTSYAILNKLLS 101
             +      F ++ ++ KLLS
Sbjct: 348 RTVPNSIIMFGTWELVIKLLS 368

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 84/177 (47%), Gaps = 11/177 (6%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFK 60
           M +  + K + +  +Q +++G  +G    + T PL+ +KIRLQ++     +     +   
Sbjct: 585 MRQYFMNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQLGAV 644

Query: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL--------SKSQLPAQIHTG 112
            ++RQ G+R L+KG    +   + + +  F +YA L K +        +K          
Sbjct: 645 GIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELL 704

Query: 113 MVGALSGTCSAIASYPCDVLRTRFIANHSRELST---MLSTAQEIWRHEGFRGFFKG 166
           + G ++G  +A  + P DV++TR   +  +  +T   ++  A+ I + E  + FFKG
Sbjct: 705 LAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKG 761

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 124/300 (41%), Gaps = 30/300 (10%)

Query: 13  PVFQSL---VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVR 69
           P+F S+     G ++G     V  P+D +K R+Q Q  N  QY   +    ++ + +G+R
Sbjct: 500 PIFDSIHNFTLGSIAGCIGATVVYPIDLVKTRMQAQ-RNSVQYKNSIDCVVKIFQTKGIR 558

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNK-LLSKSQLPAQIHTGMVGALSGTCSAIASYP 128
            L+ G  P +       + + T    + +  ++KS+        + GA +G C  + + P
Sbjct: 559 GLYSGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQEILSGATAGACQVVFTNP 618

Query: 129 CDVLRTRFI--ANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYE 186
            ++++ R    +++  E +     A  I R  G RG +KG                  Y 
Sbjct: 619 LEIVKIRLQMRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYA 678

Query: 187 SVK--IFCEQRPDRDS----SVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQL 240
            +K  +F     D++        +LL   A  IAG+ +  +  P D ++ R Q ID ++ 
Sbjct: 679 HLKKDVFNFDPNDKNKRNKLKTWELL--LAGGIAGMPAAYLTTPFDVIKTRLQ-IDPRK- 734

Query: 241 GHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
              G T          T T  +  A  I+++E + + + G    + +S P    +L  +E
Sbjct: 735 ---GET----------TYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFE 781

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 34/89 (38%), Gaps = 17/89 (19%)

Query: 213 IAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKE 272
           IAG +  T+V+PID V+ R Q                     S    N +   + I + +
Sbjct: 513 IAGCIGATVVYPIDLVKTRMQA-----------------QRNSVQYKNSIDCVVKIFQTK 555

Query: 273 GLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
           G+  LY G    +    P   + L V ++
Sbjct: 556 GIRGLYSGLGPQLIGVAPEKAIKLTVNDF 584

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 126/314 (40%), Gaps = 61/314 (19%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQL---QLANEAQYGGILVTFKRLVRQEGVRALWK 73
           +L+AG  +G+   +   PLDT+K+R+Q+    + +  +  G + T   + R EG  A +K
Sbjct: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72

Query: 74  -------GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG---MVGALSGTCSA 123
                  G  P MA+       +F+SY     LL+  +   ++ TG   + G  +G   A
Sbjct: 73  GLGAVVIGITPKMAI-------RFSSYEFYRTLLADKET-GKVSTGNTFIAGVGAGITEA 124

Query: 124 -IASYPCDVLRTRFIANH------SRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXX 176
            +   P +V++ R  A H      + +    +     I + EGF   ++G          
Sbjct: 125 VVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184

Query: 177 XXXXXXXXYESVKIFC------EQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRK 230
                   Y  +K F       E  P  ++S+I L       I+G +      P+DT++ 
Sbjct: 185 NQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGL-------ISGAIGPFSNAPLDTIKT 237

Query: 231 RYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALM---IVEKEGLLALYHGYTLGIAK 287
           R Q                 K   +   +   R+ ++   ++++EG  ALY G T  + +
Sbjct: 238 RLQ-----------------KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMR 280

Query: 288 SVPSTVVSLGVYEW 301
             P   V+   YE+
Sbjct: 281 VAPGQAVTFTAYEF 294

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 12  VPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYG--GILVTFKRLVRQEGVR 69
           +P +++ + G +SG       APLDT+K RLQ   + +   G   I +  K+L+++EG R
Sbjct: 209 LPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFR 268

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS 103
           AL+KG  P +       +  FT+Y  + K L K+
Sbjct: 269 ALYKGITPRVMRVAPGQAVTFTAYEFIRKELEKT 302

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 77/171 (45%), Gaps = 19/171 (11%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLV 63
           D+L   +     +S  AG L GI   IV  PLD LKI+ Q    N   + G    F +++
Sbjct: 109 DNLFGEKTGKAMRSAAAGSLIGI-GEIVLLPLDVLKIKRQ---TNPESFKG--RGFIKIL 162

Query: 64  RQEGVRALWKG-------NVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGA 116
           R EG+  L++G       N P    + L+G   F    IL  L   SQ  A      + +
Sbjct: 163 RDEGLFNLYRGWGWTAARNAPGS--FALFGGNAFAKEYILG-LKDYSQ--ATWSQNFISS 217

Query: 117 LSGTCSA-IASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           + G CS+ I S P DV++TR    +     + L   +   ++EG   FFKG
Sbjct: 218 IVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKG 268

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           Q+ ++  +   S+ IV+APLD +K R+Q +  +  + G  L   K  ++ EGV A +KG 
Sbjct: 212 QNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESG--LRIVKNTLKNEGVTAFFKGL 269

Query: 76  VPAM 79
            P +
Sbjct: 270 TPKL 273

>Kwal_26.7972
          Length = 358

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 69/147 (46%), Gaps = 5/147 (3%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKR----LVRQEGVR 69
           + +S +AG ++G  A+ + APLD +KI  Q    +  +Y G  +   R    +   +G+R
Sbjct: 27  ILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIR 86

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYA-ILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYP 128
             ++G+   +     Y + +F +Y  I + ++   +          G+++G CS   +YP
Sbjct: 87  GFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARRLASGSMAGLCSVFMTYP 146

Query: 129 CDVLRTRFIANHSRELSTMLSTAQEIW 155
            D++R R      R    ML   ++I+
Sbjct: 147 LDLIRVRLAYVTDRSRIKMLPVIKQIY 173

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 88/215 (40%), Gaps = 17/215 (7%)

Query: 97  NKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSREL----STM--LST 150
           N+ + K      + +G+ G ++G+C+     P D ++  F  ++   L    STM  +  
Sbjct: 16  NQSVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRA 75

Query: 151 AQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSA 210
              I  H+G RGF++G                  YE ++ F     + ++   +L   S 
Sbjct: 76  GAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARRLASGS- 134

Query: 211 SVIAGIVSKTIVFPIDTVRKRYQ-VIDWQQLGHPGHTNKAY--KAYKSYTSTNFLRLALM 267
             +AG+ S  + +P+D +R R   V D  ++       + Y  +A +S TS +++     
Sbjct: 135 --MAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWF- 191

Query: 268 IVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
                     Y G+T  +   +P   VS   ++ C
Sbjct: 192 ----AHWCNFYRGFTPTVLGMIPYAGVSFFAHDLC 222

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 47/196 (23%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRAL---- 71
           + L +G ++G+ +  +T PLD +++RL      +     +L   K++  +    +L    
Sbjct: 128 RRLASGSMAGLCSVFMTYPLDLIRVRLAY--VTDRSRIKMLPVIKQIYTERASESLTSKS 185

Query: 72  ------------WKGNVPAMAMYILYGSTQFTSYAILNKLL------------------- 100
                       ++G  P +   I Y    F ++ +   +L                   
Sbjct: 186 YVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELT 245

Query: 101 --SKSQLPAQIHTG---MVGALSGTCSAIASYPCDVLRTRFIAN-----HSRELSTMLST 150
             SK Q    + T    + G L+G  S  ASYP +++R R   +           T+   
Sbjct: 246 IRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDM 305

Query: 151 AQEIWRHEGFRGFFKG 166
            + I++  G+RGFF G
Sbjct: 306 IRIIYKERGWRGFFVG 321

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 77/168 (45%), Gaps = 18/168 (10%)

Query: 16  QSLVAGCLSGIS-ARIVTAPLDTLKIRLQLQLAN------EAQYGGILVTFKRLVRQEGV 68
            + +AG  +G++ A +V  P++ +KIRLQ Q  N      + +Y   +     ++++EG+
Sbjct: 139 NTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGI 198

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK----SQLPAQIHTGMVGALSGTCSAI 124
            AL++G     A         FT Y+ L + L +      LP+   T  +G +SG     
Sbjct: 199 SALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSW-ETSCIGLISGAIGPF 257

Query: 125 ASYPCDVLRTRFIANHSREL------STMLSTAQEIWRHEGFRGFFKG 166
           ++ P D ++TR   + S           +     ++ + EGFR  +KG
Sbjct: 258 SNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKG 305

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 69/341 (20%), Positives = 123/341 (36%), Gaps = 84/341 (24%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQL------------------------------QL 46
           +LVAG  +G+   +   PLDT+K+R+Q+                                
Sbjct: 14  NLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDA 73

Query: 47  ANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQ-- 104
               +  G + T + +  QEG  AL+KG    +   I   + +F+SY     LL+  Q  
Sbjct: 74  TAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQTG 133

Query: 105 LPAQIHTGMVGALSGTCSAI-ASYPCDVLRTRFIANH--------SRELSTMLSTAQEIW 155
           + +  +T + G  +G   A+    P +V++ R  A H          + +  +     I 
Sbjct: 134 VVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTII 193

Query: 156 RHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIF------CEQRPDRDSSVIQLLESS 209
           + EG    ++G                  Y  ++ F       E  P  ++S I L    
Sbjct: 194 KEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGL---- 249

Query: 210 ASVIAGIVSKTIVFPIDTVRKRYQVID---------WQQLGHPGHTNKAYKAYKSYTSTN 260
              I+G +      P+DT++ R Q            W+++ H                  
Sbjct: 250 ---ISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAH------------------ 288

Query: 261 FLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
              +   ++++EG  ALY G T  + +  P   V+  VYE+
Sbjct: 289 ---IGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 326

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQ----LQLANEAQYGGILVTFKRLVRQ 65
           + +P +++   G +SG       APLDT+K RLQ         E+ +  I     +L+++
Sbjct: 237 ETLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKE 296

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK 102
           EG RAL+KG  P +       +  FT Y  + + L  
Sbjct: 297 EGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEN 333

>Kwal_26.7967
          Length = 297

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 4/95 (4%)

Query: 1   MAEDHLRKGQEVPVFQSL--VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVT 58
           M +D+    ++ P+   +  V G  SGI     T P+DT+K R+Q    + ++Y   +  
Sbjct: 196 MIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQS--LDSSKYSSTINC 253

Query: 59  FKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY 93
           F  + R+EG++  WKG  P +   IL G   FT Y
Sbjct: 254 FATVFREEGLKTFWKGATPRLGRLILSGGIVFTIY 288

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/306 (20%), Positives = 111/306 (36%), Gaps = 30/306 (9%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVR 69
           ++V    S +AG L+G     +T P +  K RLQL   +       L    R  + +G+ 
Sbjct: 5   KQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLG 64

Query: 70  ALWKGNVPAMAMYILYGSTQFTSY-AILNKLLSKSQLPAQIHTGMVGALSGTC--SAIAS 126
           A++ G    +         +F  + AI N L   +        G+V  L      S +A 
Sbjct: 65  AVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPRGIVAGLGAGLLESVVAV 124

Query: 127 YPCDVLRTRFIAN-------HSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXX 179
            P + ++T  I +       +      ML     +   +GF G ++G             
Sbjct: 125 TPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQA 184

Query: 180 XXXXXYESVKIFCEQRPD--RDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDW 237
                Y  +K   +   +  +D  +   +       +GIV+     PIDTV+ R Q +D 
Sbjct: 185 VRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDS 244

Query: 238 QQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLG 297
            +                Y+ST  +     +  +EGL   + G T  + + + S  +   
Sbjct: 245 SK----------------YSST--INCFATVFREEGLKTFWKGATPRLGRLILSGGIVFT 286

Query: 298 VYEWCL 303
           +YE  L
Sbjct: 287 IYEKVL 292

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 39/208 (18%), Positives = 77/208 (37%), Gaps = 24/208 (11%)

Query: 100 LSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTR--FIANHSRELSTMLSTAQEIWRH 157
           +S+ +    +H+ + G+L+G   A  +YP +  +TR   +   S      L+      + 
Sbjct: 1   MSQKKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKV 60

Query: 158 EGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAG-- 215
           +G    + G                  ++++K        RD +  + L     ++AG  
Sbjct: 61  QGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNIL-----RDPTTGE-LSGPRGIVAGLG 114

Query: 216 ---IVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKE 272
              + S   V P + ++    +ID +Q   P + N      ++Y+S         +V  +
Sbjct: 115 AGLLESVVAVTPFEAIKT--ALIDDKQSASPKYHNNGRGMLRNYSS---------LVYDK 163

Query: 273 GLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           G   LY G      +   +  V LG Y 
Sbjct: 164 GFSGLYRGVLPVSMRQAANQAVRLGCYN 191

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 79/164 (48%), Gaps = 19/164 (11%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGIL----VTFKRLVRQEGVRALWK 73
           +++G  +G    + T PL+ +KIRLQ++    ++Y G +    VT   +++Q G++ L+K
Sbjct: 616 ILSGACAGACQVVFTNPLEVVKIRLQVR----SEYAGDVLKSQVTALGVIKQLGIKGLYK 671

Query: 74  GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG--------MVGALSGTCSAIA 125
           G    +   + + +  F +YA L K + K     +            + G L+G  +A  
Sbjct: 672 GIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYL 731

Query: 126 SYPCDVLRTRFIANHSR---ELSTMLSTAQEIWRHEGFRGFFKG 166
           + P DV++TR   +  +       +   A+ I + E F+ FFKG
Sbjct: 732 TTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKG 775

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 59/298 (19%), Positives = 115/298 (38%), Gaps = 26/298 (8%)

Query: 13  PVFQSL---VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVR 69
           P+F S+     G ++G     V  P+D +K R+Q Q +  +QY   +  F ++  +EG+R
Sbjct: 514 PIFDSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRS-FSQYKNSIDCFAKIFSREGIR 572

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILN-KLLSKSQLPAQIHTGMVGALSGTCSAIASYP 128
            ++ G  P +       + + T    +  +L+ K          + GA +G C  + + P
Sbjct: 573 GIYSGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHANLKWYFEILSGACAGACQVVFTNP 632

Query: 129 CDVLRTRFIANHSRELSTMLS--TAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYE 186
            +V++ R           + S  TA  + +  G +G +KG                  Y 
Sbjct: 633 LEVVKIRLQVRSEYAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPTYA 692

Query: 187 SVKIFCEQRPDRDSSVIQLLES----SASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGH 242
            +K    +   +D      L++     A  +AG+ +  +  P D ++ R Q+        
Sbjct: 693 HLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQI-------D 745

Query: 243 PGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           P      Y+             A  I+++E   + + G +  + +S P    +L  YE
Sbjct: 746 PRKGETRYEG--------IFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYE 795

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 7   RKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ-LANEAQYGGILVTFKRLVRQ 65
           ++  ++  ++ LVAG L+G+ A  +T P D +K RLQ+     E +Y GI    + ++++
Sbjct: 707 KQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKE 766

Query: 66  EGVRALWKG 74
           E  ++ +KG
Sbjct: 767 ESFKSFFKG 775

 Score = 32.0 bits (71), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 37/89 (41%), Gaps = 17/89 (19%)

Query: 213 IAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKE 272
           IAG +  T+V+PID V+ R Q              +++  YK     N +     I  +E
Sbjct: 527 IAGCIGATVVYPIDLVKTRMQA------------QRSFSQYK-----NSIDCFAKIFSRE 569

Query: 273 GLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
           G+  +Y G    +    P   + L V ++
Sbjct: 570 GIRGIYSGLGPQLIGVAPEKAIKLTVNDY 598

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 117/302 (38%), Gaps = 25/302 (8%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA--QYGGILVTFKRLVRQEG 67
           + +P      AG ++G+S  +V  PLD +K R+QLQ+   A   Y G++   K++V  EG
Sbjct: 7   KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEG 66

Query: 68  VRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS---QLPAQIHTGMVGALSGTCSAI 124
           V  L+KG    + M     +T+F       KL  ++   +  +Q  + + GA +G   A 
Sbjct: 67  VGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAF 126

Query: 125 ASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXX 184
              P ++++ R + + S      +   ++I   EG    + G                  
Sbjct: 127 VVVPFELVKIR-LQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI 185

Query: 185 YESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPG 244
               +       ++   +   L S +  I   +   +  P D V+ R Q         PG
Sbjct: 186 IFQARALLPAAHNKTQCITNDLISDS--IGCSIGCMLSTPFDVVKSRIQ----NTAVIPG 239

Query: 245 HTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPS----TVVSLGVYE 300
              K   +  S          L I  +EG  ALY G+   + +  P      VV  GV +
Sbjct: 240 VVRKYNWSLPSL---------LTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLD 290

Query: 301 WC 302
           +C
Sbjct: 291 FC 292

>Kwal_27.12081
          Length = 369

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 70/312 (22%), Positives = 130/312 (41%), Gaps = 60/312 (19%)

Query: 30  IVTAPLDTLKIRLQLQL-------------ANEAQYG--------GILVTFKRLVRQEGV 68
           IVT P D +K RLQ  +             +N    G        GI+    +L   EG 
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKL---EGF 124

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS----QLPAQIHTGMVGALSGTCSAI 124
           R+L+KG  P +   I   S  F +Y    ++ S++    +    IH  +  A +G  ++ 
Sbjct: 125 RSLFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHL-ISAATAGWATST 183

Query: 125 ASYPCDVLRTRF---IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXX 181
           A+ P  +++TR     A H+R+        + I + EGF G +KG               
Sbjct: 184 ATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGILQW 243

Query: 182 XXXYESVKIFCEQRP----------DRDSS--VIQLLESSASV-IAGIVSKTIVFPIDTV 228
              YE +K   + R           ++++S  + +  + S S  +A  ++  + +P + V
Sbjct: 244 LL-YEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVV 302

Query: 229 RKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKS 288
           R R +         P   +K          T  ++   +I+++EGL ++Y G T  + ++
Sbjct: 303 RTRLRQA-------PLENDK-------LKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRT 348

Query: 289 VPSTVVSLGVYE 300
           VP++++  G +E
Sbjct: 349 VPNSIIMFGTWE 360

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 23  LSGISARIVTAPLDTLKIRL-QLQLANEA-QYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           L+   A IVT P + ++ RL Q  L N+  +Y G++ +F+ ++++EG+ +++ G  P + 
Sbjct: 287 LAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLL 346

Query: 81  MYILYGSTQFTSYAILNKLLS 101
             +      F ++ ++ KLLS
Sbjct: 347 RTVPNSIIMFGTWELVIKLLS 367

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 118/315 (37%), Gaps = 43/315 (13%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQL-----QLANEAQYGGILVT 58
           D+    +  P+   L AG  +GI    +  P+D +K R+Q        A       +L  
Sbjct: 7   DYEALPENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQ 66

Query: 59  FKRLVRQEGVRALWK-------GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHT 111
             ++   EG  ALWK       G  PA A+Y       F +Y +    L   +   Q H 
Sbjct: 67  IAKISTTEGSLALWKGVQSVVLGAGPAHAVY-------FATYEMCKSRLIDPE-DRQTHQ 118

Query: 112 GMVGALSGTCSAIAS----YPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGX 167
            +  ALSGT + +A+     P D ++ R   + S    +M   A  +++ EG   FF   
Sbjct: 119 PLKTALSGTLATVAADALMNPFDTIKQRLQLHPS---DSMTKCAVRMYQREGIAAFFYSY 175

Query: 168 XXXXXXXXXXXXXXXXXYE-SVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPID 226
                            YE S KIF     +  ++    +      I+G     I  P+D
Sbjct: 176 PTTIAMNIPFAALNFVIYESSTKIF-----NPSNNYNPWIHCLCGGISGATCAAITTPLD 230

Query: 227 TVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIA 286
            V+   Q+         G  +   + +K   +  F + A  I +  G    + G    I 
Sbjct: 231 CVKTVLQIR--------GADSVQSQLFKE--ADTFRKAASAIHKTYGWSGFFRGLKPRII 280

Query: 287 KSVPSTVVSLGVYEW 301
            ++P+T +S   YE+
Sbjct: 281 SNMPATAISWTSYEF 295

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 14/110 (12%)

Query: 193 EQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKA 252
           E  P+    V QL   +A   AGI+  +I+FPID ++ R Q +          T  +  A
Sbjct: 9   EALPENAPLVYQL---AAGAFAGIMEHSIMFPIDAIKTRMQAVS---------TTGSSAA 56

Query: 253 YKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
            +    +N L     I   EG LAL+ G    +  + P+  V    YE C
Sbjct: 57  TR--LPSNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEMC 104

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 73/159 (45%), Gaps = 19/159 (11%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG- 74
           +S  AG L GI   IV  PLD LKI+ Q    N   + G    F ++++ EG+  L++G 
Sbjct: 121 RSATAGSLIGI-GEIVLLPLDVLKIKRQ---TNPEAFKG--RGFLKILKDEGIFNLYRGW 174

Query: 75  ------NVPAMAMYILYGSTQFTSYAILN-KLLSKSQLPAQIHTGMVGALSGTCSAIASY 127
                 N P    + L+G   F    IL  +  S++       + +VGA   + S I S 
Sbjct: 175 GWTAARNAPGS--FALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGA---SASLIVSA 229

Query: 128 PCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           P DV++TR    +     +     +   ++EGF  FFKG
Sbjct: 230 PLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKG 268

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           Q+ ++  +   ++ IV+APLD +K R+Q +  +  + G  +V  K  ++ EG  A +KG 
Sbjct: 212 QNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIV--KNTLKNEGFTAFFKGL 269

Query: 76  VPAM 79
            P +
Sbjct: 270 TPKL 273

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 119/300 (39%), Gaps = 46/300 (15%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQ------LQLANEAQYGGILVTFKRLVRQEGVRA 70
             + G +S   ++   AP++ +K+ +Q       Q + + +Y GI+  FKR    EGV +
Sbjct: 13  DFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVAS 72

Query: 71  LWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAIAS---- 126
            W+GN    A  I Y  TQ  ++A  +K+  K+    +   G     +G  ++       
Sbjct: 73  FWRGNT---ANVIRYFPTQALNFAFKDKI--KAMFGFKKEEGYAKWFAGNLASGGLAGGL 127

Query: 127 -----YPCDVLRTRFIANH-------SRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXX 174
                Y  D  RTR  A+         R+ + ++   ++    +G  G ++G        
Sbjct: 128 SLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGI 187

Query: 175 XXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQV 234
                     Y+S+K         +S +   L   A V  G  + T  +P+DTVR+R  +
Sbjct: 188 VVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWA-VTTG--ASTASYPLDTVRRRMMM 244

Query: 235 IDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVV 294
              Q + + G    A+ A++             IV  EG+ +L+ G    I + V    V
Sbjct: 245 TSGQAVKYDG----AFDAFRK------------IVAAEGIKSLFKGCGANILRGVAGAGV 288

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 1   MAEDHLRKGQEVPVFQSL--VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVT 58
           + +D+    ++ P+   L  + G  SGI     T P+DT+K R+Q    N  QY   +  
Sbjct: 277 LVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQS--LNAGQYSSTINC 334

Query: 59  FKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY 93
           F  + ++EG++  WKG  P +   IL G   FT Y
Sbjct: 335 FATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIY 369

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 62/306 (20%), Positives = 115/306 (37%), Gaps = 34/306 (11%)

Query: 12  VPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRAL 71
           V  F S +AG ++G     +T P +  K RLQL           LV      +  G+ ++
Sbjct: 88  VDPFHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSI 147

Query: 72  WKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTC-----SAIAS 126
           + G    +         +F  +  +  LL + +   ++ +G  G ++G       S +A 
Sbjct: 148 YVGCPAFIVGNTAKAGIRFLGFDTIKNLL-RDKKTGEL-SGFRGVVAGLGAGLLESVVAV 205

Query: 127 YPCDVLRTRFIAN-------HSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXX 179
            P + ++T  I +       +      M+S   ++   +GF G ++G             
Sbjct: 206 TPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQA 265

Query: 180 XXXXXYESVKIFCEQRPD--RDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDW 237
                Y  +K   +   +  +D  +   L       +GIV+     PIDTV+ R Q ++ 
Sbjct: 266 VRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLNA 325

Query: 238 QQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLG 297
            Q                Y+ST  +     I ++EGL   + G T  + + + S  +   
Sbjct: 326 GQ----------------YSST--INCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFT 367

Query: 298 VYEWCL 303
           +YE  L
Sbjct: 368 IYEKVL 373

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 82/172 (47%), Gaps = 12/172 (6%)

Query: 7   RKGQEVPVFQSLVAGCLSGISARIVT-APLDTLKIRL----QLQLANEAQYG-GILVTFK 60
           +K  E+  F+ +VAG  +G+   +V   P + +K  L    Q  +      G G++  + 
Sbjct: 179 KKTGELSGFRGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYA 238

Query: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK-SQLPAQ--IHTGM---V 114
           +L+  +G   L++G +P         + +   Y  +  L+   + +P    + +G+   V
Sbjct: 239 KLLSDQGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIV 298

Query: 115 GALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           GA SG  +   + P D ++TR  + ++ + S+ ++    I++ EG + F+KG
Sbjct: 299 GAFSGIVTVYTTMPIDTVKTRMQSLNAGQYSSTINCFATIFKEEGLKTFWKG 350

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 67/311 (21%), Positives = 125/311 (40%), Gaps = 52/311 (16%)

Query: 13  PVFQSL-------VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQ 65
           P+F S+       VAGC+  +    V  P+D +K R+Q Q  + ++Y   +    +++ +
Sbjct: 520 PIFDSIYNFTLGSVAGCIGAM----VVYPIDMVKTRMQAQ-RDFSKYKNSIDCLLKILSK 574

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLS----KSQLPAQIHTGMVGALSGTC 121
           EGVR L+ G  P +       + + T    +   L+    K  LP +I   + GA +G C
Sbjct: 575 EGVRGLYSGLGPQLIGVAPEKAIKLTVNDHMRATLAGRDGKLSLPCEI---ISGATAGAC 631

Query: 122 SAIASYPCDVLRTR------FIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXX 175
             + + P ++++ R      ++A+ +R     +S  + +    G  G ++G         
Sbjct: 632 QVVFTNPLEIVKIRLQVKSDYVADAARNSVNAISVIKNL----GLIGLYRGAGACLLRDI 687

Query: 176 XXXXXXXXXYESVK--IFCEQRPDRDS----SVIQLLESSASVIAGIVSKTIVFPIDTVR 229
                    Y  +K  +F     D D     +  QLL S    +AG+ +  +  P D ++
Sbjct: 688 PFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGG--LAGMPAAFLTTPFDVIK 745

Query: 230 KRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSV 289
            R Q+        P      Y              A  I+++EG+ + + G    + +S 
Sbjct: 746 TRLQI-------DPKKGESVYNG--------IWDAARTILKEEGIKSFFKGGPARVLRSS 790

Query: 290 PSTVVSLGVYE 300
           P    +L  YE
Sbjct: 791 PQFGFTLAAYE 801

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 16/129 (12%)

Query: 8   KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN-EAQYGGILVTFKRLVRQE 66
           K  ++  +Q LV+G L+G+ A  +T P D +K RLQ+     E+ Y GI    + ++++E
Sbjct: 714 KRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEE 773

Query: 67  GVRALWKGNVPAMAMYILYGSTQF----TSYAILNKLL-------SKSQLPAQIHTGMVG 115
           G+++ +KG  PA    +L  S QF     +Y I + L        S +  P +   G + 
Sbjct: 774 GIKSFFKGG-PAR---VLRSSPQFGFTLAAYEIFHNLFPAPRYDDSTTHRPTREPVGALA 829

Query: 116 ALSGTCSAI 124
            ++ T SA 
Sbjct: 830 PINKTVSAF 838

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 72/329 (21%), Positives = 128/329 (38%), Gaps = 69/329 (20%)

Query: 19  VAGCLSGISARIVTAPLDTLKIRLQ---LQLANEAQ--------------YGGILVTFKR 61
           ++G L+G  A ++  PLD  K RLQ   LQL                   Y GI  T   
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 62  LVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILN----KLLSKSQLPAQIHTGMVGAL 117
           +VR E +R L+KG VP +  Y       F+ Y        +  + S+    +   M    
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEF---LSHSMSALT 224

Query: 118 SGTCSAIASYPCDVLRTRFIANHSRELSTM------LSTAQEIWRHEGFRGFFKGXXXXX 171
           +G  S   + P  V++TR +    + +  M      L    +I++ EG + F+ G     
Sbjct: 225 AGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSG-LIPS 283

Query: 172 XXXXXXXXXXXXXYESVK----IFCEQRPDRDS------SVIQLLESS---------ASV 212
                        YE +K     +   RP++++      S  Q   S+         AS 
Sbjct: 284 LFGLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVASC 343

Query: 213 IAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKE 272
            + +++ T+ +P + +R R Q+            +    + KS   T +         KE
Sbjct: 344 GSKMIASTLTYPHEILRTRLQL-----------KSDMKPSIKSIIRTTY--------AKE 384

Query: 273 GLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
           G+   Y G+   + ++VP++ ++L  +E+
Sbjct: 385 GIRGFYSGFLTNMFRTVPASAITLVSFEY 413

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 76/177 (42%), Gaps = 33/177 (18%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQ----LANEAQYGGILVTFKRLVRQEGVRALW 72
           +L AG +S      +T P+  +K RL LQ    +     Y   L  F ++ + EG+++ +
Sbjct: 222 ALTAGAIS----TTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFY 277

Query: 73  KGNVPAMAMYILYGSTQFTSYAILNKLL------------------SKSQLPAQIHTGMV 114
            G +P++   +L+ +  F  Y  L K+L                  S  Q     +  + 
Sbjct: 278 SGLIPSL-FGLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLG 336

Query: 115 GALSGTCSA--IAS---YPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
             +  +C +  IAS   YP ++LRTR       + S + S  +  +  EG RGF+ G
Sbjct: 337 RLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKPS-IKSIIRTTYAKEGIRGFYSG 392

 Score = 34.7 bits (78), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 71/189 (37%), Gaps = 34/189 (17%)

Query: 111 TGMVGALSGTCSAIASYPCDVLRTRFIANH-------SRELSTMLST-----AQEIW--- 155
           T + GAL+G  + +   P DV +TR  A         +R + ++ +T        IW   
Sbjct: 106 TALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTL 165

Query: 156 ----RHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSAS 211
               R E  RG +KG                  YE  K+     P   ++   L  S ++
Sbjct: 166 TTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKL---SYPRYFNNSEFLSHSMSA 222

Query: 212 VIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEK 271
           + AG +S T+  PI  V+ R  +         G   K    YK     N L   + I + 
Sbjct: 223 LTAGAISTTLTNPIWVVKTRLML-------QSGKNIKGMTHYK-----NTLDAFIKIYKV 270

Query: 272 EGLLALYHG 280
           EG+ + Y G
Sbjct: 271 EGIKSFYSG 279

>Scas_702.10
          Length = 302

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 113/280 (40%), Gaps = 52/280 (18%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           G  +GI A ++T PLD  K+RLQ     +   G +L T   ++R E V  L+ G   A+ 
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTT---ILRNENVMGLYSGLSAAVL 72

Query: 81  MYILYGSTQFTSYAILNK-LLSKSQ-------LPAQIHTGMVGALSGTCSAIASYPCDVL 132
               Y + +F +Y ++ + L+ +         LP  + +G +G L G  +       DV+
Sbjct: 73  RQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNFA-------DVV 125

Query: 133 RTRFIANHS------RELSTMLSTAQEIWRHE-GFRGFFKGXXXXXXXXXXXXXXXXXXY 185
             R   + +      R     +    +I+ HE G +    G                  Y
Sbjct: 126 NIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTY 185

Query: 186 ESVKIFCEQR----PDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLG 241
           +  K +   +    P ++S+ +     SAS++AG+V+ TI  P D ++ R          
Sbjct: 186 DVFKNYLVTKLSFDPKKNSTHL-----SASLLAGLVATTICSPADVIKTRIM-------- 232

Query: 242 HPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGY 281
              H  ++  A K  TS          ++KEG   ++ G+
Sbjct: 233 -NAHKTESESAIKILTSA---------IKKEGPSFMFRGW 262

>Scas_645.9
          Length = 391

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 89/182 (48%), Gaps = 30/182 (16%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQ-LQLANEAQYGGILVT-FKRLVRQE---- 66
           P F  L+ G ++ I A    APL+ LK +LQ +   +++    ++V    +  RQE    
Sbjct: 184 PTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRIS 243

Query: 67  -GVRALWKG-------NVPAMAMYILYGSTQFT-SYAILNKLLSKSQLPAQIHTGMVGAL 117
               AL+KG       +VP  A+Y  +GS +F  ++  ++   S S L   I++ + G++
Sbjct: 244 GASNALFKGLEITLWRDVPFSAIY--WGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSI 301

Query: 118 SGTCSAIASYPCDVLRTR----FIANHSR---------ELSTMLSTAQEIWRHEGFRGFF 164
           SGT +A+ ++P DV +TR    F+ N+ +         +   M    + IW+ EG+   +
Sbjct: 302 SGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALY 361

Query: 165 KG 166
            G
Sbjct: 362 TG 363

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 102/271 (37%), Gaps = 19/271 (7%)

Query: 43  QLQLANEA-QYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLS 101
           +L   N + ++ G L  F ++ + EG+  LW+G    + M I      FT Y  L     
Sbjct: 119 ELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSP 178

Query: 102 KSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRF--IANHSRELSTML-------STAQ 152
            +      +  M GA++   +A    P ++L+T+   I   S+  ++ +        T Q
Sbjct: 179 LATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQ 238

Query: 153 EIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESS--A 210
           E+         FKG                  YE  K        +  S +    +S   
Sbjct: 239 EMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIG 298

Query: 211 SVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKA-YKAYKSYTSTNFLRLALMIV 269
             I+G ++  +  P D  + R+Q+         G+ +K+  K+     + N  +    I 
Sbjct: 299 GSISGTIAALVTHPFDVGKTRWQI------SFMGNNDKSVVKSPDIEQTKNMFKFLRNIW 352

Query: 270 EKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           + EG  ALY G    + K  PS  + +  YE
Sbjct: 353 KLEGWGALYTGLVPRMVKIAPSCAIMISSYE 383

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 38/97 (39%), Gaps = 11/97 (11%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANE-----------AQYGGILVTFKRLVR 64
            S + G +SG  A +VT P D  K R Q+                 Q   +    + + +
Sbjct: 294 NSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWK 353

Query: 65  QEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLS 101
            EG  AL+ G VP M       +   +SY +  +L +
Sbjct: 354 LEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFN 390

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 65/170 (38%), Gaps = 25/170 (14%)

Query: 139 NHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDR 198
           N S   +  L    +IW+ EG    ++G                  YE ++   +  P  
Sbjct: 124 NSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLR---DNSPLA 180

Query: 199 DSS-VIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYT 257
            SS     L   A  IA I++ + V P++ ++ + Q I               +  KS T
Sbjct: 181 TSSPTFNPLMCGA--IARILAASTVAPLELLKTKLQSIP--------------RVSKSTT 224

Query: 258 STNFLRLALMIVEKEGLL-----ALYHGYTLGIAKSVPSTVVSLGVYEWC 302
           S   ++  L    +E  +     AL+ G  + + + VP + +  G YE+C
Sbjct: 225 SWMMVKELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFC 274

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 80/172 (46%), Gaps = 14/172 (8%)

Query: 5   HLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRL 62
            L +   +P+ Q  V G   G+    + +P++ ++IRLQ Q +N  + ++ G     K+L
Sbjct: 133 DLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL 192

Query: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAIL-----NKLLSKSQLPAQIHTGMVGAL 117
             Q G   L +G  P M        T F  Y  L        L+++++P      + GA 
Sbjct: 193 KAQGG---LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW-KLCLFGAF 248

Query: 118 SGTCSAIASYPCDVLRTRFIANHSREL---STMLSTAQEIWRHEGFRGFFKG 166
           SGT   +  YP DV+++    +  R+    +++   A+ I+  EG R FFKG
Sbjct: 249 SGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 14 VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73
          V + + AG + GI+  +V  P DT K+RLQ            L   + LV+ EGV A +K
Sbjct: 34 VLKDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT----LEVLRNLVKNEGVFAFYK 89

Query: 74 G 74
          G
Sbjct: 90 G 90

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 1/95 (1%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQY-GGILVTFKRLVRQEGV 68
            E+P ++  + G  SG    +   PLD +K  +Q     + +Y   I    K +  +EG+
Sbjct: 235 NEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGI 294

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS 103
           RA +KG  P M          F ++ ++ + L + 
Sbjct: 295 RAFFKGFGPTMVRSAPVNGATFLTFELVMRFLGEE 329

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 81/173 (46%), Gaps = 34/173 (19%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRA 70
           E+ + Q   AG +S I   +VTAP + +K+ LQ      +     L   K++VR +G ++
Sbjct: 136 ELTLSQMAAAGFISAIPTTLVTAPTERVKVVLQTTQGKAS----FLDAAKQIVRTQGFQS 191

Query: 71  LWKGNV-------PAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG---------MV 114
           L+KG++       P  A+Y       F SY I  + L+K    A  HT          + 
Sbjct: 192 LFKGSLATLSRDGPGSALY-------FASYEICKEYLNK----ASGHTSGELSITNVCIS 240

Query: 115 GALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHE-GFRGFFKG 166
           G ++G    +  +P D ++T+  ++  R+  +ML   + I+    G +GFF G
Sbjct: 241 GGMAGVSMWVVVFPIDTVKTQLQSSSKRQ--SMLEVTRMIYNTRGGIKGFFPG 291

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 101/253 (39%), Gaps = 38/253 (15%)

Query: 8   KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVT-FKRLVRQ- 65
           K Q     +SL AG + G+ A +   P D +K+R Q   +N+A+     V+   +  RQ 
Sbjct: 22  KSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQ---SNQARSAMDAVSHILQAARQA 78

Query: 66  ------EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKL------------------LS 101
                   VR  +KG VP +       +  F  Y +  KL                  L+
Sbjct: 79  AGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELT 138

Query: 102 KSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFR 161
            SQ+ A       G +S   + + + P +  R + +   ++  ++ L  A++I R +GF+
Sbjct: 139 LSQMAA------AGFISAIPTTLVTAPTE--RVKVVLQTTQGKASFLDAAKQIVRTQGFQ 190

Query: 162 GFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSAS-VIAGIVSKT 220
             FKG                  YE  K +  +     S  + +     S  +AG+    
Sbjct: 191 SLFKGSLATLSRDGPGSALYFASYEICKEYLNKASGHTSGELSITNVCISGGMAGVSMWV 250

Query: 221 IVFPIDTVRKRYQ 233
           +VFPIDTV+ + Q
Sbjct: 251 VVFPIDTVKTQLQ 263

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/217 (19%), Positives = 77/217 (35%), Gaps = 35/217 (16%)

Query: 101 SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRH--- 157
           +KSQL   + +   G + G C+ +  +P D+++ R  +N +R     +S   +  R    
Sbjct: 21  TKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQAAG 80

Query: 158 ----EGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLE------ 207
                  RGF+KG                  Y+  K      P   +S    +E      
Sbjct: 81  PTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLS 140

Query: 208 --SSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLA 265
             ++A  I+ I +  +  P + V+   Q    +                     +FL  A
Sbjct: 141 QMAAAGFISAIPTTLVTAPTERVKVVLQTTQGK--------------------ASFLDAA 180

Query: 266 LMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
             IV  +G  +L+ G    +++  P + +    YE C
Sbjct: 181 KQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYEIC 217

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 74/159 (46%), Gaps = 20/159 (12%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG- 74
           +S  AG + GI   IV  PLD LKI+ Q    N   + G    F ++++ EG+  L++G 
Sbjct: 120 RSATAGSMIGI-GEIVLLPLDVLKIKRQ---TNPEAFKG--RGFVKILKDEGL-GLYRGW 172

Query: 75  ------NVPAMAMYILYGSTQFTSYAILN-KLLSKSQLPAQIHTGMVGALSGTCSAIASY 127
                 N P    + L+G   F    IL  K  S++       + +VGA   + S I S 
Sbjct: 173 GWTAARNAPGS--FALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGA---SASLIISA 227

Query: 128 PCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           P DV++TR    +     +  +  +   ++EGF  FFKG
Sbjct: 228 PLDVIKTRIQNKNFENPESGFTIVKNTLKNEGFSAFFKG 266

>Kwal_27.11626
          Length = 299

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 70/159 (44%), Gaps = 20/159 (12%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG- 74
           +S  AG L GI   IV  PLD LKI+ Q    N   + G    F ++++ EG   L++G 
Sbjct: 120 RSATAGSLIGI-GEIVLLPLDVLKIKRQ---TNPESFKG--RGFIKILKDEGF-GLYRGW 172

Query: 75  ------NVPAMAMYILYGSTQFTSYAILN-KLLSKSQLPAQIHTGMVGALSGTCSAIASY 127
                 N P    + L+G   F    IL  K  S +       + +VGA   + S I S 
Sbjct: 173 GWTAARNAPGS--FALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGA---SASLIVSA 227

Query: 128 PCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           P DV++TR    H     +     Q   ++EG   FFKG
Sbjct: 228 PLDVIKTRIQNRHFDNPESGFRIVQNTLKNEGITAFFKG 266

>Scas_489.4
          Length = 297

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 4/95 (4%)

Query: 1   MAEDHLRKGQEVPVFQSL--VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVT 58
           M +D+    ++ P+   L  + G  SG+     T P+DT+K R+Q    +  +Y   +  
Sbjct: 197 MVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQS--LDATKYTSTVNC 254

Query: 59  FKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY 93
           F ++ ++EG++  WKG  P +   IL G   FT Y
Sbjct: 255 FAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIY 289

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/307 (20%), Positives = 111/307 (36%), Gaps = 32/307 (10%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVR 69
           + V    S +AG L+G     +T P +  K RLQL           LV      + +G  
Sbjct: 6   KPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTG 65

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIH--TGMVGALSGTC--SAIA 125
           A++ G    +         +F  +  +  +L +  +  ++    G+V  L      S +A
Sbjct: 66  AIYVGCPAFIVGNTAKAGIRFLGFDTIKNML-RDPVTGELSGPRGVVAGLGAGLLESVVA 124

Query: 126 SYPCDVLRTRFIAN-------HSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXX 178
             P + ++T  I +       +      ML     + R +G  G ++G            
Sbjct: 125 VTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQ 184

Query: 179 XXXXXXYESVKIFCEQRPD--RDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVID 236
                 Y  +K   +   +  +D  +   L       +G+V+     PIDTV+ R Q +D
Sbjct: 185 AVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQSLD 244

Query: 237 WQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSL 296
             +                YTST  +     I ++EGL   + G T  + + + S  +  
Sbjct: 245 ATK----------------YTST--VNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVF 286

Query: 297 GVYEWCL 303
            +YE  L
Sbjct: 287 TIYENVL 293

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 82/188 (43%), Gaps = 12/188 (6%)

Query: 16  QSLVAGCLSGISARIVT-APLDTLKIRL-----QLQLANEAQYGGILVTFKRLVRQEGVR 69
           + +VAG  +G+   +V   P + +K  L      L+   +    G+L  +  LVR +G+ 
Sbjct: 108 RGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIM 167

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKLL------SKSQLPAQIHTGMVGALSGTCSA 123
            L++G +P         + +   Y  +  ++       K +  +   T +VGA SG  + 
Sbjct: 168 GLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTV 227

Query: 124 IASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXX 183
             + P D ++TR  +  + + ++ ++   +I++ EG + F+KG                 
Sbjct: 228 YTTMPIDTVKTRMQSLDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFT 287

Query: 184 XYESVKIF 191
            YE+V +F
Sbjct: 288 IYENVLVF 295

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 83/173 (47%), Gaps = 20/173 (11%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQL-ANEAQYGGILVTFKRLVRQ--- 65
            ++P+   +++G ++G +   + AP++  K +LQ+Q  A   +Y G +   +++ +Q   
Sbjct: 107 DKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMA 166

Query: 66  -----EGVRALWKGNVPAM---AMYILYGSTQFTSYAILNKLLSK-SQLPAQIHTGMVGA 116
                 GVR+L+KG +  +   + ++ +    + SY ++ +   K + L A       G 
Sbjct: 167 TNGILGGVRSLYKGLISTLIFRSNFVFW----WGSYELITQWFQKNTNLSAPAINFWAGG 222

Query: 117 LSGTCSAIAS-YPCDVLRTRFIAN--HSRELSTMLSTAQEIWRHEGFRGFFKG 166
           LS +     S YP DV++   + N  +     +  +   +I+R  G  GFFKG
Sbjct: 223 LSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKG 275

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 59/305 (19%), Positives = 119/305 (39%), Gaps = 38/305 (12%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQL-QLANEA--QYGGILVTFKRLVRQEGVRALWKG 74
            VAG  SG++   V  P DT+K+RLQ  Q+ + A  Q+ G L    + ++ +G+R L+ G
Sbjct: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72

Query: 75  NVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIH---TGMV--GALSGTCSAIASYPC 129
             P +  +I+  S    S      LL K   P       +G +  G ++G   +  + P 
Sbjct: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPV 132

Query: 130 DVLRTRFIANHSRELSTM---LSTAQEIWRH--------EGFRGFFKGXXXXXXXXXXXX 178
           ++ + +    +  + +     +   Q++++          G R  +KG            
Sbjct: 133 ELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG-LISTLIFRSNF 191

Query: 179 XXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQ 238
                 YE +  + ++  +  +  I       S   G    T  +P D V++     D  
Sbjct: 192 VFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFW--TSAYPSDVVKQVVLCND-- 247

Query: 239 QLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGV 298
                   + ++K++++  S         I  + G+   + G+     +S P+   +L  
Sbjct: 248 ------KYDGSFKSWRTAVSD--------IYRQRGIHGFFKGFLPSFLRSFPANAAALAA 293

Query: 299 YEWCL 303
           +E+ L
Sbjct: 294 FEFVL 298

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 104/241 (43%), Gaps = 30/241 (12%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVR---QEG----- 67
           +SL AG + G+ A +   P D LK+R Q   +N+A  G +    K LV    Q G     
Sbjct: 49  KSLAAGAVGGVCAVLTGHPFDLLKVRCQ---SNQAS-GTVDAVRKILVEARAQSGLSAVN 104

Query: 68  -VRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAIAS 126
            +R  +KG +P +       +  F  Y +  KL++ +    ++ T  + A +G  SAI +
Sbjct: 105 MMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQL-ATAGFISAIPT 163

Query: 127 Y----PCD----VLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXX 178
                P +    VL+T+  +NHS     + S A+ I    G R  F+G            
Sbjct: 164 TLVMAPTERVKVVLQTQ--SNHS-----LGSAAKHILATGGVRSLFRGSLATLARDGPGS 216

Query: 179 XXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQ 238
                 YE+ K +   R   +   I+ +   A  +AG+     VFPIDT++   Q  + +
Sbjct: 217 ALYFASYEATKAYLNARSGTNELSIKNV-CLAGGMAGVSMWVGVFPIDTIKTELQSSNTR 275

Query: 239 Q 239
           Q
Sbjct: 276 Q 276

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 67/136 (49%), Gaps = 7/136 (5%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYG----GILVTFKRLVRQEGVR 69
           + +S +AG ++G  A+ + APLD +KI  Q    +  +Y     G+L     +  ++ +R
Sbjct: 53  ILKSGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLR 112

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYA-ILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYP 128
            +++G+   +     Y + +F +Y  I N ++   +          G+L+G CS   +YP
Sbjct: 113 GVFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRRLCSGSLAGLCSVFCTYP 172

Query: 129 CDVLRTR--FIANHSR 142
            D++R R  ++  H +
Sbjct: 173 LDLIRVRLAYVTEHHK 188

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 77/203 (37%), Gaps = 53/203 (26%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRAL--- 71
           F+ L +G L+G+ +   T PLD +++RL      E     +    K++  +    AL   
Sbjct: 153 FRRLCSGSLAGLCSVFCTYPLDLIRVRLAY--VTEHHKVRVWPLVKQIYSEPASEALSSK 210

Query: 72  -------------WKGNVPAMAMYILYGSTQFTSYAILNKLL----------------SK 102
                        ++G +P +   I Y    F ++ + + +L                  
Sbjct: 211 AYVPKWFAQWCNFYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDA 270

Query: 103 SQLPAQIHTG--------------MVGALSGTCSAIASYPCDVLRTRF----IANH-SRE 143
             L   + T               + G L+G  S  A+YP +++R R     + N    +
Sbjct: 271 DDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHK 330

Query: 144 LSTMLSTAQEIWRHEGFRGFFKG 166
            ++M   A+ I+   G+RGFF G
Sbjct: 331 FTSMSEMAKIIFHERGWRGFFVG 353

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/137 (19%), Positives = 53/137 (38%), Gaps = 9/137 (6%)

Query: 101 SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRF------IANHSRELSTMLSTAQEI 154
           SK      + +G+ G ++G+C+     P D ++  F         ++     +L+    I
Sbjct: 46  SKQNFDYILKSGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHI 105

Query: 155 WRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIA 214
           W  +  RG F+G                  YE ++       + ++   +L   S   +A
Sbjct: 106 WSRDRLRGVFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRRLCSGS---LA 162

Query: 215 GIVSKTIVFPIDTVRKR 231
           G+ S    +P+D +R R
Sbjct: 163 GLCSVFCTYPLDLIRVR 179

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 13/91 (14%)

Query: 210 ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIV 269
           A  +AG+ S+T  +P + +R+R QV           TN     + S +      +A +I 
Sbjct: 296 AGGLAGMASQTAAYPFEIIRRRLQV--------GAVTNPLEHKFTSMS-----EMAKIIF 342

Query: 270 EKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
            + G    + G ++G  K  P    S  VYE
Sbjct: 343 HERGWRGFFVGLSIGYIKVTPMVACSFFVYE 373

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/325 (21%), Positives = 117/325 (36%), Gaps = 50/325 (15%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQ-----------------LQL 46
           D+       P+   L+AG  +GI    +  P+D LK R+Q                    
Sbjct: 10  DYEALPDTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAA 69

Query: 47  ANEAQYGGILVTFKRLVRQEGVRALWK-------GNVPAMAMYILYGSTQFTSYAILNKL 99
           +  A  G +L    R+   EG  ALW+       G  PA A+Y       F +Y    + 
Sbjct: 70  SGGAGAGTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVY-------FATYEFCKEQ 122

Query: 100 LSKSQLPAQIHTGMVGALSGTCSAIAS----YPCDVLRTRFIANHSRELSTMLSTAQEIW 155
           L  ++     H  +  A+SG  + +A+     P D ++ R         S+M   A  I+
Sbjct: 123 LIDAK-DFNTHQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIY 181

Query: 156 RHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAG 215
           ++EG   FF                    YES   F     +  ++    +      IAG
Sbjct: 182 KNEGPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFF----NPTNAYNPWIHCLCGGIAG 237

Query: 216 IVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLL 275
                +  P+D ++   Q+         G      +++K  T+  F + A  I +  G  
Sbjct: 238 ATCAAVTTPLDCIKTVLQIR--------GSDTVHVESFK--TANTFKKAAQAIWQSYGWK 287

Query: 276 ALYHGYTLGIAKSVPSTVVSLGVYE 300
             + G    +  ++P+T +S   YE
Sbjct: 288 GFWRGLQPRVISNIPATAISWTSYE 312

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 48/111 (43%), Gaps = 4/111 (3%)

Query: 193 EQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVI-DWQQLGHPGHTNKAYK 251
           E  PD      QL+   A   AGI+  +I+FPID ++ R Q + + +       +  A  
Sbjct: 12  EALPDTAPLSYQLI---AGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGA 68

Query: 252 AYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
           A     +   L+    I   EG LAL+ G    +  + P+  V    YE+C
Sbjct: 69  ASGGAGAGTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFC 119

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 6/95 (6%)

Query: 19  VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILV--TFKR----LVRQEGVRALW 72
           + G ++G +   VT PLD +K  LQ++ ++           TFK+    + +  G +  W
Sbjct: 231 LCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFW 290

Query: 73  KGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPA 107
           +G  P +   I   +  +TSY     LL   Q P+
Sbjct: 291 RGLQPRVISNIPATAISWTSYEFAKHLLFTKQEPS 325

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 77/191 (40%), Gaps = 40/191 (20%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKI------------------RLQLQLANEAQYG---- 53
           Q L+AG L+G    +   P + +K+                   +Q Q+ANE +      
Sbjct: 103 QLLMAGALTGTMESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKK 162

Query: 54  -----------------GILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAIL 96
                             +L T   L RQ G+RA +KG +P +   +     +FT++ +L
Sbjct: 163 PTLRSSYEALFPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTML 222

Query: 97  NKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSREL-STMLSTAQEIW 155
            +   K     +    ++G +S      A+ P DV++TR  A  S  L    ++ A  I+
Sbjct: 223 KQFAPKEYQNNEYFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIF 282

Query: 156 RHEGFRGFFKG 166
             EGF   +KG
Sbjct: 283 VEEGFAMLWKG 293

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 117/334 (35%), Gaps = 82/334 (24%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77
           + AG +SG+ +  +T P + LK  LQL     A        F+ L  Q  VR  + G   
Sbjct: 13  ITAGSVSGLFSATITYPFEFLKTGLQLHRNVVAAK-----PFEVLGYQ--VRTYFAGCSA 65

Query: 78  AMAMYILYGSTQFTSYAILNKLLSKSQLPAQ-----IHTGMVGALSGTCSAIASYPCDVL 132
                ++  S +F ++   ++ L    L        +   M GAL+GT  ++   P + +
Sbjct: 66  VNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALTGTMESLCIIPFENV 125

Query: 133 RTRFIAN----HSRELST-------------------------------------MLSTA 151
           +   I N    H R  +T                                     +L+TA
Sbjct: 126 KVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKLPTNVLTTA 185

Query: 152 QEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSAS 211
            E++R  G R +FKG                  +  +K F  +    +     LL     
Sbjct: 186 AELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQNNEYFATLL----- 240

Query: 212 VIAGIVSKTIVF----PIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALM 267
              G++S   V     P+D ++ R Q  D   L +    N AY+                
Sbjct: 241 ---GLISSCAVVGATQPLDVIKTRMQAKD-SVLLYRNSINCAYR---------------- 280

Query: 268 IVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
           I  +EG   L+ G+   + K   S  VS G+Y++
Sbjct: 281 IFVEEGFAMLWKGWLPRLMKVGLSGSVSFGIYQY 314

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           G +S  +    T PLD +K R+Q + +       I   + R+  +EG   LWKG +P + 
Sbjct: 241 GLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAY-RIFVEEGFAMLWKGWLPRLM 299

Query: 81  MYILYGSTQFTSYAILNKLLS 101
              L GS  F  Y     +++
Sbjct: 300 KVGLSGSVSFGIYQYTENMIA 320

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/320 (21%), Positives = 124/320 (38%), Gaps = 60/320 (18%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQL-QLANEAQYGGILVTFKRLVRQEGVR 69
           +V    S +AG L+G +   +T P +  K RLQL   A++A    +++ +K   + +G+ 
Sbjct: 9   DVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKT-AKTQGIG 67

Query: 70  ALWKGNVPAMAMYILYGST-----QFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAI 124
           +++ G  PA     + G+T     +F  +  +  +L  S+          G LSGT   I
Sbjct: 68  SIYVG-CPAF----IIGNTAKAGIRFLGFDTIKDMLRDSE---------TGELSGTRGVI 113

Query: 125 ASY------------PCDVLRTRFIANHSRELSTMLSTAQEIWRH-------EGFRGFFK 165
           A              P + ++T  I +         +  + + R+       +GF G ++
Sbjct: 114 AGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYR 173

Query: 166 GXXXXXXXXXXXXXXXXXXYESVKIFCEQRPD--RDSSVIQLLESSASVIAGIVSKTIVF 223
           G                  Y  +K   +   D  +D  +   L       +GIV+     
Sbjct: 174 GVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTM 233

Query: 224 PIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTL 283
           P+DTV+ R Q +D  +                Y+ST  +     I ++EGL   + G T 
Sbjct: 234 PLDTVKTRMQSLDSTK----------------YSST--MNCFATIFKEEGLKTFWKGATP 275

Query: 284 GIAKSVPSTVVSLGVYEWCL 303
            + + V S  +   +YE  L
Sbjct: 276 RLGRLVLSGGIVFTIYEKVL 295

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 1   MAEDHLRKGQEVPVFQSL--VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVT 58
           + +D+    ++ P+   L  + G  SGI     T PLDT+K R+Q    +  +Y   +  
Sbjct: 199 LIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQS--LDSTKYSSTMNC 256

Query: 59  FKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY 93
           F  + ++EG++  WKG  P +   +L G   FT Y
Sbjct: 257 FATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIY 291

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 128/314 (40%), Gaps = 52/314 (16%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFK 60
           M+ED  +       ++ L+ G ++G   ++V  P DT+K+RLQ Q A  A +        
Sbjct: 1   MSEDADK------AYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSA--ALFPTTWSCVS 52

Query: 61  RLVRQEGVRALWKGNVPAMAMYI----LYGSTQFTSY----AILNKLLSKSQLPAQIHTG 112
              +QEG   LW+G    MA  +    L  +  F S+    A+L    S   L   +   
Sbjct: 53  HTYKQEG---LWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEKVV--- 106

Query: 113 MVGALSGTCSAIASYPCDVLRTRFIANHSRELS-----TMLSTAQEIWRHEGFRGFFKGX 167
             GA++G C++    P ++++ +   ++   +S      +L T + I +  G  G ++G 
Sbjct: 107 FAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQ 166

Query: 168 XXXXXXXXXXXXXXXXXYESVK-IFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPID 226
                            YE +K     +R   +++V +LL S A   A   +   +FP D
Sbjct: 167 SGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHAS--IFPAD 224

Query: 227 TVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIA 286
           TV+   Q    + LG       A +                +++K G    Y G  + + 
Sbjct: 225 TVKSTMQT---EHLG----LGPAVRT---------------VLKKHGPTGFYRGVGITLL 262

Query: 287 KSVPSTVVSLGVYE 300
           +++P+  V   VYE
Sbjct: 263 RALPANAVIFYVYE 276

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 76/165 (46%), Gaps = 10/165 (6%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA----QYGGILVTFKRLVRQ 65
           + +P     V+G  +G+S  +V  PLD +K R+QLQ+ +       Y G++    ++V++
Sbjct: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFT---SY-AILNKLLSKSQLPAQIHTGMVGALSGTC 121
           EG   L+KG    M M     +T+F    SY  +   L    +L  QI   + G+L+G  
Sbjct: 64  EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI-LSGSLAGVT 122

Query: 122 SAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
            A    P ++++ R    +S+    M    + I R  G    + G
Sbjct: 123 EACVIVPFELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNG 166

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 70/162 (43%), Gaps = 15/162 (9%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76
           S+++G L+G++   V  P + +KIR  LQ  N    G + V FK  +R+ G+ +L+ G  
Sbjct: 112 SILSGSLAGVTEACVIVPFELVKIR--LQDVNSKFNGPMEVVFKT-IRETGILSLYNGLE 168

Query: 77  PAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG--MVGALSGTCSAIASYPC-DVLR 133
             M     +    F     +  LL K++   +  T   + G + G C     +    V++
Sbjct: 169 STMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVK 228

Query: 134 TRFIANHSRELSTMLSTAQ---------EIWRHEGFRGFFKG 166
           +R  +  +  L+      +         +I+  EGF   +KG
Sbjct: 229 SRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKG 270

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 78/164 (47%), Gaps = 20/164 (12%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQ---LANEAQYGGILVTFKRLVRQEGVRALW 72
           Q  V G  SG +   +  P++ ++IRLQLQ   LAN A+Y G L   ++L++Q    AL 
Sbjct: 120 QYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLAN-AEYQGSLDCMRKLLKQG---ALM 175

Query: 73  KGNVPAMAMYILYG-STQFTSYAILNKLLSKSQLP----AQIHTGMVGALSGTCSAIASY 127
           +G   A  M   +G    F++Y  L     K  +P    A     + GA SG C    +Y
Sbjct: 176 RG-FTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAY 234

Query: 128 PCDVLRTRFIANHSRELSTMLST-----AQEIWRHEGFRGFFKG 166
           P DV+++  I    R +S +  T     A+ I+   G R F KG
Sbjct: 235 PIDVVKS--IMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKG 276

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 55/128 (42%), Gaps = 13/128 (10%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           + +++G   GI+  +V  P D  K+R+Q   A  A    ++ +   L++ EG+   +KG 
Sbjct: 25  KDILSGTAGGIAQVLVGQPFDITKVRMQTS-AGSATAVDVVTS---LIKNEGILGFYKGT 80

Query: 76  VPAMAMYILYGSTQF-------TSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYP 128
           +  +       S QF         +  +N   SK     Q +  + G  SG  +A  + P
Sbjct: 81  LAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQYY--VCGVASGCANAFLATP 138

Query: 129 CDVLRTRF 136
            + +R R 
Sbjct: 139 IEHVRIRL 146

>Scas_582.7
          Length = 329

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 65/304 (21%), Positives = 118/304 (38%), Gaps = 38/304 (12%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQ--LQLANEAQYGGILVTFKRLVRQEGV 68
             P+   L+AG  +GI       P+D LK R+Q       E     I+    ++   EG 
Sbjct: 33  HAPLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGS 92

Query: 69  RALWK-------GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTC 121
            ALWK       G  PA A+Y  + + +FT   ++     ++  P ++      A+SG  
Sbjct: 93  LALWKGVQSVILGAGPAHAVY--FATYEFTKAHLIPDSQRETHQPIKV------AVSGAT 144

Query: 122 SAIAS----YPCDVLRTRF-IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXX 176
           + +AS     P D ++ R  I++  +E   + + A++I+  EG   F+            
Sbjct: 145 ATVASDFFMNPFDTIKQRMQISDLKKE--KVYNVAKKIYNLEGLSAFYYSYPTTIAMNIP 202

Query: 177 XXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVID 236
                   YES   F       +     L+      I+G ++  +  P+D ++   Q+  
Sbjct: 203 FAAFNFMIYESASKFFNPLHHYN----PLIHCLCGGISGAIAAAVTTPLDCIKTVIQI-- 256

Query: 237 WQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSL 296
                  G +  + +  K   +  F +    I+   G    + G    I  ++P+T +S 
Sbjct: 257 ------RGSSVVSLEVMKK--ANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISW 308

Query: 297 GVYE 300
             YE
Sbjct: 309 TAYE 312

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 17/98 (17%)

Query: 204 QLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLR 263
           QLL   A   AGI+  + +FPID ++ R Q            T K  +     TST+ ++
Sbjct: 39  QLL---AGAFAGIMEHSTMFPIDALKTRIQ----------STTTKGTEQ----TSTSIIK 81

Query: 264 LALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
               I   EG LAL+ G    I  + P+  V    YE+
Sbjct: 82  QISKISTMEGSLALWKGVQSVILGAGPAHAVYFATYEF 119

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 77/177 (43%), Gaps = 19/177 (10%)

Query: 5   HLRKGQEVP-----VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILV 57
           H R G   P     + Q  + G   G +   + +P++ ++IRLQ Q      AQ+ G L 
Sbjct: 106 HSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLD 165

Query: 58  TFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAI-----LNKLLSKSQLPAQIHTG 112
             K+L       +L +G  P M          F +Y       L+K +S+S++P      
Sbjct: 166 CIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTW-KLC 221

Query: 113 MVGALSGTCSAIASYPCDVLRTRFIAN---HSRELSTMLSTAQEIWRHEGFRGFFKG 166
           + GA SGT   +  YP DV+++    +     ++   ML  A+ I+   G   FFKG
Sbjct: 222 LFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKG 278

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 14 VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73
          VF+ L+AG   G+S  ++  P DT K+RLQ            L   K+LV+ EG R  +K
Sbjct: 23 VFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA----LDVVKKLVKNEGFRGFYK 78

Query: 74 GNV 76
          G +
Sbjct: 79 GTL 81

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 49/125 (39%), Gaps = 5/125 (4%)

Query: 113 MVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXX 172
           + G   G    +   P D  + R     S   +T L   +++ ++EGFRGF+KG      
Sbjct: 28  LAGTAGGVSQVLIGQPFDTTKVRL--QTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLV 85

Query: 173 XXXXXXXXXXXXYESVKIFCEQRPDRD--SSVIQLLESSASVIAGIVSKT-IVFPIDTVR 229
                        E++K F   R      +  + LL+      AG  + + +  PI+ VR
Sbjct: 86  GVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVR 145

Query: 230 KRYQV 234
            R Q 
Sbjct: 146 IRLQT 150

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 44/101 (43%), Gaps = 4/101 (3%)

Query: 4   DHLRKG---QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ-LANEAQYGGILVTF 59
           + L KG    E+P ++  + G  SG +  ++  PLD +K  +Q   L    Q   +L   
Sbjct: 204 NELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVA 263

Query: 60  KRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
           K +    G+ + +KG  P M          F ++ +  ++L
Sbjct: 264 KTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304

>Scas_715.45
          Length = 305

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 76/149 (51%), Gaps = 14/149 (9%)

Query: 28  ARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87
           A I+  P + +K++ Q  +        ++  +K++  +EG+   +KG  P     I Y  
Sbjct: 129 ADIMLCPFEAIKVKQQTTMPPWCN--NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTM 186

Query: 88  TQFTSY-----AILNKLLS-KSQLPA--QIHTGMVGA-LSGTCSAIASYPCDVLRTRFIA 138
            +FTS+     AI  +L + KS++ A  QI    VG  ++G   AI S+P DV+ ++   
Sbjct: 187 CKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKI-- 244

Query: 139 NHSRELSTMLSTA-QEIWRHEGFRGFFKG 166
           N+ R+++  ++ A + I+   GF G + G
Sbjct: 245 NNERKVNESMNVALKRIYSRIGFVGLWNG 273

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 71/159 (44%), Gaps = 20/159 (12%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG- 74
           +S  AG L GI   IV  PLD LKI+ Q    N   + G    F ++++ EG   L++G 
Sbjct: 121 RSATAGSLIGI-GEIVLLPLDVLKIKRQ---TNPESFKG--RGFLKIIKDEGF-GLYRGW 173

Query: 75  ------NVPAMAMYILYGSTQFTSYAILN-KLLSKSQLPAQIHTGMVGALSGTCSAIASY 127
                 N P    + L+G   F    IL  K   ++       + +VGA   + S I S 
Sbjct: 174 GWTAARNAPGS--FALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGA---SASLIVSA 228

Query: 128 PCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           P DV++TR    +     +     +   ++EGF  FFKG
Sbjct: 229 PLDVIKTRIQNRNFDNPESGFKIIKNTLKNEGFTAFFKG 267

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           Q+ V+  +   ++ IV+APLD +K R+Q +  +  + G  ++  K  ++ EG  A +KG 
Sbjct: 211 QNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKII--KNTLKNEGFTAFFKGL 268

Query: 76  VPAM 79
            P +
Sbjct: 269 TPKL 272

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 73/159 (45%), Gaps = 20/159 (12%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG- 74
           +S  AG L GI   IV  PLD LKI+ Q    N   + G    F R++R EG+  L++G 
Sbjct: 120 RSATAGSLIGI-GEIVLLPLDVLKIKRQ---TNPESFRG--RGFLRILRDEGM-GLYRGW 172

Query: 75  ------NVPAMAMYILYGSTQFTSYAILN-KLLSKSQLPAQIHTGMVGALSGTCSAIASY 127
                 N P    + L+G   F    IL  K  S++       + + GA   + S I S 
Sbjct: 173 GWTAARNAPGS--FALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGA---SASLIVSA 227

Query: 128 PCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           P DV++TR  + +     +  +  +   ++EG   FFKG
Sbjct: 228 PLDVIKTRIQSRNFESAESGFTIVKNTLKNEGATAFFKG 266

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 62/306 (20%), Positives = 117/306 (38%), Gaps = 51/306 (16%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77
           L+ G + G+++ IV  P D LK RLQ Q  +   +G    T K +      + LW+G +P
Sbjct: 11  LIGGFVGGLTSAIVLQPFDLLKTRLQ-QNKDTTLWG----TLKEI---RSPKQLWRGALP 62

Query: 78  AMAMYILYGSTQFTSYAILNKLLSKSQ----------LP--AQIHTGMVGALSGTCSAIA 125
           +     +  +   ++  +    ++K +          LP          GA +       
Sbjct: 63  SSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFI 122

Query: 126 SYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXY 185
           + P  +++ R+ +       ++    + I+  EG RGFF G                  Y
Sbjct: 123 TMPITIIKVRYESTM-YSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLY 181

Query: 186 ESVKIFCEQR-PDRDSSVIQ----------LLESSASVIAGIVSKTIVFPIDTVRKRYQV 234
           E  K+      P    S  +          ++ S ++ ++  ++ TI  P DT++ R Q 
Sbjct: 182 EKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQ- 240

Query: 235 IDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVV 294
           +D  +                   + F +  ++IV KE    L+ G TL + +   S  +
Sbjct: 241 LDPTKF------------------SGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGI 282

Query: 295 SLGVYE 300
           + G+YE
Sbjct: 283 AWGIYE 288

>Scas_718.5
          Length = 324

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 80/160 (50%), Gaps = 12/160 (7%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQL--ANEAQYGGILVTFKRLVRQEGVRALWK 73
           Q  + G   G+    + +P++ ++IRLQ Q    NE ++ G L   ++LV++   ++L +
Sbjct: 141 QYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMR 197

Query: 74  GNVPAMAMYILYGSTQFTSY-AILNKLLSKSQLPAQIHTGMV---GALSGTCSAIASYPC 129
           G  P M          F +Y A++   + K +  ++I +  +   G+LSG    +A YP 
Sbjct: 198 GLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPL 257

Query: 130 DVLRTRFIAN---HSRELSTMLSTAQEIWRHEGFRGFFKG 166
           DV+++    +   + R  ++M +    ++R +G   FFKG
Sbjct: 258 DVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKG 297

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/315 (20%), Positives = 120/315 (38%), Gaps = 44/315 (13%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFK 60
           MA+D  R      V + ++AG   GIS  IV  P DT K+R+Q      A+  G L   +
Sbjct: 32  MAKDSTR------VLKDILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIR 81

Query: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK--SQLPAQIHTG------ 112
           +LV+ EGV A +KG++  +       S QF     + +   +  +    Q   G      
Sbjct: 82  KLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQ 141

Query: 113 --MVGALSGTCSAIASYPCDVLRTRFIA----NHSRELSTMLSTAQEIWRHEGFRGFFKG 166
             + G   G  ++  + P + +R R        + RE    L   +++ +    +   +G
Sbjct: 142 YYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRG 198

Query: 167 XXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLE-SSASVIAGIVSKTIVFPI 225
                             YE++ I  E +  +D S I   +  S   ++G+V    ++P+
Sbjct: 199 LRPMMLRAGHGLGCYFLTYEAL-IANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPL 257

Query: 226 DTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGI 285
           D V+   Q      L +P   N                    +  ++G+ A + G+   +
Sbjct: 258 DVVKSMIQT---DTLRNPRFKNSMKNVINH------------LYREQGISAFFKGFAPTM 302

Query: 286 AKSVPSTVVSLGVYE 300
            ++ P    +   +E
Sbjct: 303 LRAAPVNGATFVTFE 317

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 4/101 (3%)

Query: 4   DHLRKGQ---EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ-LANEAQYGGILVTF 59
           + ++KG+   E+  ++    G LSG+   +   PLD +K  +Q   L N      +    
Sbjct: 223 NEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVI 282

Query: 60  KRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
             L R++G+ A +KG  P M          F ++ ++ +LL
Sbjct: 283 NHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 94/242 (38%), Gaps = 28/242 (11%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANE---------------AQYGGILVTFK 60
           ++LVAG + G+ A +   P D +K+R Q   A                 +   G L T  
Sbjct: 23  KALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTT-- 80

Query: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLS---KSQLP---AQIHTGMV 114
            L  +  V+  +KG +P +       +  F  Y I  +L++    S  P   AQ+ T   
Sbjct: 81  SLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMATA-- 138

Query: 115 GALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXX 174
           G +S   + + + P + ++     N S    + +  A+ I    G +  F G        
Sbjct: 139 GFISAIPTTLVTAPTERIKVVLQTN-SEFKGSFIKAAKHIVSTGGVKSLFNGSLATLARD 197

Query: 175 XXXXXXXXXXYESVKIFCEQR-PDRDSSVIQLLESS-ASVIAGIVSKTIVFPIDTVRKRY 232
                     YE  K F  +    +D   + L     A  IAG+    +VFPIDT++ R 
Sbjct: 198 GPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRL 257

Query: 233 QV 234
           QV
Sbjct: 258 QV 259

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 7   RKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQE 66
           +   EV +    +AG ++G+S  +V  P+DT+K RLQ+     +    +  T    +++ 
Sbjct: 222 KDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATTPISM---VQATKDIYIQRG 278

Query: 67  GVRALWKGNVPAM 79
           G++  + G  PA+
Sbjct: 279 GIKGFFPGLGPAL 291

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 104/266 (39%), Gaps = 22/266 (8%)

Query: 50  AQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAIL--NKLLSKSQLPA 107
           A+  G L   +++ + EG+  LW+G    + M +      F+ Y  L  N  L+ S+LP 
Sbjct: 78  ARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRDNSPLA-SRLPV 136

Query: 108 QIHTGMVGALSGTCSAIASYPCDVLRTRFIA-----NHSRELSTMLSTAQEIWRHE---- 158
             +  + GA +   +A    P ++LRTR  +     +  R +  +    +E+ RHE    
Sbjct: 137 A-NPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREM-RHEVSVM 194

Query: 159 GFRGFFKGXXXXXXXXXXXXXXXXXXYESVK--IFCEQRPDRDSSVIQLLESSASV--IA 214
           G+R  FKG                  YE  K   +       ++S       S +   + 
Sbjct: 195 GYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMG 254

Query: 215 GIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGL 274
           G V+  +  P D  + R Q+     +  P       KA K+  S         I + EG+
Sbjct: 255 GAVAALLTHPFDVGKTRMQI----AIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGI 310

Query: 275 LALYHGYTLGIAKSVPSTVVSLGVYE 300
            ALY G    + K  PS  + +  YE
Sbjct: 311 RALYTGLLPRVMKIAPSCAIMISTYE 336

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 80/193 (41%), Gaps = 32/193 (16%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQ-LQLANEAQ-----YGGILV 57
           D+      +PV   LV G  + I A    APL+ L+ RLQ +  A + +      G +L 
Sbjct: 126 DNSPLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLR 185

Query: 58  TFKRLVRQEGVRALWKG-------NVPAMAMYILYGSTQFTS---YAILNKLLSKSQLPA 107
             +  V   G RAL+KG       +VP  A+Y  +G+ +F     +A      + S    
Sbjct: 186 EMRHEVSVMGYRALFKGLEITLWRDVPFSAIY--WGTYEFCKTQFWARHAATHNASNWDH 243

Query: 108 QIHTGMVGALSGTCSAIASYPCDVLRTRF--------------IANHSRELSTMLSTAQE 153
            I +   G++ G  +A+ ++P DV +TR                A  + +   M S    
Sbjct: 244 FIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNA 303

Query: 154 IWRHEGFRGFFKG 166
           I + EG R  + G
Sbjct: 304 IRKSEGIRALYTG 316

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 12/97 (12%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQY--GGI---------LVTFKRLVRQ 65
           S   G + G  A ++T P D  K R+Q+ +A+  Q   GG          + +F   +R+
Sbjct: 247 SFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRK 306

Query: 66  -EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLS 101
            EG+RAL+ G +P +       +   ++Y +  K  +
Sbjct: 307 SEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFFT 343

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 40/91 (43%), Gaps = 12/91 (13%)

Query: 213 IAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKS-YTSTNFLRLALMIVEK 271
            A I++ T + P++ +R R Q +            +A    ++ Y   + LR     V  
Sbjct: 145 FARILAATTIAPLELLRTRLQSVP-----------RARDTERTIYLIGDLLREMRHEVSV 193

Query: 272 EGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
            G  AL+ G  + + + VP + +  G YE+C
Sbjct: 194 MGYRALFKGLEITLWRDVPFSAIYWGTYEFC 224

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 48.1 bits (113), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 14/106 (13%)

Query: 196 PDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKS 255
           P  D ++  L + +   I+G V++T+V+P D +R+R+QV+        G     ++ YKS
Sbjct: 2   PVTDPNLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAM------GGNELGFR-YKS 54

Query: 256 YTSTNFLRLALMIVEK-EGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
            +       AL+ + K EG    Y G T  + K +PST VS  VYE
Sbjct: 55  VSD------ALITIGKTEGPKGYYKGLTANLFKVIPSTAVSWLVYE 94

 Score = 34.7 bits (78), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 6/66 (9%)

Query: 107 AQIHTGMVGALSGTCSAIASYPCDVLRTRF--IANHSRELSTMLSTAQE----IWRHEGF 160
           A ++   +GA+SG  +    YP D+LR RF  +A    EL     +  +    I + EG 
Sbjct: 9   ANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGP 68

Query: 161 RGFFKG 166
           +G++KG
Sbjct: 69  KGYYKG 74

>Kwal_47.19228
          Length = 281

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 60/114 (52%), Gaps = 3/114 (2%)

Query: 55  ILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMV 114
            L T + + R  G+R   +G +P +       + +FT+Y  L +++S ++   + +   +
Sbjct: 131 FLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYAFAL 190

Query: 115 GALSGTCSAIA-SYPCDVLRTRFIANHS-RELSTMLSTAQEIWRHEGFRGFFKG 166
           G +S +C+ +A + P DV++TR  + ++       L+ A  I+  EGF  F+KG
Sbjct: 191 GFIS-SCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKG 243

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 61/157 (38%), Gaps = 25/157 (15%)

Query: 147 MLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK-IFCEQRPDRDSSVIQL 205
            L+T QEI+R  G RGF +G                  Y S+K +    +P  +     L
Sbjct: 131 FLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYAFAL 190

Query: 206 -LESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRL 264
              SS +V+A      +  PID ++ R Q            +   +  YK     N L  
Sbjct: 191 GFISSCAVVA------VTQPIDVIKTRMQ------------SKYTWSNYK-----NSLNC 227

Query: 265 ALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
           A  I  +EG    + G+   + K   S  VS GVY++
Sbjct: 228 AYRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQY 264

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 1/86 (1%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG 74
           + +   G +S  +   VT P+D +K R+Q +    + Y   L    R+  +EG    WKG
Sbjct: 185 YYAFALGFISSCAVVAVTQPIDVIKTRMQSKYT-WSNYKNSLNCAYRIFVEEGFTKFWKG 243

Query: 75  NVPAMAMYILYGSTQFTSYAILNKLL 100
             P +    L G   F  Y  ++ L+
Sbjct: 244 WAPRLMKVGLSGGVSFGVYQYVDNLM 269

>Scas_669.6
          Length = 373

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 64/135 (47%), Gaps = 20/135 (14%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQ-------LANEAQYGGILVTFKRLVRQEGVRA 70
           L AG L    +  V  P + LK RLQLQ         +   Y  +    + +V  EGV+A
Sbjct: 150 LSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKA 209

Query: 71  LWKGNVPAMAMYILYGSTQF--------TSYAILNKLLSKSQL--PAQIHTGMVGALSGT 120
           L+ G    +A  + + + QF        T++ +  K ++K  L  P +I TG   A++G 
Sbjct: 210 LFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTG---AIAGG 266

Query: 121 CSAIASYPCDVLRTR 135
            + I + P DV++TR
Sbjct: 267 LAGIITTPMDVIKTR 281

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 11/93 (11%)

Query: 209 SASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLAL-M 267
           SA ++   VS  +  P + ++ R Q+         G  N  +  ++S  +   LR A+ +
Sbjct: 151 SAGLLGDFVSSFVYVPSEVLKTRLQL--------QGRVNNPF--FQSGYNYRSLRTAIRI 200

Query: 268 IVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           IV  EG+ AL+ GY   +A+ +P + +  G YE
Sbjct: 201 IVNTEGVKALFFGYKATLARDLPFSALQFGFYE 233

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 33/79 (41%), Gaps = 18/79 (22%)

Query: 225 IDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLL-ALYHGYTL 283
           +DTV+ R Q       G P      YK   +   T FL        +EG+   LY GY  
Sbjct: 72  LDTVKTRQQ-------GAP--MTPKYKNMTTAYRTIFL--------EEGIARGLYGGYFA 114

Query: 284 GIAKSVPSTVVSLGVYEWC 302
            +  S PS  +  G YEWC
Sbjct: 115 AMLGSFPSAAIFFGTYEWC 133

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 3   EDHLRKGQEVP--VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN 48
           +D  +    +P  +F   +AG L+GI    +T P+D +K RLQ Q A+
Sbjct: 245 KDITKHNLSIPNEIFTGAIAGGLAGI----ITTPMDVIKTRLQTQQAD 288

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 75/154 (48%), Gaps = 7/154 (4%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76
           ++ +G  +G     V AP + +KIRLQ      +Q+   +   K  V + GV +L+ G  
Sbjct: 125 AIYSGASAGAVEAFVVAPFELVKIRLQ---DVNSQFKTPIEVVKNSVVKGGVLSLFNGLE 181

Query: 77  PAMAMYILYGSTQFTSYAILNKLL--SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRT 134
             +  ++L+ +  F     + KLL  +K+      +  + GA+ GT   + + P DV+++
Sbjct: 182 ATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKS 241

Query: 135 RFIANHS--RELSTMLSTAQEIWRHEGFRGFFKG 166
           R   +    R+ +  L +   ++R EGF+  +KG
Sbjct: 242 RIQRSSGPLRKYNWSLPSVLLVYREEGFKALYKG 275

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/312 (19%), Positives = 118/312 (37%), Gaps = 46/312 (14%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA------------QYGGILV 57
           + +P      AG ++G+S  +V  PLD +K R+QLQ+  +              Y G++ 
Sbjct: 7   RPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMD 66

Query: 58  TFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK-SQLPAQIHTGMV-- 114
              ++V++EG   L+KG    + M     + +F+          K    P    T  +  
Sbjct: 67  CLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAI 126

Query: 115 --GALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRG----FFKGXX 168
             GA +G   A    P ++++ R      +++++   T  E+ ++   +G     F G  
Sbjct: 127 YSGASAGAVEAFVVAPFELVKIRL-----QDVNSQFKTPIEVVKNSVVKGGVLSLFNGLE 181

Query: 169 XXX-XXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDT 227
                            ++  K+    +   + +   L+   A  I G V   +  P D 
Sbjct: 182 ATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLI---AGAIGGTVGCLLNTPFDV 238

Query: 228 VRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAK 287
           V+ R Q              ++    + Y  +  L   L++  +EG  ALY G+   + +
Sbjct: 239 VKSRIQ--------------RSSGPLRKYNWS--LPSVLLVYREEGFKALYKGFAPKVMR 282

Query: 288 SVPSTVVSLGVY 299
             P   + L V+
Sbjct: 283 LAPGGGLLLVVF 294

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 74/178 (41%), Gaps = 25/178 (14%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ-------LANEAQYGGILVTFKRLVRQE 66
            +  L AG L  + + +V  P + LK RLQLQ         +   Y G+    + +VR E
Sbjct: 148 TYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTE 207

Query: 67  GVRALWKGNVPAMAMYILYGSTQFTSYAILNK---LLSKSQLPAQIHTG---MVGALSGT 120
           GV AL+ G    ++  + + + QF  Y    K   LL +  +   +      + GA +G 
Sbjct: 208 GVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAGG 267

Query: 121 CSAIASYPCDVLRTRFIANHSRELSTMLSTAQE------------IWRHEGFRGFFKG 166
            + I + P DV++TR          T  ++A              + R+EG  G F G
Sbjct: 268 LAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSG 325

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 101/262 (38%), Gaps = 26/262 (9%)

Query: 35  LDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGV-RALWKGNVPAMAMYILYGSTQFTSY 93
           LDT+K R Q     E +Y  ++  ++ L  +EGV R L+ G   AM       +  F +Y
Sbjct: 74  LDTVKTR-QQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFFGTY 132

Query: 94  A-ILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTR-----------FIANHS 141
             +  +++++ Q+         G L    S++   P +VL+TR           F + ++
Sbjct: 133 EWVKRQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYN 192

Query: 142 -RELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK--IFCEQRPDR 198
            R LS  + T   I R EG    F G                  YE  +   F  +R   
Sbjct: 193 YRGLSDAVRT---IVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPV 249

Query: 199 DSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTS 258
           D  +    E      AG ++  I  P+D V+ R Q       G P  +  A        +
Sbjct: 250 DGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPA------RLN 303

Query: 259 TNFLRLALMIVEKEGLLALYHG 280
            +  R  L+++  EGL   + G
Sbjct: 304 GSIFRSLLVVLRYEGLGGAFSG 325

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 38/87 (43%), Gaps = 22/87 (25%)

Query: 219 KTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAY--KAYKSYTSTNFLRLALMIVEKEGLL- 275
            +++  +DTV+ R Q       G PG     +   AY++        LAL    +EG+  
Sbjct: 68  DSVMHSLDTVKTRQQ-------GAPGEVKYRHMISAYRT--------LAL----EEGVRR 108

Query: 276 ALYHGYTLGIAKSVPSTVVSLGVYEWC 302
            LY GY   +  S PS  V  G YEW 
Sbjct: 109 GLYGGYGAAMLGSFPSAAVFFGTYEWV 135

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 10/70 (14%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQ----------YGGILVTFKRLVRQEG 67
           +V G  +G  A I+T PLD +K R+Q Q    A            G I  +   ++R EG
Sbjct: 259 VVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEG 318

Query: 68  VRALWKGNVP 77
           +   + G  P
Sbjct: 319 LGGAFSGVGP 328

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 44/93 (47%), Gaps = 11/93 (11%)

Query: 209 SASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTS-TNFLRLALM 267
           +A  +  + S  +  P + ++ R Q+          + N+ +++  +Y   ++ +R    
Sbjct: 153 AAGFLGDLFSSVVYVPSEVLKTRLQLQGC-------YNNRHFQSGYNYRGLSDAVR---T 202

Query: 268 IVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           IV  EG+ AL+ GY   +++ +P + +    YE
Sbjct: 203 IVRTEGVSALFFGYKATLSRDLPFSALQFAFYE 235

>Scas_602.8
          Length = 885

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 126/309 (40%), Gaps = 47/309 (15%)

Query: 13  PVFQSL-------VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQ 65
           P+F S+       VAGC   I A +V  P+D +K R+Q Q +   +Y   +    ++  +
Sbjct: 494 PIFDSIFNFSLGSVAGC---IGATLV-YPIDFIKTRMQAQRS-LTKYKNSIDCLVKIFGK 548

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAILNK-LLSKS---QLPAQIHTGMVGALSGTC 121
           EG+R L+ G  P +       + + T    + K L+ K    QL A++   + GA +G C
Sbjct: 549 EGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMRKSLVDKKGNLQLGAEV---LSGATAGAC 605

Query: 122 SAIASYPCDVLRTRFIANHSRELSTMLSTAQ----EIWRHEGFRGFFKGXXXXXXXXXXX 177
             + + P ++++ R +   S   + M+  +Q    +I +     G +KG           
Sbjct: 606 QVVFTNPLEIVKIR-LQVKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPF 664

Query: 178 XXXXXXXYESVK--IFCEQRPDRDS----SVIQLLESSASVIAGIVSKTIVFPIDTVRKR 231
                  Y  +K  +F     D+D        +LL  +A  +AG+ +  +  P D ++ R
Sbjct: 665 SAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELL--TAGALAGVPAAFLTTPFDVIKTR 722

Query: 232 YQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPS 291
            Q+        PG     Y        T  L     I+++E   + + G    + +S P 
Sbjct: 723 LQI-------EPGVGETRY--------TGILHAVRTILKEESFRSFFKGGAARVMRSSPQ 767

Query: 292 TVVSLGVYE 300
              +L  YE
Sbjct: 768 FGFTLAAYE 776

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 8   KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLA-NEAQYGGILVTFKRLVRQE 66
           K   +  ++ L AG L+G+ A  +T P D +K RLQ++    E +Y GIL   + ++++E
Sbjct: 689 KRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHAVRTILKEE 748

Query: 67  GVRALWKG 74
             R+ +KG
Sbjct: 749 SFRSFFKG 756

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 37/89 (41%), Gaps = 17/89 (19%)

Query: 213 IAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKE 272
           +AG +  T+V+PID ++ R Q              ++   YK     N +   + I  KE
Sbjct: 507 VAGCIGATLVYPIDFIKTRMQA------------QRSLTKYK-----NSIDCLVKIFGKE 549

Query: 273 GLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
           G+  LY G    +    P   + L V ++
Sbjct: 550 GIRGLYSGLGPQLIGVAPEKAIKLTVNDF 578

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 72/148 (48%), Gaps = 12/148 (8%)

Query: 28  ARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87
           A I+  P + +K++ Q  +    +    L  + ++   EG+  L+KG  P     I Y  
Sbjct: 126 ADILLCPWEAIKVKQQTTIPPFCK--NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTM 183

Query: 88  TQFTSYAILNKLL------SKSQLPA--QIHTGMVGA-LSGTCSAIASYPCDVLRTRFIA 138
            +FTS+  + +++      SK ++    QI    VG  L+G   A+ S+P DV+ ++  A
Sbjct: 184 CKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNA 243

Query: 139 NHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           +  ++  +M+  ++ I+   GF G + G
Sbjct: 244 DR-KQGESMVEASKRIYSRIGFGGLWNG 270

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 71/170 (41%), Gaps = 17/170 (10%)

Query: 10  QEVPVFQ-SLVAGC-LSGISARIVT----APLDTLKIRLQLQLANEAQYGGILVTFKRLV 63
           Q +P+F     A C L G+ A   T     PLD +K RLQ+   N   Y   L  +K +V
Sbjct: 5   QPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV---NPQLYRSNLDGWKTIV 61

Query: 64  RQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSA 123
           R EG+  ++ G       Y L G+ ++  Y    +  S    P   H     A+    SA
Sbjct: 62  RSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRT-AVYLCASA 120

Query: 124 IASYPCDVLRTRFIANHSRELSTM-------LSTAQEIWRHEGFRGFFKG 166
            A +  D+L   + A   ++ +T+       L    +I   EG  G +KG
Sbjct: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKG 170

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 2   AEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKR 61
           ++  +   Q++ V  S V G L+GI   +V+ P D +  ++    A+  Q   ++   KR
Sbjct: 203 SKQEMSPSQQIGV--SFVGGYLAGILCAVVSHPADVMVSKVN---ADRKQGESMVEASKR 257

Query: 62  LVRQEGVRALWKG 74
           +  + G   LW G
Sbjct: 258 IYSRIGFGGLWNG 270

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/311 (20%), Positives = 122/311 (39%), Gaps = 56/311 (18%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77
           L+ G   G+S+ +   PLD LK R Q     + + G +  T K L   +    LW+G +P
Sbjct: 8   LIGGFAGGLSSAVALQPLDLLKTRFQ-----QTKGGTLWQTVKSL---DTPWQLWRGTLP 59

Query: 78  AMAMYILYGSTQFTSYAILNKLLSK---------------SQLP--AQIHTGMVGALSGT 120
           +     +  +   +S  ++   L+K               S LP  +     + GA +  
Sbjct: 60  SAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARG 119

Query: 121 CSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXX 180
                + P  +++ R+ +       ++   A+ I   EG RGFF+G              
Sbjct: 120 TVGYITMPITIIKVRYESTL-YNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGL 178

Query: 181 XXXXYESVK-----IFCEQRPDRDSS------VIQLLESSASVIAGIVSKTIVFPIDTVR 229
               YE +K     I  +     DS           + S++++++  ++ T+  P DT++
Sbjct: 179 YVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIK 238

Query: 230 KRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSV 289
            R Q+        P      +K + S  +T        IV +E  + ++ G ++ + +  
Sbjct: 239 TRMQL-------EP----TKFKTFWSTLTT--------IVTQEHPIKIFSGLSMRLTRKA 279

Query: 290 PSTVVSLGVYE 300
            S  ++ G+YE
Sbjct: 280 LSAGIAWGIYE 290

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 64/141 (45%), Gaps = 18/141 (12%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRA 70
           ++ ++++LV G  +  +   +T P+  +K+R +  L N   Y  I    K +  QEG+R 
Sbjct: 104 QLSMYENLVTGAFARGTVGYITMPITIIKVRYESTLYN---YKSIAEAAKSIAAQEGIRG 160

Query: 71  LWKG-------NVPAMAMYI-LYGSTQFTSYAILNKLL----SKSQLPAQIHTGMVGA-- 116
            ++G       + P   +Y+ LY   + T   IL K L    S+ +  A   T +     
Sbjct: 161 FFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSA 220

Query: 117 -LSGTCSAIASYPCDVLRTRF 136
            LS + +   + P D ++TR 
Sbjct: 221 ILSASMATTVTAPFDTIKTRM 241

>Kwal_33.15597
          Length = 305

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 72/155 (46%), Gaps = 18/155 (11%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFKRLVRQEGVRALWKGNVPA 78
           GC +  SA +   P+D +K R+QL+  + N+    G++ +FK+++  EG  AL  G  P 
Sbjct: 23  GCGTTHSAMV---PIDVVKTRIQLEPTVYNK----GMISSFKQIISSEGAGALLTGFGPT 75

Query: 79  MAMYILYGSTQFTSYAILNKLLSKS-------QLPAQIHTGMVGALSGTCSAIASYPCDV 131
           +  Y L GS +F  Y +  KL   +            I+ G   A++   + IA  P + 
Sbjct: 76  LLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSA-AIAEFFADIALCPLEA 134

Query: 132 LRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
            R R ++  +   + ++     I + EG   F+ G
Sbjct: 135 TRIRLVSQPTFA-NGLVGGFSRILKEEGLSSFYNG 168

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 63/159 (39%), Gaps = 35/159 (22%)

Query: 28  ARIVTAPLDTLKIRL--QLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILY 85
           A I   PL+  +IRL  Q   AN     G++  F R++++EG+ + + G  P +   I Y
Sbjct: 125 ADIALCPLEATRIRLVSQPTFAN-----GLVGGFSRILKEEGLSSFYNGFTPILFKQIPY 179

Query: 86  GSTQFTSYAILNKLLSKSQLPAQIHTGMVGA------------------LSGTCSAIASY 127
              +F  +          +  A+++ GM G                    +G  +AI S 
Sbjct: 180 NIAKFLVF----------ERAAEVYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQ 229

Query: 128 PCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           P D L ++          + +    ++ +  GF G F G
Sbjct: 230 PADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAG 268

>Scas_558.2
          Length = 289

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 78/168 (46%), Gaps = 15/168 (8%)

Query: 7   RKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVR-- 64
           R    V     ++A  +  ++A +V  P + +K R Q+   N +       TF+ +++  
Sbjct: 92  RSPHSVDTIVHMIASSMGELAACLVRVPAEVIKQRTQVHSTNSSWQ-----TFRTILKNE 146

Query: 65  -QEGV-RALWKGNVPAMAMYILYGSTQFTSYAILNK---LLSKSQLPAQIHTGMV-GALS 118
            QEG+ R L++G    +   I +   QF  Y  + K   L        +   G + G+++
Sbjct: 147 NQEGIIRNLYRGWSTTIMREIPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIA 206

Query: 119 GTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           G  +A  + P D L+TR + N  ++   + S  + I++ EGF+ FF G
Sbjct: 207 GGIAAATTTPLDFLKTRLMLN--KDSIPIKSLIRNIYKEEGFKIFFSG 252

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 84/210 (40%), Gaps = 46/210 (21%)

Query: 105 LPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFF 164
           L A + + + GA +GT + +  +P D L+TR            L      +++ G+ G +
Sbjct: 3   LTAFVMSLLSGAAAGTSTDLVFFPIDTLKTR------------LQAKGGFFQNGGYHGIY 50

Query: 165 KGXXXXXXXXXXXXXXXXXXYESVKIFCE------------QRPDRDSSVIQLLESSASV 212
           +G                  Y+S+K+               + P    +++ ++ SS   
Sbjct: 51  RGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGE 110

Query: 213 IAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKE 272
           +A  + +    P + +++R QV           TN +++ +         R  L    +E
Sbjct: 111 LAACLVRV---PAEVIKQRTQV---------HSTNSSWQTF---------RTILKNENQE 149

Query: 273 GLL-ALYHGYTLGIAKSVPSTVVSLGVYEW 301
           G++  LY G++  I + +P T +   +YE+
Sbjct: 150 GIIRNLYRGWSTTIMREIPFTCIQFPLYEF 179

 Score = 31.2 bits (69), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 17 SLVAGCLSGISARIVTAPLDTLKIRLQ 43
          SL++G  +G S  +V  P+DTLK RLQ
Sbjct: 9  SLLSGAAAGTSTDLVFFPIDTLKTRLQ 35

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 75/160 (46%), Gaps = 15/160 (9%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEG-VRALWKGNV 76
           L+A   +   A I+  P + +K++ Q  +        ++  +K++  + G ++A +KG V
Sbjct: 113 LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN--NVVDGWKKMYAESGGMKAFYKGIV 170

Query: 77  PAMAMYILYGSTQFTS--------YAILNKLLSKSQLPAQIHTGMVGA-LSGTCSAIASY 127
           P     I Y   +FTS        Y++L K   +     QI    VG  L+G   A  S+
Sbjct: 171 PLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSH 230

Query: 128 PCDVLRTRFIANHSRELSTMLSTA-QEIWRHEGFRGFFKG 166
           P DV+ ++   N  R+ +  +S A + I++  GF G + G
Sbjct: 231 PADVMVSKI--NSERKANESMSVASKRIYQKIGFTGLWNG 268

>Scas_667.22
          Length = 306

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 75/161 (46%), Gaps = 14/161 (8%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLVRQEGVRALWK 73
           Q  + G   GI+   + +P++ ++IRLQ Q  +    ++ G L   ++L  Q G     +
Sbjct: 123 QYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMR 179

Query: 74  GNVPAMAMYILYGSTQFTSYAIL-----NKLLSKSQLPAQIHTGMVGALSGTCSAIASYP 128
           G  P M        T F  Y  +     NK   ++++PA     + GALSGT   +  YP
Sbjct: 180 GLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAW-KLCLFGALSGTTLWMMVYP 238

Query: 129 CDVLRTRFIANHSREL---STMLSTAQEIWRHEGFRGFFKG 166
            DV+++    ++ +     +++ S A+ ++   G   FFKG
Sbjct: 239 LDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKG 279

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/311 (18%), Positives = 116/311 (37%), Gaps = 33/311 (10%)

Query: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62
           E+H  K     V + L+AG   GI+  +V  P DT K+RLQ            +   ++L
Sbjct: 15  ENH-PKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVIRKL 69

Query: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL------SKSQLPAQIHTGMVGA 116
           ++ EG +  +KG +  +       S QF     + +        S SQ+ +     + G 
Sbjct: 70  LKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGL 129

Query: 117 LSGTCSAIASYPCDVLRTRFI----ANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXX 172
             G  ++  + P + +R R      +  + E    L   +++ R +G  GF +G      
Sbjct: 130 TGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTML 186

Query: 173 XXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRY 232
                       YE++      +  + + V          ++G     +V+P+D ++   
Sbjct: 187 REGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIK--- 243

Query: 233 QVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPST 292
            V+    L  P + N      K+            +  K GL A + G+   + ++ P+ 
Sbjct: 244 SVMQTDNLKSPKYGNSISSVAKT------------LYAKGGLGAFFKGFGPTMLRAAPAN 291

Query: 293 VVSLGVYEWCL 303
             +   +E  +
Sbjct: 292 GATFATFELAM 302

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 4/104 (3%)

Query: 1   MAEDHLRKG---QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILV 57
           M  + + KG    EVP ++  + G LSG +  ++  PLD +K  +Q       +YG  + 
Sbjct: 202 MVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSIS 261

Query: 58  TF-KRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
           +  K L  + G+ A +KG  P M          F ++ +  +LL
Sbjct: 262 SVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFELAMRLL 305

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 103/267 (38%), Gaps = 25/267 (9%)

Query: 51  QYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIH 110
           ++ G L  F+++ + EGV  LW+G    + M I      FT Y  +      + L   I+
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLNGLYPTIN 168

Query: 111 TGMVGALSGTCSAIASYPCDVLRTRF--IANHSRELSTML---STAQEIWRHEGFRG--- 162
             + GA + T +A +  P ++++T+   I + S +  +++       EI      RG   
Sbjct: 169 PLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQ 228

Query: 163 -FFKGXXXXXXXXXXXXXXXXXXYE----SVKIFCEQRPDRDSSVIQLLESSASVIAGIV 217
             FKG                  YE     V        D++SS       + S + G +
Sbjct: 229 TMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSS--NWFHFTNSFLGGFI 286

Query: 218 SKTI----VFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEG 273
           S ++      P D  + R Q+     +      N   K   S T   FL     I + EG
Sbjct: 287 SGSLAAICTHPFDVGKTRQQI---SLVTDKKLANSNLKYGSSNTMFGFLNY---IRKTEG 340

Query: 274 LLALYHGYTLGIAKSVPSTVVSLGVYE 300
           + ALY G    +AK  PS  + +  YE
Sbjct: 341 IGALYTGLAPRVAKIAPSCAIMISSYE 367

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 10/95 (10%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA-------QYG--GILVTFKRLVRQ- 65
            S + G +SG  A I T P D  K R Q+ L  +        +YG    +  F   +R+ 
Sbjct: 279 NSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKT 338

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
           EG+ AL+ G  P +A      +   +SY +  +L 
Sbjct: 339 EGIGALYTGLAPRVAKIAPSCAIMISSYELTKRLF 373

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 64/144 (44%), Gaps = 25/144 (17%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILV------TFKRLVRQE 66
           P    L+ G  +   A    APL+ +K +LQ   ++  + G +++        K  +   
Sbjct: 165 PTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMR 224

Query: 67  GV-RALWKG-------NVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQ-------IHT 111
           GV + ++KG       +VP  A+Y  + S +F  Y      LS S             ++
Sbjct: 225 GVAQTMFKGLEITLWRDVPFSAIY--WASYEF--YKTKVAYLSPSTFDKNSSNWFHFTNS 280

Query: 112 GMVGALSGTCSAIASYPCDVLRTR 135
            + G +SG+ +AI ++P DV +TR
Sbjct: 281 FLGGFISGSLAAICTHPFDVGKTR 304

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/317 (23%), Positives = 126/317 (39%), Gaps = 62/317 (19%)

Query: 30  IVTAPLDTLKIRLQ---LQLANEAQYGGILVT----------------FKRLV------- 63
           +VT P D +K RLQ    Q   ++Q   +++                 FK  V       
Sbjct: 72  VVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVY 131

Query: 64  RQEGVRALWKGNVPAMAMYILYGSTQFTSYA----ILNKLLSKSQLPAQIHTGMVGALSG 119
           RQEG R+L+KG  P +   I   S  F +Y     I +K  +  Q    IH  M  A +G
Sbjct: 132 RQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWIHL-MAAATAG 190

Query: 120 TCSAIASYPCDVLRTRF---IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXX 176
             +A A+ P  +++TR     A  +R         + I R+EG  G ++G          
Sbjct: 191 WATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVE 250

Query: 177 XXXXXXXXYESVKIFCEQRP-----DRDSSVIQLLE--------SSASVIAGIVSKTIVF 223
                   YE +K   ++R        D S +   +        S  + +A  ++  + +
Sbjct: 251 GILQWLL-YEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTY 309

Query: 224 PIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTL 283
           P + VR R +         P    K          T  ++   +I+++EGL ++Y G T 
Sbjct: 310 PHEVVRTRLR-------QSPLENGKV-------KYTGLVQSFRVIIKEEGLASMYSGLTP 355

Query: 284 GIAKSVPSTVVSLGVYE 300
            + ++VP++++  G +E
Sbjct: 356 HLMRTVPNSIIMFGTWE 372

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 23  LSGISARIVTAPLDTLKIRL-QLQLAN-EAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           L+   A IVT P + ++ RL Q  L N + +Y G++ +F+ ++++EG+ +++ G  P + 
Sbjct: 299 LAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLM 358

Query: 81  MYILYGSTQFTSYAILNKLLS 101
             +      F ++ ++ KLLS
Sbjct: 359 RTVPNSIIMFGTWEVVIKLLS 379

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/286 (19%), Positives = 112/286 (39%), Gaps = 35/286 (12%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           G  +GI A + T PLD  K+RLQ   A       I+   + +++ EG+  L+ G   ++ 
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQ---AAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLL 69

Query: 81  MYILYGSTQFTSY-AILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIAN 139
               Y + +F  Y A+   ++ + +L    +      +SG    +A    D++  R   +
Sbjct: 70  RQCTYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNFADLINIRMQND 129

Query: 140 HS------RELSTMLSTAQEIWRHEGFRG-FFKGXXXXXXXXXXXXXXXXXXYESVKIFC 192
            +      R     +    +I++ EG +  F  G                  Y+  K F 
Sbjct: 130 SALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFKNFL 189

Query: 193 ----EQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNK 248
                  P ++S+ +     ++S++AG V+ T+  P D ++     I       PGH + 
Sbjct: 190 VTKYNMDPKKNSTHL-----TSSLLAGFVATTVCSPADVIK----TIVMNAHKKPGHNHD 240

Query: 249 AYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVV 294
           +             ++ +  + KEG   ++ G+     +  P T++
Sbjct: 241 SS-----------FKILMEAINKEGPSFMFRGWVPSFTRLAPFTML 275

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 118/269 (43%), Gaps = 22/269 (8%)

Query: 31  VTAPLDTLKIRLQLQLANE-AQYGGILVTFKRLVRQEGVRALWKG---NVPAMAM--YIL 84
           +T PL T+  +LQ Q  +E  Q    L T K + R++G+   + G    +  MA+  ++ 
Sbjct: 30  LTYPLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVY 89

Query: 85  YGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSREL 144
           Y   + TS  +L   + K +    + + + G ++G+ +AIAS P  V  TR     S + 
Sbjct: 90  YYFYELTSRNVLK--VRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEK- 146

Query: 145 STMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQ 204
            T L+T  EI + +  +  F G                  +E +K        +      
Sbjct: 147 -TALATIIEIVKKDSAKTLFNG-LKPALVLVMNPIVQYTVFEQLKNLVLAWNKQG----- 199

Query: 205 LLESSASVIAGIVSKTI----VFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTN 260
           +L  S + + G + K       +P  T++ R  + +  +        KA K +K+ +S +
Sbjct: 200 ILSPSWAFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKA-KGHKA-SSKS 257

Query: 261 FLRLALMIVEKEGLLALYHGYTLGIAKSV 289
            L L   IV+K+G+  LY G  + +A+S+
Sbjct: 258 MLSLITEIVKKDGVSGLYRGVGIKLAQSI 286

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 80/180 (44%), Gaps = 24/180 (13%)

Query: 6   LRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQ 65
           +RK +++   +S++ GC++G    I + P+     R+ +  + +      L T   +V++
Sbjct: 103 VRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEKTA----LATIIEIVKK 158

Query: 66  EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL---SKSQLPAQIHTGMVGALSGTCS 122
           +  + L+ G  PA+ + ++    Q+T +  L  L+   +K  + +     ++GAL    +
Sbjct: 159 DSAKTLFNGLKPALVL-VMNPIVQYTVFEQLKNLVLAWNKQGILSPSWAFLLGALGKLAA 217

Query: 123 AIASYPCDVLRTRF----------------IANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
             ++YP   L+TR                    H     +MLS   EI + +G  G ++G
Sbjct: 218 TGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITEIVKKDGVSGLYRG 277

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/319 (21%), Positives = 124/319 (38%), Gaps = 64/319 (20%)

Query: 30  IVTAPLDTLKIRLQLQLANEA--------------------------QYGGILVTFKRLV 63
           +VT P D +K RLQ  +  +A                           +   L     + 
Sbjct: 68  VVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVY 127

Query: 64  RQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS----QLPAQIHTGMVGALSG 119
           +QEG R+L+KG  P +   I   S  F +Y     + +K+    Q    IH  M  A +G
Sbjct: 128 KQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHL-MAAATAG 186

Query: 120 TCSAIASYPCDVLRTRFIANHS-----RELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXX 174
             +A A+ P  +++TR   + +     R+        + + R+EGF G +KG        
Sbjct: 187 WATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGS 246

Query: 175 XXXXXXXXXXYESVKIFCEQR------------PDRDSSVIQLLESSASV-IAGIVSKTI 221
                     YE +K   ++R                  V +  + S S  +A  V+   
Sbjct: 247 VEGILQWLL-YEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIA 305

Query: 222 VFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGY 281
            +P + VR R +         P    K     + YT    ++   +I+++EGL ++Y G 
Sbjct: 306 TYPHEVVRTRLRQT-------PKENGK-----RKYTG--LVQSFKVIIKEEGLFSMYSGL 351

Query: 282 TLGIAKSVPSTVVSLGVYE 300
           T  + ++VP++++  G +E
Sbjct: 352 TPHLMRTVPNSIIMFGTWE 370

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 80/190 (42%), Gaps = 26/190 (13%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA---QYGGILV 57
           M       GQE P+   L+A   +G +    T P+  +K R+QL  A +    QY     
Sbjct: 163 MYAKAFNNGQETPMIH-LMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWD 221

Query: 58  TFKRLVRQEGVRALWK-------GNVPAMAMYILYGS----------TQFTSYAILNKLL 100
             K ++R EG   L+K       G+V  +  ++LY             +F   A   K  
Sbjct: 222 CLKSVIRNEGFTGLYKGLSASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKST 281

Query: 101 SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRF----IANHSRELSTMLSTAQEIWR 156
           S+        +G  G L+   ++IA+YP +V+RTR       N  R+ + ++ + + I +
Sbjct: 282 SEKVKEWCQRSGSAG-LAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIK 340

Query: 157 HEGFRGFFKG 166
            EG    + G
Sbjct: 341 EEGLFSMYSG 350

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 23  LSGISARIVTAPLDTLKIRLQLQLANEA---QYGGILVTFKRLVRQEGVRALWKGNVPAM 79
           L+   A I T P + ++ RL+ Q   E    +Y G++ +FK ++++EG+ +++ G  P +
Sbjct: 297 LAKFVASIATYPHEVVRTRLR-QTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHL 355

Query: 80  AMYILYGSTQFTSYAILNKLLS 101
              +      F ++ I+ +LLS
Sbjct: 356 MRTVPNSIIMFGTWEIVIRLLS 377

>Scas_662.12
          Length = 308

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/315 (18%), Positives = 126/315 (40%), Gaps = 45/315 (14%)

Query: 13  PVFQSLVAGCLSGISARIVTAPLDTLKIRLQL------------------QLANEAQYGG 54
           P+ + +++G  +G    ++  PLD +K+RLQL                  +L N ++  G
Sbjct: 6   PIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMG 65

Query: 55  ILVTFKRLVRQ--EGVRALWKGNVPAMAMYI-LYGSTQFTSYAILNKLLSKSQLPAQIHT 111
                  L+++   G+     GN  A ++Y  +Y ST+   Y   N  L  +     + +
Sbjct: 66  SQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTK--DYMFQNNYLHNNNTTIFLTS 123

Query: 112 GMVGALSGTCSAIASYPCDVLRTRFIA---NHSRELSTMLSTAQEIWRHEGFRGFFKGXX 168
           G++   SG  + + + P  V++TR ++   +H     ++    + +   EG +  + G  
Sbjct: 124 GLI---SGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLL 180

Query: 169 XXXXXXXXXXXXXXXXYESVKIFCE---QRPDRDSSVIQLLESSASVIAGIVSKTIVFPI 225
                           Y+++K+       +  +D++   L     S ++ ++S   V+P 
Sbjct: 181 PSLLGVSQGAIYFMI-YDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPF 239

Query: 226 DTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGI 285
             ++   Q         P +              +F+ L   I    G+  LY G +  +
Sbjct: 240 QLLKSNLQTFRSVTNNIPQN------------DYHFITLIRKIYRDNGIKGLYKGLSANL 287

Query: 286 AKSVPSTVVSLGVYE 300
            +++PST ++  +YE
Sbjct: 288 LRAIPSTCITFCIYE 302

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 73/153 (47%), Gaps = 8/153 (5%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRA-LWKGNV 76
           +++  +  I A +V  P + +K R Q+   N +     L +  R   +EG+R  L++G  
Sbjct: 98  MLSSSIGEICACLVRVPAEVVKQRTQVHSTNSSWQ--TLQSILRNDNKEGLRKNLYRGWS 155

Query: 77  PAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHT---GMVGALSGTCSAIASYPCDVLR 133
             +   I +   QF  Y  L K  +K+   +Q+      + G+++G  +A  + P D L+
Sbjct: 156 TTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLK 215

Query: 134 TRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           TR + N  +  +++ S    I+R EG   FF G
Sbjct: 216 TRLMLN--KTTASLGSVIIRIYREEGPAVFFSG 246

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRA 70
           +V  ++  + G ++G  A   T PLD LK RL L     A  G +++   R+ R+EG   
Sbjct: 187 QVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLN-KTTASLGSVII---RIYREEGPAV 242

Query: 71  LWKGNVPAMAMYILYGSTQFTS-YAILNKLLSKS 103
            + G  P   M+I  G   F   Y  ++ LLSKS
Sbjct: 243 FFSGVGP-RTMWISAGGAIFLGMYETVHSLLSKS 275

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 81/198 (40%), Gaps = 41/198 (20%)

Query: 113 MVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXX 172
           + GA +GT + +  +P D ++TR  A                + + G++G ++G      
Sbjct: 9   LSGAAAGTSTDLVFFPIDTIKTRLQAKGG------------FFANGGYKGIYRGLGSAVV 56

Query: 173 XXXXXXXXXXXXYESVKIFCEQRPD----RDSSVIQLLESS----ASVIAGIVSKTIVFP 224
                       Y+ +K+  + RP           QL++++    +S I  I +  +  P
Sbjct: 57  ASAPGASLFFISYDYMKV--KSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVP 114

Query: 225 IDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLA-LYHGYTL 283
            + V++R QV       H   TN +++  +S    +          KEGL   LY G++ 
Sbjct: 115 AEVVKQRTQV-------H--STNSSWQTLQSILRND---------NKEGLRKNLYRGWST 156

Query: 284 GIAKSVPSTVVSLGVYEW 301
            I + +P T +   +YE+
Sbjct: 157 TIMREIPFTCIQFPLYEY 174

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 68/154 (44%), Gaps = 13/154 (8%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG 74
           F SL++G  +G S  +V  P+DT+K RLQ +    A  G     +K + R  G   +   
Sbjct: 5   FLSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANGG-----YKGIYRGLGSAVV--A 57

Query: 75  NVPAMAMYIL-YGSTQFTSYAILNKLLSKS--QLPAQIHTGMVGALSGTCSAIASYPCDV 131
           + P  +++ + Y   +  S   ++KL S+   QL       +  ++   C+ +   P +V
Sbjct: 58  SAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEV 117

Query: 132 LRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFK 165
           ++ R         ++   T Q I R++   G  K
Sbjct: 118 VKQR---TQVHSTNSSWQTLQSILRNDNKEGLRK 148

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 79/164 (48%), Gaps = 14/164 (8%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQ---E 66
           Q   V   +++  L  +SA +V  P + +K R Q    N +     L T + ++R    E
Sbjct: 89  QLAEVLTHMLSSSLGEMSACLVRVPAEVIKQRTQTHHTNSS-----LQTLRLILRDPTGE 143

Query: 67  GV-RALWKGNVPAMAMYILYGSTQFTSYAILNK---LLSKSQLPAQIHTGMVGALSGTCS 122
           GV R L++G    +   I +   QF  Y  L K     ++ +  +     + G+L+G  +
Sbjct: 144 GVVRGLYRGWWTTIMREIPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIA 203

Query: 123 AIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           A A+ P DVL+TR + +  R    ML  A+ ++R EG R FF+G
Sbjct: 204 AAATTPLDVLKTRMMLHERR--VPMLHLARTLFREEGARVFFRG 245

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 77/192 (40%), Gaps = 35/192 (18%)

Query: 115 GALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXX 174
           GA +GT + +  +P D L+TR  A                + + G+RG ++G        
Sbjct: 12  GAAAGTSTDVVFFPIDTLKTRLQAKGG------------FFHNGGYRGIYRGLGSAVVAS 59

Query: 175 XXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIA---GIVSKTIV-FPIDTVRK 230
                     Y+S+K        R ++  QL E    +++   G +S  +V  P + +++
Sbjct: 60  APGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVPAEVIKQ 119

Query: 231 RYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLL-ALYHGYTLGIAKSV 289
           R Q           HTN         +S   LRL L     EG++  LY G+   I + +
Sbjct: 120 RTQT---------HHTN---------SSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREI 161

Query: 290 PSTVVSLGVYEW 301
           P T +   +YE+
Sbjct: 162 PFTCIQFPLYEY 173

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 77/163 (47%), Gaps = 31/163 (19%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG-- 74
           SLV+G  +G S  +V  P+DTLK RLQ +       GG            G R +++G  
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQAK-------GGFF-------HNGGYRGIYRGLG 53

Query: 75  -----NVPAMAM-YILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSA-IASY 127
                + P  ++ ++ Y S +     ++ +  +  QL A++ T M+ +  G  SA +   
Sbjct: 54  SAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQL-AEVLTHMLSSSLGEMSACLVRV 112

Query: 128 PCDVLRTRFIANHSRELSTMLSTAQEIWRH---EG-FRGFFKG 166
           P +V++ R   +H+   ++ L T + I R    EG  RG ++G
Sbjct: 113 PAEVIKQRTQTHHT---NSSLQTLRLILRDPTGEGVVRGLYRG 152

 Score = 31.6 bits (70), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVR 69
           + V  +Q  V G L+G  A   T PLD LK R+ L          +L   + L R+EG R
Sbjct: 185 ERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVP----MLHLARTLFREEGAR 240

Query: 70  ALWKGNVPAMAMYILYGSTQF 90
             ++G  P   M+I  G   F
Sbjct: 241 VFFRGIGP-RTMWISAGGAIF 260

>Scas_714.18
          Length = 305

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 64/329 (19%), Positives = 121/329 (36%), Gaps = 63/329 (19%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLV 63
           + + +G      + ++AG ++G   + +  P DT+K+RLQ Q A    +       K   
Sbjct: 2   NAVEEGGFGAALREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAY--MFPSTWSCIKYTY 59

Query: 64  RQEGV-RALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK-SQLPAQIHTGMVGALSGTC 121
             EG+    ++G    +    L  +  F +Y   +  L+  ++  A +   +    +G+C
Sbjct: 60  ENEGILEGFYQGIESPLIGAALENAILFLAYNQCSSFLNAFTEFSAFLIILISAGFAGSC 119

Query: 122 SAIASYPCDVLRTRF-IANHSREL------------------------STMLSTAQEIWR 156
           ++    P ++++ +  I+N    L                        + ++ T + I +
Sbjct: 120 ASFVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIK 179

Query: 157 HEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGI 216
            +G  G ++G                  YE +K          ++  QLL S A+  AG+
Sbjct: 180 EKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGAT--AGL 237

Query: 217 VSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALM-----IVEK 271
                VFP DTV+   Q                              LALM     I+E+
Sbjct: 238 AFNGSVFPADTVKSIMQT---------------------------EHLALMETVRSILER 270

Query: 272 EGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           +G+   Y G  + + ++VPS       YE
Sbjct: 271 DGVAGFYRGLGITLLRAVPSNAAVFYTYE 299

>Kwal_23.4354
          Length = 343

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 74/354 (20%), Positives = 128/354 (36%), Gaps = 74/354 (20%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ-------------LANEA 50
           D  +KG  + + + L++  +  +   ++  P+D ++IRLQ Q             L + A
Sbjct: 3   DEKQKG--IGLKERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRA 60

Query: 51  QYGGIL----------------------VTFKRLVRQEGVRALWKGNVPAMAMYILYGST 88
              G+                         F ++ + EGV++LW+G    + M       
Sbjct: 61  SSKGVFWQDICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMV 120

Query: 89  QFTSYAILNKLLSKSQLPAQ---IHTGMVGALSGTCSAIASYPCDVLRTRF--IANHSRE 143
            F  Y     L  KS+L  +   ++  M GAL+   +A    P ++ RTR   I   S +
Sbjct: 121 YFIGY---ESLRDKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPK 177

Query: 144 LST--MLSTAQEIWRHE----GFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPD 197
            +T  M+    +  R+E    G++  F+G                  YE  K       D
Sbjct: 178 STTAMMIKDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYK--SNVSID 235

Query: 198 RDSSVIQLLESS---------ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNK 248
            + S++    S+              G V+  +  P D  + R Q+          + N 
Sbjct: 236 SEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQIT---------YLNS 286

Query: 249 AYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
             +      S N  +    + + EGL ALY G    + K  PS  + +  YE C
Sbjct: 287 TLE---KKPSKNMFKYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVC 337

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 74/154 (48%), Gaps = 16/154 (10%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFKRLVRQEGVRALWKGNVPA 78
           GC +  SA +   P+D +K R+QL+  + N+    G++ +FK+++  EG  AL  G  P 
Sbjct: 23  GCGTTHSAMV---PIDVVKTRIQLEPTVYNK----GMISSFKQIISSEGAGALLTGFGPT 75

Query: 79  MAMYILYGSTQFTSYAILNKL----LSKSQLPAQIHTGMVG--ALSGTCSAIASYPCDVL 132
           +  Y L GS +F  Y +  KL    L   Q     ++  +G  A++   + IA  P +  
Sbjct: 76  LLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEAT 135

Query: 133 RTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           R R ++  +   + ++     I + EG   F+ G
Sbjct: 136 RIRLVSQPTFA-NGLVGGFSRILKEEGAGSFYNG 168

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 62/149 (41%), Gaps = 15/149 (10%)

Query: 28  ARIVTAPLDTLKIRL--QLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILY 85
           A I   PL+  +IRL  Q   AN     G++  F R++++EG  + + G  P +   I Y
Sbjct: 125 ADIALCPLEATRIRLVSQPTFAN-----GLVGGFSRILKEEGAGSFYNGFTPILFKQIPY 179

Query: 86  GSTQFTSYAILNKLL-----SKSQLPAQIHTG---MVGALSGTCSAIASYPCDVLRTRFI 137
              +F  +    ++       K  L     TG   + G  +G  +AI S P D L ++  
Sbjct: 180 NIAKFLVFERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVN 239

Query: 138 ANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
                   + +    ++ +  GF G F G
Sbjct: 240 KTKKAPGQSTIGLLAQLAKQLGFVGSFAG 268

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 71/153 (46%), Gaps = 14/153 (9%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           GC +  SA +   P+D +K R+QL+    +   G++ +F+++V +EG  AL  G  P + 
Sbjct: 25  GCGATHSAMV---PIDVVKTRIQLEPLKYSS--GMVGSFRKIVGEEGAAALLTGFGPTLL 79

Query: 81  MYILYGSTQFTSYAILNKLL-------SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLR 133
            Y + G+ +F  Y +  K         +  Q    I+ G   A++   + IA  P +  R
Sbjct: 80  GYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSA-AIAEFFADIALCPLEATR 138

Query: 134 TRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
            R ++  +   + ++     I + EG   F+ G
Sbjct: 139 IRLVSQPTFA-NGLVGGFARILKEEGIGSFYNG 170

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 62/149 (41%), Gaps = 15/149 (10%)

Query: 28  ARIVTAPLDTLKIRL--QLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILY 85
           A I   PL+  +IRL  Q   AN     G++  F R++++EG+ + + G  P +   I Y
Sbjct: 127 ADIALCPLEATRIRLVSQPTFAN-----GLVGGFARILKEEGIGSFYNGFTPILFKQIPY 181

Query: 86  GSTQFTSY-----AILNKLLSKSQLPAQIHTGM---VGALSGTCSAIASYPCDVLRTRFI 137
              +F  +     A      SK  L     TG+    G  +G  +A+ S P D L ++  
Sbjct: 182 NIAKFVVFEHAANAYFGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKVN 241

Query: 138 ANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
                   +      ++ +  GF G F G
Sbjct: 242 KTKKAPGQSTFGLLMQLAKQLGFVGSFAG 270

>Kwal_33.12988
          Length = 303

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 63/149 (42%), Gaps = 3/149 (2%)

Query: 87  STQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELST 146
           S + T   +++ L  KS +   +     G   G    +   P D+ + R     S   +T
Sbjct: 2   SDELTMPQVVDDLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRL--QTSSTPTT 59

Query: 147 MLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLL 206
            L   Q++ ++EG RGF+KG                   E++K +  +R +  S+ ++L 
Sbjct: 60  ALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLP 119

Query: 207 ESSA-SVIAGIVSKTIVFPIDTVRKRYQV 234
           E  A   ++G  +  +  PI+ VR   QV
Sbjct: 120 EYYACGFVSGCANAFLATPIEHVRILLQV 148

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 74/156 (47%), Gaps = 14/156 (8%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLVRQEGVRALWKGNVPA 78
           G +SG +   +  P++ ++I LQ+Q  +  +A+Y G +   K+L++ EG   L +G  P 
Sbjct: 125 GFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLK-EG--KLMRGFTPT 181

Query: 79  MAMYILYGSTQFTSYAIL-----NKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLR 133
           +          FTSY  +      K +++  +PA     + GA SG+      YP DV++
Sbjct: 182 ILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAW-KLCLYGAFSGSLLWAMVYPFDVIK 240

Query: 134 TRFIANHSREL---STMLSTAQEIWRHEGFRGFFKG 166
           +   ++  R     + +   A+ I+   G + F KG
Sbjct: 241 SVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKG 276

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 57/141 (40%), Gaps = 15/141 (10%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFK 60
           + +D   K       + + AG   GI+  +V  P D  K+RLQ      +     L   +
Sbjct: 10  VVDDLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQ----TSSTPTTALRVVQ 65

Query: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS--------QLPAQIHTG 112
            LV+ EG+R  +KG    +    L  S+QF +   + +   K         +LP     G
Sbjct: 66  DLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACG 125

Query: 113 MVGALSGTCSAIASYPCDVLR 133
            V   SG  +A  + P + +R
Sbjct: 126 FV---SGCANAFLATPIEHVR 143

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 43/99 (43%), Gaps = 4/99 (4%)

Query: 7   RKG---QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYG-GILVTFKRL 62
           RKG   +++P ++  + G  SG     +  P D +K  +Q        YG  +    K +
Sbjct: 205 RKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYGTNVFQVAKNI 264

Query: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLS 101
             + G +A  KG  P M   +      FT++ +  ++L+
Sbjct: 265 YNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAMRILN 303

>Kwal_56.23011
          Length = 303

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 75/166 (45%), Gaps = 12/166 (7%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANE--AQYGGILVTFKRLVRQ-- 65
           Q + + Q    G +SG +   +  P++ ++IRLQLQ A+   A+Y G L   ++L++Q  
Sbjct: 114 QPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGA 173

Query: 66  --EGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSA 123
              G  A          +Y L   T   + A    L  +  +PA     + GA SG    
Sbjct: 174 LMRGFTATTLRTSHGFGIYFLTYETLIANQAHHGVL--RENIPAW-KVCVYGAFSGAFFW 230

Query: 124 IASYPCDVLRTRFIANHSREL---STMLSTAQEIWRHEGFRGFFKG 166
             +YP DV+++   A+  +        L+ A+ I+R  G R F KG
Sbjct: 231 AMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKG 276

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 60/145 (41%), Gaps = 19/145 (13%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFKRLVRQEGVRALWK 73
           + +  G + G++  +V  P D  K+RLQ        AQ        K LV+ EG+ A +K
Sbjct: 25  KDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTTAAQ------VIKSLVKNEGLLAFYK 78

Query: 74  GNVPAMAMYILYGSTQFTSYAILNKLLSK-----SQLPAQIHTGMVGALSGTCSAIASYP 128
           G +  +A      S QF     L K   K      Q  A       G +SGT +A  + P
Sbjct: 79  GTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLATP 138

Query: 129 CDVLRTRFIANHSRELSTMLSTAQE 153
            + +R R       +L T  S+A E
Sbjct: 139 IEHVRIRL------QLQTASSSAAE 157

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 78/165 (47%), Gaps = 22/165 (13%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQ---LANEAQYGGILVTFKRLVRQEGVRALW 72
           Q    G +SG +  ++  P++ ++IRLQLQ   LAN A+Y   L   ++L++Q    +L 
Sbjct: 124 QYYTCGFVSGSANALLATPIEHVRIRLQLQKEALAN-AEYKSTLDCTEKLLKQG---SLM 179

Query: 73  KGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLP--------AQIHTGMVGALSGTCSAI 124
           +G        ++  S  F  Y +  + L  SQL         +     M GALSG     
Sbjct: 180 RG----FTATLMRTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWA 235

Query: 125 ASYPCDVLRTRFIAN---HSRELSTMLSTAQEIWRHEGFRGFFKG 166
            +YP DV+++   A+   +    + ++  A+ I+R  G R F KG
Sbjct: 236 MTYPFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKG 280

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/299 (19%), Positives = 110/299 (36%), Gaps = 38/299 (12%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           + + +G + G++  +V  P D +K+RLQ    N   +  I      LV+ EG    +KG 
Sbjct: 26  KDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEAI----TDLVKYEGFMGFYKGT 81

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMV--------GALSGTCSAIASY 127
           +  +       S QF     + +          I+   +        G +SG+ +A+ + 
Sbjct: 82  MAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLAT 141

Query: 128 PCDVLRTRF------IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXX 181
           P + +R R       +AN   + ST+  T + + +    RGF                  
Sbjct: 142 PIEHVRIRLQLQKEALANAEYK-STLDCTEKLLKQGSLMRGF----TATLMRTSHGFGIY 196

Query: 182 XXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLG 241
              YE++         R   +          ++G     + +P D V+    V+   +L 
Sbjct: 197 FLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVK---SVMQADKLV 253

Query: 242 HPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           +P +             TN +++A  I  + GL A   G+   + +S+P    +   +E
Sbjct: 254 NPAY------------GTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFE 300

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 5   HLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQL-QLANEAQYGGILVTFKRLV 63
           H  + +++  +++ + G LSG     +T P D +K  +Q  +L N A    ++   K + 
Sbjct: 210 HGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYGTNVVQVAKNIY 269

Query: 64  RQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
           R+ G+RA  KG +P M   +      F ++ +  ++L
Sbjct: 270 RERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQML 306

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 80/173 (46%), Gaps = 22/173 (12%)

Query: 8   KGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLA--NEAQYGGILVTFKRLVRQ 65
           K Q + + Q    G +SG +   +  P++ ++IRLQLQ     +A+Y G L   K+L++Q
Sbjct: 112 KDQHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQ 171

Query: 66  EGVRALWKGNVPAMAMYILYG-STQFTSYAIL------NKLLSKSQLPAQIHTGMVGALS 118
              +AL +G   A  M   +G    F +Y  L      N +L K   P ++   + GA S
Sbjct: 172 ---KALMRG-FTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVC--VFGAFS 225

Query: 119 GTCSAIASYPCDVLRTRFIANHSRELS-----TMLSTAQEIWRHEGFRGFFKG 166
           G      +YP DV+++  I    R +S      +   A+ I    G+  F KG
Sbjct: 226 GAFFWAMTYPFDVVKS--IMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKG 276

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 54/125 (43%), Gaps = 9/125 (7%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           + +++G   GI+  +V  P D  K+R+Q    +       +   K LV+ EG+ A +KG 
Sbjct: 25  KDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTA----IEVIKNLVKNEGLLAFYKGT 80

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMV-----GALSGTCSAIASYPCD 130
           +  +       S QF     + +   +       H  ++     G +SG+ +A  + P +
Sbjct: 81  LVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAFLATPIE 140

Query: 131 VLRTR 135
            +R R
Sbjct: 141 HVRIR 145

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 91/222 (40%), Gaps = 18/222 (8%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           GC S  S+ +   P+D +K R+QL+     +  G++ +FK+++  EG  AL  G  P + 
Sbjct: 27  GCGSTHSSMV---PIDVVKTRIQLEPTVYNK--GMVGSFKQIIAGEGAGALLTGFGPTLL 81

Query: 81  MYILYGSTQFTSYAILNKLL-------SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLR 133
            Y + G+ +F  Y +  K         + S+    ++ G   A++   + IA  P +  R
Sbjct: 82  GYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSA-AMAEFLADIALCPLEATR 140

Query: 134 TRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK---- 189
            R + +  +  + ++     I + EG   F+ G                  +E       
Sbjct: 141 IRLV-SQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFYY 199

Query: 190 IFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKR 231
            F   +    S+   LL   + + AG+ +  +  P DT+  +
Sbjct: 200 GFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSK 241

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 64/152 (42%), Gaps = 21/152 (13%)

Query: 28  ARIVTAPLDTLKIRL--QLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILY 85
           A I   PL+  +IRL  Q Q AN     G++  F R++++EG+ + + G  P +   I Y
Sbjct: 129 ADIALCPLEATRIRLVSQPQFAN-----GLVGGFSRILKEEGIGSFYSGFTPILFKQIPY 183

Query: 86  GSTQFTSY-----------AILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRT 134
              +F  +               KL S S     + +G+    +G  +AI S P D L +
Sbjct: 184 NIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLT---AGLAAAIVSQPADTLLS 240

Query: 135 RFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
           +          + +    ++ +  GF G F G
Sbjct: 241 KVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAG 272

>Kwal_27.12599
          Length = 304

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 79/161 (49%), Gaps = 14/161 (8%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANE--AQYGGILVTFKRLVRQEGVRALWK 73
           Q  + G + G++   + +P++ ++IRLQ Q A+   A++ G L    +L R  G  AL +
Sbjct: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-RANG--ALMR 177

Query: 74  GNVPAMAMYILYGSTQFTSYAIL-----NKLLSKSQLPAQIHTGMVGALSGTCSAIASYP 128
           G  P +       +T F +Y  L      K +++S +PA     + GA+SG    +  YP
Sbjct: 178 GLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAW-KLCLFGAVSGVTLWLTVYP 236

Query: 129 CDVLRTRFIANHSREL---STMLSTAQEIWRHEGFRGFFKG 166
            DV+++    ++ +       ++  A+ +    G++ FFKG
Sbjct: 237 LDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKG 277

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 54/131 (41%), Gaps = 15/131 (11%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73
           V + L+AG   G++  +V  P DT K+RLQ            +   K+LV+ EG+R  +K
Sbjct: 24  VLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA----VEVVKKLVKNEGLRGFYK 79

Query: 74  GNVPAMAMYILYGSTQFTSYAILNKLLSKSQ--------LPAQIHTGMVGALSGTCSAIA 125
           G +  +       S QF     + +    S         LP     G VG   G  ++  
Sbjct: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVG---GVANSFL 136

Query: 126 SYPCDVLRTRF 136
           + P + +R R 
Sbjct: 137 ASPIEHVRIRL 147

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 45/122 (36%), Gaps = 3/122 (2%)

Query: 113 MVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXX 172
           + G   G    +   P D  + R     S   +T +   +++ ++EG RGF+KG      
Sbjct: 29  LAGTAGGMAQVLVGQPFDTTKVRL--QTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLV 86

Query: 173 XXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESS-ASVIAGIVSKTIVFPIDTVRKR 231
                        E++K F           + L +      + G+ +  +  PI+ VR R
Sbjct: 87  GVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIR 146

Query: 232 YQ 233
            Q
Sbjct: 147 LQ 148

 Score = 32.3 bits (72), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 41/91 (45%), Gaps = 1/91 (1%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQE-GVR 69
           +VP ++  + G +SG++  +   PLD +K  +Q         G  ++   RLV  + G +
Sbjct: 213 DVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWK 272

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
           + +KG  P M          F ++ +  + L
Sbjct: 273 SFFKGFGPTMLRAAPANGATFATFELAMRFL 303

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 97/226 (42%), Gaps = 26/226 (11%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           GC S  S+ +   P+D +K R+QL+     +  G++ +F++++ +EG  AL  G  P + 
Sbjct: 23  GCGSTHSSMV---PIDVVKTRIQLEPTVYNK--GMVGSFRKIIAEEGAGALLTGFGPTLL 77

Query: 81  MYILYGSTQFTSYAILNKLL-------SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLR 133
            Y + G+ +F  Y +  K         + ++    ++ G   A     + IA  P +  R
Sbjct: 78  GYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAE-FLADIALCPLEATR 136

Query: 134 TRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYE-SVKIFC 192
            R ++  +   + ++     I + EG   F+ G                  +E + +++ 
Sbjct: 137 IRLVSQPTFA-NGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASELYF 195

Query: 193 EQRPDRDS------SVIQLLES-SASVIAGIVSKTIVFPIDTVRKR 231
              P +D+      + I LL   +A + A IVS+    P DT+  +
Sbjct: 196 SLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQ----PADTLLSK 237

>Scas_687.15*
          Length = 328

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 90/208 (43%), Gaps = 48/208 (23%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRL---QLQLAN----EAQYG 53
           + +D L KG  +     L+AG L+G    +   P + +K+ +    LQL+     E +  
Sbjct: 91  LPKDSLLKGPRL-----LLAGILTGAVESLCIIPFENVKVTMIENSLQLSESKPTEKEIA 145

Query: 54  GIL---VTF-----KRLVRQE-------------------------GVRALWKGNVPAMA 80
           G L   VTF     K+L  QE                         G+R   +G +P + 
Sbjct: 146 GTLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVF 205

Query: 81  MYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAIA-SYPCDVLRTRFIAN 139
             +   + +FT+Y  L +L+S +Q   +++   +G  S +C+ +A + P DV++TR  + 
Sbjct: 206 RQVSNSTVRFTAYTTLKQLISPTQPLNEVYAFGIGLFS-SCAVVALTQPIDVVKTRMQSK 264

Query: 140 HSREL-STMLSTAQEIWRHEGFRGFFKG 166
            +       L+ A  ++  EG    +KG
Sbjct: 265 TAHYFYKNSLNCAYRVFVEEGMVSLWKG 292

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 66/159 (41%), Gaps = 25/159 (15%)

Query: 145 STMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK-IFCEQRPDRDSSVI 203
           S + S  +EI+   G RGF +G                  Y ++K +    +P  +    
Sbjct: 178 SNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPLNEVYAF 237

Query: 204 QL-LESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFL 262
            + L SS +V+A      +  PID V+ R Q            +  A+  YK     N L
Sbjct: 238 GIGLFSSCAVVA------LTQPIDVVKTRMQ------------SKTAHYFYK-----NSL 274

Query: 263 RLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
             A  +  +EG+++L+ G+   + K   S  +S GVY++
Sbjct: 275 NCAYRVFVEEGMVSLWKGWLPRLFKVGLSGGISFGVYQY 313

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           G  S  +   +T P+D +K R+Q + A+   Y   L    R+  +EG+ +LWKG +P + 
Sbjct: 240 GLFSSCAVVALTQPIDVVKTRMQSKTAHYF-YKNSLNCAYRVFVEEGMVSLWKGWLPRLF 298

Query: 81  MYILYGSTQFTSYAILNKL 99
              L G   F  Y  +  L
Sbjct: 299 KVGLSGGISFGVYQYVENL 317

>Kwal_23.5757
          Length = 307

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 66/149 (44%), Gaps = 13/149 (8%)

Query: 28  ARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87
           A I   P + +K+R Q  +        +   + ++V  EG  +L+KG  P     I Y  
Sbjct: 130 ADIFLCPWEAIKVRQQTAVPPPFARN-VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTM 188

Query: 88  TQFTSYAILNKLLSKSQLP---------AQIHTGMVGA-LSGTCSAIASYPCDVLRTRFI 137
            +FTS+  + +++  ++LP          QI     G  L+G   A+ S+P DV+ ++ +
Sbjct: 189 CKFTSFERIVEMI-YARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSK-V 246

Query: 138 ANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
            N  +   + L     I+   GF G + G
Sbjct: 247 NNERKSGESTLQATSRIYGKIGFPGLWNG 275

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 80/214 (37%), Gaps = 29/214 (13%)

Query: 34  PLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY 93
           PLD +K R Q+   + + Y   L  ++++VR EG   ++ G       Y L G+ ++  Y
Sbjct: 39  PLDLVKCRRQV---DASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGY 95

Query: 94  AILNKLLSKSQLPAQIH---TGMVGALSGTCSAIASY---PCDVLRTR--------FIAN 139
                  S+   P   H   TG+  A S +   IA     P + ++ R        F  N
Sbjct: 96  EFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARN 155

Query: 140 HSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYES-VKIFCEQRPDR 198
                S M+         EGF   +KG                  +E  V++   + P  
Sbjct: 156 VFDAYSKMVGA-------EGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTP 208

Query: 199 DSSVIQLLESSASV----IAGIVSKTIVFPIDTV 228
              + QL + S S     +AGI+   +  P D +
Sbjct: 209 KREMSQLGQISVSFAGGYLAGILCAVVSHPADVM 242

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 87/198 (43%), Gaps = 18/198 (9%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQE---GVR- 69
           V   + +  +  I+A +V  P + +K R Q   ++ +       T + +++ E   GVR 
Sbjct: 93  VVTHMFSSSMGEIAACMVRVPAEVVKQRSQTHASHSSWE-----TLREILKNENGEGVRR 147

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKL---LSKSQLPAQIHTGMVGALSGTCSAIAS 126
            L++G    +   I +   QF  Y  + K+   L +S         + G+++G  +A  +
Sbjct: 148 NLYRGWSTTIMREIPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATT 207

Query: 127 YPCDVLRTRF-IANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXY 185
            P D L+TR  +   S  L T++ST   I++ EGF+ FF G                  Y
Sbjct: 208 TPLDFLKTRLMLCKKSIPLGTLVST---IYKEEGFKVFFSGVGPRTMWISAGGAIFLGIY 264

Query: 186 ESVK--IFCEQRPDRDSS 201
           E+V   +   ++P R+ +
Sbjct: 265 ETVHSLLSTNKKPTRNEA 282

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 75/197 (38%), Gaps = 41/197 (20%)

Query: 113 MVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXX 172
           + GA +GT + +  +P D L+TR  A                +R+ G+RG ++G      
Sbjct: 10  LSGAAAGTSTDLVFFPIDTLKTRLQAKGG------------FFRNGGYRGVYRGLGSAVV 57

Query: 173 XXXXXXXXXXXXYESVK-----IFCEQRPDRDSS--VIQLLESSASVIAGIVSKTIVFPI 225
                       Y++ K      F    P  + +  V  +  SS   IA  + +    P 
Sbjct: 58  ASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAACMVRV---PA 114

Query: 226 DTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLL-ALYHGYTLG 284
           + V++R Q                   + S++S   LR  L     EG+   LY G++  
Sbjct: 115 EVVKQRSQT------------------HASHSSWETLREILKNENGEGVRRNLYRGWSTT 156

Query: 285 IAKSVPSTVVSLGVYEW 301
           I + +P T +   +YE+
Sbjct: 157 IMREIPFTCIQFPLYEY 173

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 93/229 (40%), Gaps = 34/229 (14%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG-- 74
           SL++G  +G S  +V  P+DTLK RLQ +       GG         R  G R +++G  
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQAK-------GGFF-------RNGGYRGVYRGLG 53

Query: 75  -----NVPAMAM-YILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSA-IASY 127
                + P  ++ +I Y + +  +      LL  S + A + T M  +  G  +A +   
Sbjct: 54  SAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNV-ADVVTHMFSSSMGEIAACMVRV 112

Query: 128 PCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRG----FFKGXXXXXXXXXXXXXXXXX 183
           P +V++ R   + +    +   T +EI ++E   G     ++G                 
Sbjct: 113 PAEVVKQR---SQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFP 169

Query: 184 XYESV-KIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKR 231
            YE + K++ E   D    V     +    IAG ++     P+D ++ R
Sbjct: 170 LYEYMKKVWAEL--DESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTR 216

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG 74
           +Q+  AG LS  +   +T P+D +K R+Q + A    Y   L    R+  +EG R +WKG
Sbjct: 249 YQAFAAGALSSAAVVALTQPIDVIKTRMQSKTA-WFTYKSSLNCAYRIFVEEGFRYMWKG 307

Query: 75  NVPAMAMYILYGSTQFTSYAILNKLL 100
            VP +    L G   F  Y  +  L+
Sbjct: 308 WVPRLFKVSLSGGISFGVYQYVENLV 333

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 1/110 (0%)

Query: 58  TFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGAL 117
           T   + R  GVR   +G +P +   +     +FT+YA + + LS  +   +      GAL
Sbjct: 198 TVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPHKALDEYQAFAAGAL 257

Query: 118 SGTCSAIASYPCDVLRTRFIANHSR-ELSTMLSTAQEIWRHEGFRGFFKG 166
           S       + P DV++TR  +  +     + L+ A  I+  EGFR  +KG
Sbjct: 258 SSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKG 307

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 69/178 (38%), Gaps = 22/178 (12%)

Query: 125 ASYPCDVLRTRFIANHSRELSTMLS-TAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXX 183
           A+ P      R++ ++ R+ S+  + T  EI+R  G RGF +G                 
Sbjct: 172 AARPVQTAHERWLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFT 231

Query: 184 XYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHP 243
            Y    I     P +     Q   + A   A +V+ T   PID ++ R Q          
Sbjct: 232 TY--AWIVQSLSPHKALDEYQAFAAGALSSAAVVALTQ--PIDVIKTRMQ---------- 277

Query: 244 GHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
             +  A+  YKS      L  A  I  +EG   ++ G+   + K   S  +S GVY++
Sbjct: 278 --SKTAWFTYKSS-----LNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQY 328

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 77/163 (47%), Gaps = 16/163 (9%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLVRQEGVRALWK 73
           Q    G   GI    + +P++ ++IRLQ Q  +   A++ G L   K+L      +AL +
Sbjct: 122 QYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLR 178

Query: 74  GNVPAMAMYILYGSTQFTSYA--ILNKL-----LSKSQLPAQIHTGMVGALSGTCSAIAS 126
           G  P +        T F  Y   I N++     L +  +PA     + GALSGT   +  
Sbjct: 179 GLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAW-KLCIFGALSGTALWLMV 237

Query: 127 YPCDVLRTRFIANHSREL---STMLSTAQEIWRHEGFRGFFKG 166
           YP DV+++    ++ ++    +++ S A+ ++ + G   FFKG
Sbjct: 238 YPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKG 280

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 51/127 (40%), Gaps = 11/127 (8%)

Query: 113 MVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWR----HEGFRGFFKGXX 168
           + G   G    +   P D  + R       + S+  +TA E+ R    +EG RGF+KG  
Sbjct: 30  LAGTAGGIAQVLVGQPFDTTKVRL------QTSSTPTTAMEVVRKLLANEGPRGFYKGTL 83

Query: 169 XXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSA-SVIAGIVSKTIVFPIDT 227
                            E++K F   R    SS + L +  A  V  GIV+  +  PI+ 
Sbjct: 84  TPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEH 143

Query: 228 VRKRYQV 234
           VR R Q 
Sbjct: 144 VRIRLQT 150

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 1/92 (1%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTF-KRLVRQEGV 68
           +++P ++  + G LSG +  ++  PLD +K  +Q     + ++G  + +  K L    G+
Sbjct: 215 KDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGI 274

Query: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
            A +KG  P M          F ++ +  +LL
Sbjct: 275 GAFFKGFGPTMLRAAPANGATFATFELAMRLL 306

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query: 14 VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73
          V + L+AG   GI+  +V  P DT K+RLQ            +   ++L+  EG R  +K
Sbjct: 25 VVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVVRKLLANEGPRGFYK 80

Query: 74 GNV 76
          G +
Sbjct: 81 GTL 83

>Kwal_0.232
          Length = 274

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 109/290 (37%), Gaps = 37/290 (12%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76
           SL+AG  +G S  +   P+DTLK RLQ         GG       L    G+ +    + 
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQAA-------GGFFANGGYLGVYRGLGSAVVASA 61

Query: 77  PAMAM-YILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSA-IASYPCDVLRT 134
           P+ ++ ++ Y   +  S  I N L++ S   A+  T M  + +G  +A +   P +V++ 
Sbjct: 62  PSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACMVRVPAEVIKQ 121

Query: 135 RFIANHSRELSTMLSTAQEIWRHEGFRG----FFKGXXXXXXXXXXXXXXXXXXYESVKI 190
           R     + +  + L T +++ ++E   G     ++G                  YE +K 
Sbjct: 122 R---TQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFPLYEFLKK 178

Query: 191 FCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAY 250
                  R+  V     +    +AG ++     P+D ++ R  +                
Sbjct: 179 QWAISGGRE-QVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLML---------------- 221

Query: 251 KAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
               S+TS   L LA  I   EG    + G             + LGVYE
Sbjct: 222 ----SHTSVPVLHLARQIYATEGWKVFFSGVGPRTVWISAGGAIFLGVYE 267

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 74/198 (37%), Gaps = 42/198 (21%)

Query: 113 MVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXX 172
           + GA +GT + +  +P D L+TR            L  A   + + G+ G ++G      
Sbjct: 11  LAGAAAGTSTDLFFFPIDTLKTR------------LQAAGGFFANGGYLGVYRGLGSAVV 58

Query: 173 XXXXXXXXXXXXYESVK-----IFCEQRPDRD---SSVIQLLESSASVIAGIVSKTIVFP 224
                       Y+ +K     IF       D    +   +  SSA  IA  + +    P
Sbjct: 59  ASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACMVRV---P 115

Query: 225 IDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLL-ALYHGYTL 283
            + +++R Q                   +KS +S   L+  L     EG+   LY G++ 
Sbjct: 116 AEVIKQRTQT------------------HKSDSSLQTLKKLLQNENGEGIRRNLYRGWST 157

Query: 284 GIAKSVPSTVVSLGVYEW 301
            + + +P T +   +YE+
Sbjct: 158 TVMREIPFTCIQFPLYEF 175

 Score = 32.3 bits (72), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 4/92 (4%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVR 69
           ++V  +Q    GC++G  A   T PLD LK RL L   +      +L   +++   EG +
Sbjct: 187 EQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVP----VLHLARQIYATEGWK 242

Query: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKLLS 101
             + G  P        G+     Y  ++ +LS
Sbjct: 243 VFFSGVGPRTVWISAGGAIFLGVYETVHSILS 274

>Kwal_55.21338
          Length = 323

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 112/266 (42%), Gaps = 28/266 (10%)

Query: 31  VTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQF 90
           +T PL  +  +LQ Q A + +   +  T K + R++G    + G   A+    L     +
Sbjct: 39  LTYPLIVVTTKLQTQDA-KGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYY 97

Query: 91  TSYAILNKLLSKSQLPAQIHTG---MVGALSGTCSAIASYPCDVLRTRFIANHSRELSTM 147
             Y   ++ + +++   ++ T    +VG+++G+ +A A+ P  V  TR     S   +  
Sbjct: 98  YCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGT-- 155

Query: 148 LSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLE 207
           LST  +I + EG  G FKG                  YE +K +        S   + L 
Sbjct: 156 LSTIFDIVKDEGISGLFKGLNPALILVINPIIQYTV-YEQLKNWI-----LSSRQTRTLS 209

Query: 208 SSASVIAGIVSKTI----VFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLR 263
            S + I G V K       +P  T++ R  +     LG        +K+  +    + L 
Sbjct: 210 PSWAFILGAVGKLAATGSTYPYVTMKARMHL-----LGE-------HKSSTAAPPRSLLS 257

Query: 264 LALMIVEKEGLLALYHGYTLGIAKSV 289
           L   I++K+G+L LY G  + + +S+
Sbjct: 258 LMAEIIKKDGILGLYRGIGIKLVQSI 283

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 11/140 (7%)

Query: 34  PLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY 93
           P+D +K R+QL+     +  G++ +FK+++  EG  AL  G  P +  Y L GS +F  Y
Sbjct: 33  PIDVVKTRIQLEPTVYNK--GMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGY 90

Query: 94  AILNKLL-------SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELST 146
            +  KL        +       I+ G   A++   + IA  P +  R R ++  +   + 
Sbjct: 91  ELFKKLAIDNMGYDNAVNYKNTIYIGSA-AIAEFFADIALCPLEATRIRLVSQPTFA-NG 148

Query: 147 MLSTAQEIWRHEGFRGFFKG 166
           +      I + EG   F+ G
Sbjct: 149 LFGGFSRILKEEGVGSFYNG 168

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 61/149 (40%), Gaps = 15/149 (10%)

Query: 28  ARIVTAPLDTLKIRL--QLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILY 85
           A I   PL+  +IRL  Q   AN     G+   F R++++EGV + + G  P +   I Y
Sbjct: 125 ADIALCPLEATRIRLVSQPTFAN-----GLFGGFSRILKEEGVGSFYNGFTPILFKQIPY 179

Query: 86  GSTQFTSY-----AILNKLLSKSQLPAQIHTGM---VGALSGTCSAIASYPCDVLRTRFI 137
              +F  +     A       K  +    HT +    G  +G  +A+ S P D L ++  
Sbjct: 180 NIAKFFVFEHAANAYFGLAGPKETMSETTHTAINLAAGLTAGLAAAVVSQPADTLLSKVN 239

Query: 138 ANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
                   + +    ++ +  GF G F G
Sbjct: 240 KTKKAPGQSTIGLLAQLAKQLGFVGSFTG 268

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 35/190 (18%), Positives = 69/190 (36%), Gaps = 21/190 (11%)

Query: 113 MVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXX 172
           + GA+    +  +  P DV++TR     +     M+S+ ++I   EG      G      
Sbjct: 18  LAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLL 77

Query: 173 XXXXXXXXXXXXYESVKIFCEQRPDRDSSV--IQLLESSASVIAGIVSKTIVFPIDTVRK 230
                       YE  K         D++V     +   ++ IA   +   + P++  R 
Sbjct: 78  GYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRI 137

Query: 231 RYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVP 290
           R        +  P   N  +  +              I+++EG+ + Y+G+T  + K +P
Sbjct: 138 RL-------VSQPTFANGLFGGFSR------------ILKEEGVGSFYNGFTPILFKQIP 178

Query: 291 STVVSLGVYE 300
             +    V+E
Sbjct: 179 YNIAKFFVFE 188

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 71/167 (42%), Gaps = 14/167 (8%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEG--V 68
           E+   + L  G  +G   ++VT P+  +  R QL    + +   +    K++  +    +
Sbjct: 115 ELSTIEELALGMSAGAMTQVVTNPISVISTRQQL--TKDGEDASLKAVIKQIYEESNGDL 172

Query: 69  RALWKGNVPAMAMY----ILYGSTQFTSYAILN-KLLSKSQ-LPAQIHTG---MVGALSG 119
            A WKG   A+ +     I YGS Q     IL  K LS SQ +  Q+  G   ++G  S 
Sbjct: 173 TAFWKGFKVALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSK 232

Query: 120 TCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
             S   + P  V +       S+   T     Q I+++EGF   +KG
Sbjct: 233 MISTFVTQPLIVAKITLQGKGSK-FKTFQEVLQHIYQNEGFLSLWKG 278

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           ++ + G  S + +  VT PL   KI LQ + +    +  +L   + + + EG  +LWKG 
Sbjct: 223 ENFLLGMFSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVL---QHIYQNEGFLSLWKGV 279

Query: 76  VPAMAMYILYGSTQFT 91
           +P ++  ++     FT
Sbjct: 280 IPQVSKGVIVQGLLFT 295

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/147 (20%), Positives = 58/147 (39%), Gaps = 19/147 (12%)

Query: 107 AQIHTGMVGALSGTCSAIASYPCDVLRTRFIANH-------SRE---LSTMLSTAQEIWR 156
           A + +   GA++ + +A   YP D+ +T     H       S+E      ++    +I++
Sbjct: 2   ASLESAFTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFK 61

Query: 157 HEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK----IFCEQRPD--RDSSVIQLL---E 207
             GF G ++G                  Y  ++    +F   R     DS  I+L    E
Sbjct: 62  KRGFLGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEE 121

Query: 208 SSASVIAGIVSKTIVFPIDTVRKRYQV 234
            +  + AG +++ +  PI  +  R Q+
Sbjct: 122 LALGMSAGAMTQVVTNPISVISTRQQL 148

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 82/190 (43%), Gaps = 33/190 (17%)

Query: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQ------LQLANEAQYGG 54
           M  DH       P    L  G  + + A    APL+ +K RLQ           +  +  
Sbjct: 140 MFRDHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKD 199

Query: 55  ILVTFKRLVRQEGVRALWKG-------NVPAMAMYILYGSTQF---TSYAILNKLLSKSQ 104
           +L   +  +R  G + L+KG       +VP  A+Y  +GS +F     +   ++   +  
Sbjct: 200 LLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIY--WGSYEFYKKNFWIDFSEQCLRWN 257

Query: 105 LPAQ----IHTGMVGALSGTCSAIASYPCDVLRTRF-----IANHSRELSTMLSTAQEIW 155
           L       I++ + G++SG+ +A+ ++P DV +TR      I N  R  +T++S  + + 
Sbjct: 258 LSPNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQR--NTLVSPKKRV- 314

Query: 156 RHEGFRGFFK 165
                RG FK
Sbjct: 315 ---SARGMFK 321

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/280 (20%), Positives = 100/280 (35%), Gaps = 30/280 (10%)

Query: 43  QLQLANEA-QYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLS 101
            +Q  N A ++      F ++   EG+  LW+G    + M I      F+ Y +      
Sbjct: 87  DIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSP 146

Query: 102 KSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRF--IANHSRELSTML-------STAQ 152
                  ++    GA +   +A    P ++++TR   I    ++ +T +        T  
Sbjct: 147 MRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRN 206

Query: 153 EIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK-----IFCEQ------RPDRDSS 201
           EI R  G++  FKG                  YE  K      F EQ       P+ D  
Sbjct: 207 EI-RSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFF 265

Query: 202 VIQLLESSASVIAGIVSKTIVFPIDTVRKRYQV-IDWQQLGHPGHTNKAYKAYKSYTSTN 260
           +   +  S   ++G  +  +  P D  + R Q+ +D +        N      K  ++  
Sbjct: 266 INSFIGGS---VSGSSAALLTHPFDVGKTRMQITMDIEN----KQRNTLVSPKKRVSARG 318

Query: 261 FLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
             +    I + EG  ALY G    + K  PS  + +  YE
Sbjct: 319 MFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYE 358

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 13/75 (17%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLV------------ 63
            S + G +SG SA ++T P D  K R+Q+ +  E +    LV+ K+ V            
Sbjct: 267 NSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNI 326

Query: 64  -RQEGVRALWKGNVP 77
            + EG  AL+ G +P
Sbjct: 327 KQTEGYGALYTGLIP 341

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 39/92 (42%), Gaps = 4/92 (4%)

Query: 209 SASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMI 268
           +AS + G V   +++      K    I WQ +       K      + T   F +++   
Sbjct: 52  AASELKGSVGTEVIYDHVVANKNSPKIFWQDVCFQDIQCKNSALRFNSTWEAFTKIS--- 108

Query: 269 VEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
            E EGL  L+ G ++ +  ++P+ VV    YE
Sbjct: 109 -EVEGLATLWRGLSITLLMAIPANVVYFSGYE 139

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 93/245 (37%), Gaps = 27/245 (11%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGV- 68
           +  P++   +AG + GI        LDT+K R Q    N  +Y  +L  ++ +  +EG  
Sbjct: 49  EHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTR-QQGAPNVHKYKHMLQAYRTMFIEEGFR 107

Query: 69  RALWKGNVPAM-----AMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSA 123
           R L+ G   AM     +  I + + +FT   ++N         + +  G +G      S+
Sbjct: 108 RGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTF-SHLTAGFLGDF---FSS 163

Query: 124 IASYPCDVLRTRFIA---------NHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXX 174
               P +VL+TR            N      ++ +    I+R EG    F G        
Sbjct: 164 FVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARD 223

Query: 175 XXXXXXXXXXYESVK--IFCEQRPD---RDSSVIQLLESSASVIAGIVSKTIVFPIDTVR 229
                     YE  +   F  +  D    D S+   + + A   AG ++  +  P+D V+
Sbjct: 224 LPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGA--CAGGLAGILTTPLDVVK 281

Query: 230 KRYQV 234
            R Q 
Sbjct: 282 TRVQT 286

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 75/194 (38%), Gaps = 16/194 (8%)

Query: 110 HTGMVGALSGTCSAIASYPCDVLRTRFI-ANHSRELSTMLSTAQEIWRHEGFR-GFFKGX 167
           H  + G + G     A +  D ++TR   A +  +   ML   + ++  EGFR G + G 
Sbjct: 55  HCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYGGY 114

Query: 168 XXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDT 227
                            YE  K         + +   L   +A  +    S  +  P + 
Sbjct: 115 CAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHL---TAGFLGDFFSSFVYVPSEV 171

Query: 228 VRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLAL-MIVEKEGLLALYHGYTLGIA 286
           ++ R Q+   Q   +  H N  Y  YKS      LR A+  I   EG+ AL+ GY   +A
Sbjct: 172 LKTRLQL---QGCYNNPHFNSGYN-YKS------LRNAIATIYRTEGVAALFFGYKATLA 221

Query: 287 KSVPSTVVSLGVYE 300
           + +P + +    YE
Sbjct: 222 RDLPFSALQFAFYE 235

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANE 49
            ++ +   +V G  +G  A I+T PLD +K R+Q QL ++
Sbjct: 252 HDLSISNEIVTGACAGGLAGILTTPLDVVKTRVQTQLPSQ 291

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 37/97 (38%), Gaps = 26/97 (26%)

Query: 210 ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPG-----HTNKAYKAYKSYTSTNFLRL 264
           A  + GI+  + +  +DTV+ R Q       G P      H  +AY+             
Sbjct: 59  AGGVGGIIGDSAMHSLDTVKTRQQ-------GAPNVHKYKHMLQAYRT------------ 99

Query: 265 ALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
             M +E+     LY GY   +  S PS  +    YE+
Sbjct: 100 --MFIEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEF 134

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 59/115 (51%), Gaps = 3/115 (2%)

Query: 54  GILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGM 113
            I  T + +V+  G    ++G++P +   +   + +FT+Y  L +++S ++  ++ +   
Sbjct: 192 NIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMISPNKPLSEYYAFG 251

Query: 114 VGALSGTCSAIA-SYPCDVLRTRFIANHSREL-STMLSTAQEIWRHEGFRGFFKG 166
           +G  S +C+ +A + P DV++TR  + ++  L    L+     +  EG    +KG
Sbjct: 252 IGVFS-SCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKG 305

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 21  GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80
           G  S  +   +T P+D +K R+Q +    + Y   L    R   +EG+ +LWKG VP + 
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYT-WSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLF 311

Query: 81  MYILYGSTQFTSYAILNKLL 100
              L G   F  Y  ++ L+
Sbjct: 312 KVGLSGGVSFGVYQYVDNLM 331

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 66/169 (39%), Gaps = 25/169 (14%)

Query: 135 RFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK-IFCE 193
           +F+       + + +T +E+ +  GF  FF+G                  Y ++K +   
Sbjct: 181 KFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMISP 240

Query: 194 QRPDRDSSVIQL-LESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKA 252
            +P  +     + + SS +V+A      +  PID V+ R Q            +   +  
Sbjct: 241 NKPLSEYYAFGIGVFSSCAVVA------LTQPIDVVKTRMQ------------SKYTWSL 282

Query: 253 YKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
           Y+     N L        +EGL +L+ G+   + K   S  VS GVY++
Sbjct: 283 YR-----NSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQY 326

>Scas_328.1
          Length = 227

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 3/119 (2%)

Query: 51  QYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNK-LLSKSQLPAQI 109
           ++ GIL  +K+ +  +GV  L++G +P++   ++Y    F  Y  L   LL+ S   A +
Sbjct: 78  KFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFENAFL 137

Query: 110 HTGMVGALSGTCSAIASYPCDVLRTRFI--ANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
            + ++G      ++  SYP D +R R +  +  + +    +   Q+I   EG    FKG
Sbjct: 138 PSFLLGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKG 196

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRA 70
           E     S + G    ISA   + PLDT++ R+ +      +Y G +  F+++V QEGV +
Sbjct: 133 ENAFLPSFLLGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYS 192

Query: 71  LWKG 74
           L+KG
Sbjct: 193 LFKG 196

>Scas_673.17
          Length = 314

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 73/161 (45%), Gaps = 15/161 (9%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFKRLVRQEGVRALW 72
           F+  +AG +   +      P+D +K R+QL+  + N+    G++ +FK+++  EG  AL 
Sbjct: 21  FKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNK----GMVGSFKKIIADEGAGALL 76

Query: 73  KGNVPAMAMYILYGSTQFTSYAILNKLLSKS-------QLPAQIHTGMVGALSGTCSAIA 125
            G  P +  Y + G+ +F  Y +  KL   +            ++ G   A++   + IA
Sbjct: 77  TGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSA-AVAEFLADIA 135

Query: 126 SYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
             P +  R R ++  +   + ++     I + EG   F+ G
Sbjct: 136 LCPLEATRIRLVSQPTFA-NGLVGGFSRILKEEGVGSFYSG 175

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 64/149 (42%), Gaps = 15/149 (10%)

Query: 28  ARIVTAPLDTLKIRL--QLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILY 85
           A I   PL+  +IRL  Q   AN     G++  F R++++EGV + + G  P +   I Y
Sbjct: 132 ADIALCPLEATRIRLVSQPTFAN-----GLVGGFSRILKEEGVGSFYSGFTPILFKQIPY 186

Query: 86  GSTQFTSYAILNKLL-----SKSQLPAQIHTG---MVGALSGTCSAIASYPCDVLRTRFI 137
              +F  +   +++      +K  L    +TG   + G  +G  +A  S P D L ++  
Sbjct: 187 NIAKFLVFERASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVN 246

Query: 138 ANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
                   + +    ++ +  G  G F G
Sbjct: 247 KTKKAPGQSTIGLLAQLAKQLGVIGSFAG 275

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 73/167 (43%), Gaps = 14/167 (8%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLVRQEG 67
           Q + + Q  + G   G +   + +P++ ++IRLQ Q  +   A++ G +   K+L R  G
Sbjct: 114 QHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNG 172

Query: 68  VRALWKGNVPAMAMYILYGSTQFTSYAIL-----NKLLSKSQLPAQIHTGMVGALSGTCS 122
              L +G  P M          F +Y  L        + +  +PA     + GA SGT  
Sbjct: 173 --QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAW-KLCLFGAASGTLL 229

Query: 123 AIASYPCDVLRTRFIANH---SRELSTMLSTAQEIWRHEGFRGFFKG 166
               YP DV+++    ++    +  + +L+  + I   +G  G FKG
Sbjct: 230 WTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKG 276

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 53/128 (41%), Gaps = 9/128 (7%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73
           V + L+AG   GI+  +V  P DT K+RLQ    +E     + V  K L++ EG    +K
Sbjct: 23  VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ---TSETSTNAVKV-IKDLIKNEGPMGFYK 78

Query: 74  GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMV-----GALSGTCSAIASYP 128
           G +  +       S QF     + +        A  H  ++     G   G  ++  + P
Sbjct: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASP 138

Query: 129 CDVLRTRF 136
            + +R R 
Sbjct: 139 IEHIRIRL 146

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKR-LVRQEGV 68
           +++P ++  + G  SG     +  PLD +K  +Q       + G  ++T  R ++ ++GV
Sbjct: 211 KDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGV 270

Query: 69  RALWKGNVPAM 79
             L+KG  P M
Sbjct: 271 SGLFKGFAPTM 281

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 53/110 (48%), Gaps = 1/110 (0%)

Query: 58  TFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGAL 117
           T K +    G+R   +G  P +   +   + +FT+Y  L +L+S ++   + +  ++G +
Sbjct: 273 TVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLNEYYAFVLGFI 332

Query: 118 SGTCSAIASYPCDVLRTRFIANHS-RELSTMLSTAQEIWRHEGFRGFFKG 166
           S       + P DV++TR  + ++       L+ A  I+  EG   F+KG
Sbjct: 333 SSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWKG 382

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG 74
           + + V G +S  +   VT P+D +K R+Q + A  A Y   L    R+  +EG+   WKG
Sbjct: 324 YYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYA-WANYKNSLNCAYRIFVEEGIPKFWKG 382

Query: 75  NVPAMAMYILYGSTQFTSYAILNKLL 100
             P +    L G   F  Y  +  L+
Sbjct: 383 WAPRLMKVGLSGGVSFGVYQYVENLI 408

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 74/339 (21%), Positives = 120/339 (35%), Gaps = 88/339 (25%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           +VAG  + +    ++ P + LK  LQL   L N   +  ++  FK      G  AL  G 
Sbjct: 98  IVAGSCASVFQTTISYPFEFLKTGLQLHRSLPNAHPFN-MMHQFKYYF--SGCAALNVGT 154

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG----MVGALSGTCSAIASYPCDV 131
                  +    T+FT++    +LL     P+   +G    M GA++G   ++   P + 
Sbjct: 155 -------LFKTVTRFTTFEKACQLLKDPSSPSAFISGPRLLMAGAITGFMESLWVVPFEN 207

Query: 132 LRTRFIAN---------------------HSREL-------------------------- 144
           ++T  + N                       RE+                          
Sbjct: 208 IKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERLFLHYEEHPT 267

Query: 145 STMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK-IFCEQRPDRDSSVI 203
           S   ST +EI+   G RGF +G                  Y S+K +    +P  +    
Sbjct: 268 SRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLNEYYAF 327

Query: 204 QL-LESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFL 262
            L   SS +V+A      +  PID ++ R Q            +  A+  YK     N L
Sbjct: 328 VLGFISSCAVVA------VTQPIDVIKTRMQ------------SKYAWANYK-----NSL 364

Query: 263 RLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301
             A  I  +EG+   + G+   + K   S  VS GVY++
Sbjct: 365 NCAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQY 403

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 135/314 (42%), Gaps = 50/314 (15%)

Query: 9   GQEVPVFQSLV-AGCLSGISARIVTAPLDTLKIRLQLQLANEAQ--YGGILVT-FKR--- 61
           G E+   Q  V +G  +G    I + PLD LK+RLQL   N A   Y G++   F+R   
Sbjct: 2   GHELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQW 61

Query: 62  ---LVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS-------QLPAQIHT 111
              L R  GV  L  GN  A A+Y  +G  +      L  L ++S       +LPA  + 
Sbjct: 62  GRELYRGLGVNLL--GNSVAWALY--FGCYRCAKDIALRHLGNESATGIMDRRLPAHAYM 117

Query: 112 GMVGALSGTCSAIASYPCDVLRTRFIA-NHSRELSTMLSTAQEIWRHEGFRGFFKGXXXX 170
              G+ SG  +A+ + P  V++TR +A + +    +      ++++ EG   F++G    
Sbjct: 118 LAAGS-SGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRG-VVP 175

Query: 171 XXXXXXXXXXXXXXYESVKIF----CEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPID 226
                         Y+++K         + +R  SV +++    + I+ ++S T V+P  
Sbjct: 176 SLLGVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEII--GITCISKMISVTSVYPFQ 233

Query: 227 TVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIA 286
            ++ +      Q  G P               +   +L   +  +EG+   Y G +  + 
Sbjct: 234 LLKSKL-----QDFGAP---------------SGITQLVQTVYSREGIRGFYRGLSANLL 273

Query: 287 KSVPSTVVSLGVYE 300
           ++VP+T ++  VYE
Sbjct: 274 RAVPATCITFFVYE 287

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 74/196 (37%), Gaps = 41/196 (20%)

Query: 115 GALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXX 174
           GA +GT + +A +P D L+TR  A                + + G++G ++G        
Sbjct: 13  GAAAGTSTDLAFFPIDTLKTRLQAKGG------------FFANGGYKGVYRGLGSAVVAS 60

Query: 175 XXXXXXXXXXYESVKIFCEQRP--------DRDSSVIQLLESSASVIAGIVSKTIVFPID 226
                     Y+S+K  C  RP          D +   L    +S    I +  +  P +
Sbjct: 61  APSASLFFVAYDSMK--CWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACMVRVPAE 118

Query: 227 TVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLL-ALYHGYTLGI 285
            +++R Q                   +++ +S   L+  L     EGL   LY G++  I
Sbjct: 119 VIKQRTQT------------------HRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTI 160

Query: 286 AKSVPSTVVSLGVYEW 301
            + +P T +   +YE+
Sbjct: 161 MREIPFTCIQFPLYEY 176

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 71/150 (47%), Gaps = 13/150 (8%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76
           SLV+G  +G S  +   P+DTLK RLQ +    A  G     +K + R  G   +   + 
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANGG-----YKGVYRGLGSAVV--ASA 61

Query: 77  PAMAM-YILYGSTQFTSYAILNKLLSKSQ-LPAQIHTGMVGALSGTCSA-IASYPCDVLR 133
           P+ ++ ++ Y S +  S  ++ +LL K +   A   + MV +  G  SA +   P +V++
Sbjct: 62  PSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACMVRVPAEVIK 121

Query: 134 TRFIANHSRELSTMLSTAQEIWRHEGFRGF 163
            R     +   ++ L T Q + R+E   G 
Sbjct: 122 QR---TQTHRTNSSLQTLQALLRNENGEGL 148

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 79/193 (40%), Gaps = 36/193 (18%)

Query: 115 GALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXX 174
           GA +GT + +A +P D L+TR            L      + + G++G ++G        
Sbjct: 13  GAAAGTSTDLAFFPIDTLKTR------------LQAKGGFFANGGYKGVYRGLGSAVIAS 60

Query: 175 XXXXXXXXXXYESVKIFCEQRPDR----DSSVIQLLESSASVIAGIVSKTIV-FPIDTVR 229
                     Y+S+K++ +    +    ++ +   L    S   G VS  +V  P + ++
Sbjct: 61  APSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLVRVPAEVIK 120

Query: 230 KRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLL-ALYHGYTLGIAKS 288
           +R Q            T+K   +++++T        L     EG+L  LY G+   I + 
Sbjct: 121 QRTQ------------THKTNSSWQTFTKI------LQNENGEGVLRNLYRGWNTTIMRE 162

Query: 289 VPSTVVSLGVYEW 301
           +P T +   +YE+
Sbjct: 163 IPFTCIQFPLYEF 175

 Score = 36.2 bits (82), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 70/151 (46%), Gaps = 12/151 (7%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76
           SL +G  +G S  +   P+DTLK RLQ +    A  G     +K + R  G   +   + 
Sbjct: 9   SLASGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANGG-----YKGVYRGLGSAVI--ASA 61

Query: 77  PAMAMYIL-YGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSA-IASYPCDVLRT 134
           P+ +++ + Y S +  S  +++K ++ +   A   + M  +  G  SA +   P +V++ 
Sbjct: 62  PSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLVRVPAEVIKQ 121

Query: 135 RFIANHSRELSTMLSTAQEIWRHEGFRGFFK 165
           R     + + ++   T  +I ++E   G  +
Sbjct: 122 R---TQTHKTNSSWQTFTKILQNENGEGVLR 149

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 77/163 (47%), Gaps = 22/163 (13%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73
           +  S VAG ++ I++     P+  +  R+ +  + ++    +L     +VR++GV AL+ 
Sbjct: 120 ILSSAVAGSMTAIASN----PIWVVNTRMTVAKSEQSTLAVLL----DIVRKDGVTALFN 171

Query: 74  GNVPAMAMYILYGSTQFTSYAILNKLL-----SKSQLPA-QIHTGMVGALSGTCSAIASY 127
           G  PA+ M +     Q+T +  L  ++     S   LP+     G VG L+ T S   +Y
Sbjct: 172 GLRPAL-MLVSNPIIQYTVFEQLKNVVLKWSGSDVLLPSWAFLLGAVGKLAATGS---TY 227

Query: 128 PCDVLRTRFIANHSRELS----TMLSTAQEIWRHEGFRGFFKG 166
           P   L+TR      +E +    +M S   +I + EG +G + G
Sbjct: 228 PYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKKEGIQGLYHG 270

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 57/269 (21%), Positives = 107/269 (39%), Gaps = 32/269 (11%)

Query: 31  VTAPLDTLKIRLQLQLANE---AQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87
           +T PL TL  R+Q+   ++    +    L   + + R+EGV   + G   AM        
Sbjct: 33  LTMPLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSL 92

Query: 88  TQFTSYAILNKLLSKSQLPAQIHTG---MVGALSGTCSAIASYPCDVLRTRFIANHSREL 144
             +  Y +  +   + +   +++T    +  A++G+ +AIAS P  V+ TR     S + 
Sbjct: 93  NYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSEQ- 151

Query: 145 STMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQ 204
            + L+   +I R +G    F G                  +E +K    +    D     
Sbjct: 152 -STLAVLLDIVRKDGVTALFNG-LRPALMLVSNPIIQYTVFEQLKNVVLKWSGSD----- 204

Query: 205 LLESSASVIAGIVSKTI----VFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTN 260
           +L  S + + G V K       +P  T++ R  +   ++               + T  +
Sbjct: 205 VLLPSWAFLLGAVGKLAATGSTYPYITLKTRMHLAKGKE--------------DADTQQS 250

Query: 261 FLRLALMIVEKEGLLALYHGYTLGIAKSV 289
              L + IV+KEG+  LYHG  + + +S+
Sbjct: 251 MWSLMVDIVKKEGIQGLYHGIGVKLTQSI 279

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 81/187 (43%), Gaps = 34/187 (18%)

Query: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLA---------NE----------- 49
           Q +  +  L+AG L+GI   +   P + +K  L +Q A         N+           
Sbjct: 71  QRLTGYNLLIAGTLTGIVESLFIIPFENIKTTL-IQSAMIDHKKLEKNQPVVNAKATFHK 129

Query: 50  --------AQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL- 100
                   A+   +L   K + +  G  A  +G    +   I   S QFT+Y    +LL 
Sbjct: 130 VATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQ 189

Query: 101 SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSR-ELSTMLSTAQEIWRHEG 159
           +++   + + TG+  A S T  A+ + P DV++TR ++ +++ E    L+    I+  EG
Sbjct: 190 ARNDKASSVITGL--ATSFTLVAM-TQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEG 246

Query: 160 FRGFFKG 166
              F+KG
Sbjct: 247 MATFWKG 253

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76
           S++ G  +  +   +T P+D +K R+  Q A + +Y   L    R+  QEG+   WKG++
Sbjct: 197 SVITGLATSFTLVAMTQPIDVVKTRMMSQNA-KTEYKNTLNCMYRIFVQEGMATFWKGSI 255

Query: 77  PAMAMYILYGSTQFTSYAILNKLLSKS 103
                  + G   FT Y  ++ LL  S
Sbjct: 256 FRFMKVGISGGLTFTVYEQVSLLLGFS 282

>Scas_613.24
          Length = 177

 Score = 40.4 bits (93), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 68/162 (41%), Gaps = 23/162 (14%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77
           LV+G + G+S+ +   PLD LK R+Q         G  L +  + ++       W+G +P
Sbjct: 12  LVSGFIGGLSSAVTLQPLDLLKTRIQ------QHKGATLWSAIKDIKDP--IQFWRGTLP 63

Query: 78  AMAMYILYGS-----------TQFTSYAILNKLLSKSQLP--AQIHTGMVGALSGTCSAI 124
           + A+    GS           TQ       +     S LP        + GA++      
Sbjct: 64  S-ALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGY 122

Query: 125 ASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
            + P  +L+ R+ + +     +M    ++I++ EG  GFFKG
Sbjct: 123 ITMPITILKVRYESTY-YSYKSMNEAIKDIYKMEGISGFFKG 163

>Scas_705.9
          Length = 323

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 11  EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRA 70
           ++ V Q+ + G L+ I + I+T PL   K+ LQ   +    +  +L   + L ++EGV A
Sbjct: 219 QLTVNQNFILGALAKIISTIITQPLIVAKVSLQRSNSKFKHFEEVL---RYLYKEEGVLA 275

Query: 71  LWKGNVPAMAMYIL 84
           LWKG  P +   +L
Sbjct: 276 LWKGVGPQLTKGVL 289

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 14/74 (18%)

Query: 107 AQIHTGMVGALSGTCSAIASYPCDVLRT----RFIANHSRELS----------TMLSTAQ 152
           + + + + GA++ T + +  YP DV +T       A  + ELS           ++    
Sbjct: 2   SNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLI 61

Query: 153 EIWRHEGFRGFFKG 166
            I+R  G RG ++G
Sbjct: 62  RIFRKRGLRGLYQG 75

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 11/80 (13%)

Query: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKR-- 61
           DH      +   Q+ + G LS + + +VT PL   K  LQ         G    TF+   
Sbjct: 212 DHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQ-------SAGSKFTTFQEAL 264

Query: 62  --LVRQEGVRALWKGNVPAM 79
             L + EG+++LWKG +P +
Sbjct: 265 LYLYKNEGLKSLWKGVLPQL 284

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 71/180 (39%), Gaps = 29/180 (16%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLA-------NEAQ------YGGILVTFKRL 62
           +S + G ++   A I   PLD  K  +Q Q++       NE +      Y  ++     +
Sbjct: 5   ESALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINI 64

Query: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQL--------------PAQ 108
            +++G+  L++G         +     F  Y  + K   K +L              P+ 
Sbjct: 65  FKEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPST 124

Query: 109 IHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEG--FRGFFKG 166
           I   ++G  + + S + + P  V+ TR    HS E +   +  ++I+R        F+KG
Sbjct: 125 IEELVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRENNGDITAFWKG 184

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 3/88 (3%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG 74
           +Q+   G LS + + I+T PL   K  LQ   +N + +  +L     L + EG+R+ WKG
Sbjct: 245 YQNFTLGVLSKMISAIITMPLIISKAWLQRNGSNFSSFQQVLY---YLYKNEGLRSWWKG 301

Query: 75  NVPAMAMYILYGSTQFTSYAILNKLLSK 102
             P +A  +L     F     L KL+ +
Sbjct: 302 LSPQLAKGVLVQGLLFMFKGELTKLMKR 329

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 79/198 (39%), Gaps = 49/198 (24%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLA--------------------------- 47
           F+S ++G ++   A  V  PLD +K  +Q QL                            
Sbjct: 4   FESALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPV 63

Query: 48  -------NEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100
                  N  QY        ++ +QEG+R L++G   ++        + F  Y+ + K  
Sbjct: 64  PIKLNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCY 123

Query: 101 SKSQLPAQIHTG-------MVGALSGTCSAIASYPCDVLRTRFIANHSRE----LSTMLS 149
            + +L  + +T        ++G ++   S I + P  ++  R     +R+     +  L+
Sbjct: 124 FRVKLINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISAR---QQTRQGIDGDNDFLT 180

Query: 150 TAQEIWRHE-GFRGFFKG 166
            A+EI++ +   +GF+KG
Sbjct: 181 VAKEIYKEQRSIKGFWKG 198

>Kwal_23.3529
          Length = 395

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 76/173 (43%), Gaps = 24/173 (13%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQ-------LANEAQYGGILVTFKRLVRQEGVRA 70
           L AG    + + +V  P + LK RLQLQ         +   Y  +      +VR EG + 
Sbjct: 184 LTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQT 243

Query: 71  LWKGNVPAMAMYILYGSTQFTSYAILNK--LLSKSQLPAQ----IHTGMVGALSGTCSAI 124
           L+ G    +   + + + QF  Y    +     + + P+Q    ++  + GA +G  + I
Sbjct: 244 LFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGI 303

Query: 125 ASYPCDVLRTRF-------IANHSREL----STMLSTAQEIWRHEGFRGFFKG 166
            + P DV++TR        +A+ S  L    ++++     ++R EG  GFF G
Sbjct: 304 ITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSG 356

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 54/111 (48%), Gaps = 11/111 (9%)

Query: 31  VTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGV-RALWKGNVPAM-----AMYIL 84
           V   LDT+K R Q    N  +Y  ++  ++++  +EG+ R L+ G   AM     +  I 
Sbjct: 102 VMHSLDTVKTR-QQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIF 160

Query: 85  YGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTR 135
           +G+ + T   +++       L + +  G+ G L    S++   P +VL+TR
Sbjct: 161 FGTYELTKRKLIDDWGVNETL-SHLTAGLSGDL---VSSVVYVPSEVLKTR 207

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 73/175 (41%), Gaps = 18/175 (10%)

Query: 130 DVLRTRFI-ANHSRELSTMLSTAQEIWRHEGFR-GFFKGXXXXXXXXXXXXXXXXXXYES 187
           D ++TR   A ++ +   M+S  Q+I+  EG R G + G                  YE 
Sbjct: 107 DTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFFGTYEL 166

Query: 188 VKIFCEQRPDRDSSVIQLLESSASVIAG-IVSKTIVFPIDTVRKRYQVIDWQQLGHPGHT 246
            K    ++   D  V + L    + ++G +VS  +  P + ++ R Q+   Q   +  H 
Sbjct: 167 TK----RKLIDDWGVNETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQL---QGCYNNPHF 219

Query: 247 NKAYKAYKSYTSTNFLRLALM-IVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           +  Y  Y++      LR A+  IV  EG   L+ GY   + + +P +      YE
Sbjct: 220 HSGYN-YRN------LRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYE 267

>Kwal_55.21106
          Length = 328

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           Q+ + G  S + + ++T PL   K  LQ   +N   +  +L+    L +QEG+ +LWKG 
Sbjct: 231 QNFLLGVFSKVISTLITQPLIVSKAYLQRTGSNFQSFQQVLL---YLYKQEGLISLWKGL 287

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLSK 102
            P ++  IL     F     L KL+ +
Sbjct: 288 APQLSKGILVQGLLFMFKGELTKLIKR 314

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 63/310 (20%), Positives = 114/310 (36%), Gaps = 55/310 (17%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQ-------------------LANEAQYGGIL 56
           +S + G ++   A +V  PLD +K  +Q Q                      E +Y   L
Sbjct: 5   ESAITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSL 64

Query: 57  VTFKRLVRQEGVRALWKG--------NVPAMAMYILYGSTQ--FTSYAILNKLLSKSQLP 106
               ++ + +GV  L++G         + + + +  Y   +  F  Y +L   L K   P
Sbjct: 65  DALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTP 124

Query: 107 AQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEG-FRGFFK 165
            ++  G+V A     S I + P  V+ TR   + S           +I+  +    GF++
Sbjct: 125 EELLLGIVAA---AVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWR 181

Query: 166 GXXXXXXXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLESSASV------IAGIVSK 219
           G                   +   IF   +   D +  QLLE+S  +      + G+ SK
Sbjct: 182 GFKVSLILTVNPSITFASYEKLQDIFITSKRAVDENG-QLLETSGQLSPRQNFLLGVFSK 240

Query: 220 TIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYH 279
            I   I                 P   +KAY         +F ++ L + ++EGL++L+ 
Sbjct: 241 VISTLIT---------------QPLIVSKAYLQRTGSNFQSFQQVLLYLYKQEGLISLWK 285

Query: 280 GYTLGIAKSV 289
           G    ++K +
Sbjct: 286 GLAPQLSKGI 295

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 20  AGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKG 74
           +  LS   A  VTAP DT+K R+QL+    +++     TF  +V+ E V  L+ G
Sbjct: 229 SAVLSASLATTVTAPFDTIKTRMQLE---PSKFTNSFNTFTSIVKNENVLKLFSG 280

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 18 LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77
          L+ G   G+++ +   PLD LK R+Q               +K L   +    LW+G +P
Sbjct: 14 LIGGFFGGLTSAVALQPLDLLKTRIQQDKK--------ATLWKNLKEIDSPLQLWRGTLP 65

Query: 78 A 78
          +
Sbjct: 66 S 66

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 70/182 (38%), Gaps = 32/182 (17%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ-------LANEAQYGGILVTFKRLVRQE 66
            F  L AG L    +  V  P + LK RLQLQ         +   Y  +      +VR+E
Sbjct: 150 TFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRRE 209

Query: 67  GVRALWKGNVPAMAMYILYGSTQFTSY--------AILNKLLSKS-QLPAQIHTGMVGAL 117
           G   L+ G    ++  + +   QF  Y        A+ NK   +   L  +I TG     
Sbjct: 210 GWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAG- 268

Query: 118 SGTCSAIASYPCDVLRTR-------FIANHSREL------STMLSTAQEIWRHEGFRGFF 164
               + I + P DV++TR          N S+ L      +++      +++ EG  G F
Sbjct: 269 --GLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLF 326

Query: 165 KG 166
            G
Sbjct: 327 SG 328

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 103/263 (39%), Gaps = 27/263 (10%)

Query: 35  LDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVR-ALWKGNVPAMAMYILYGSTQFTSY 93
           LDT+K R Q    +  +Y  ++  ++ ++ +EG+R  L+ G   AM       +  F +Y
Sbjct: 76  LDTVKTR-QQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATY 134

Query: 94  AILN-KLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTR-----------FIANHS 141
                K++ +  +         G L    S+    P +VL+TR           F + ++
Sbjct: 135 EYTKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYN 194

Query: 142 -RELSTMLSTAQEIWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK--IFCEQRPDR 198
            + L+  ++T   I R EG+   F G                  YE  +   F  +    
Sbjct: 195 YKNLTDAVTT---IVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTF 251

Query: 199 DSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTS 258
           D  +    E      AG ++  I  P+D V+ R Q     QL  P     + +  K  T 
Sbjct: 252 DEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQT----QL--PDIPENSSQNLKQQTL 305

Query: 259 TNFLRLALMIVEK-EGLLALYHG 280
           TN +   +M V K EGL  L+ G
Sbjct: 306 TNSITKGMMTVYKTEGLAGLFSG 328

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 39/93 (41%), Gaps = 11/93 (11%)

Query: 209 SASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKS-YTSTNFLRLALM 267
           +A  +   +S  +  P + ++ R Q+         G  N  +  ++S Y   N       
Sbjct: 155 TAGFLGDFISSFVYVPSEVLKTRLQL--------QGRYNNPF--FRSGYNYKNLTDAVTT 204

Query: 268 IVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           IV +EG   L+ GY   +++ +P + +    YE
Sbjct: 205 IVRREGWPTLFFGYKATLSRDLPFSGLQFAFYE 237

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 35.4 bits (80), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           Q+ + G LS I +  +T PL   K  LQ   +    +  +L     L R EG  ALWKG 
Sbjct: 255 QNFLIGVLSKIISTCLTHPLIVAKASLQRSSSKFTSFQEVLT---YLYRHEGAHALWKGL 311

Query: 76  VPAM 79
           +P +
Sbjct: 312 LPQL 315

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 41/105 (39%)

Query: 62  LVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTC 121
           L +  GVR L++G   A+    +  + Q   Y+   + LS+          +  ALS   
Sbjct: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVA 226

Query: 122 SAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKG 166
             IA  P DV  TR   +        L    +  R EGF   +KG
Sbjct: 227 VCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKG 271

 Score = 34.3 bits (77), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 103/289 (35%), Gaps = 40/289 (13%)

Query: 32  TAPLDTLKIRLQLQ---LANEAQ-YGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87
           T P++T+K RLQLQ   +A  ++ Y G       + R EG+R L +G   A A  IL   
Sbjct: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88

Query: 88  TQFTSYAILNKLLSKSQLPAQIHTGMVG--------ALSGTCSAIASYPCDVLRTRFIAN 139
           ++   Y  L   L    L  +   G           A +G   A    P  +++TR  A 
Sbjct: 89  SRLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQLVKTRMQAL 148

Query: 140 HSRELSTMLSTAQE----IWRHEGFRGFFKGXXXXXXXXXXXXXXXXXXYESVK-IFCEQ 194
             R +  +          +++  G RG ++G                  Y   K      
Sbjct: 149 APRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRH 208

Query: 195 RPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYK 254
            PD  +     L + AS ++ +     + P D    R        + H  H    Y+   
Sbjct: 209 VPDGMA-----LYTLASALSSVAVCIAMNPFDVAMTR--------MYH--HRGGLYR--- 250

Query: 255 SYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWCL 303
                  L      V +EG  ALY G+   + +  P T++ L + E  L
Sbjct: 251 -----GPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 19  VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76
           +A  LS ++  I   P D    R+         Y G L    + VRQEG  AL+KG++
Sbjct: 218 LASALSSVAVCIAMNPFDVAMTRMYHH--RGGLYRGPLDCLCKTVRQEGFSALYKGHL 273

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 72/195 (36%), Gaps = 46/195 (23%)

Query: 15  FQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANE------------------------- 49
           F++ V G  +   A I   PLD  K  +Q QL +E                         
Sbjct: 3   FENAVIGATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNRIKPIA 62

Query: 50  -------AQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL-- 100
                   QY G L   +R+   EGV  L++G   +     +   + F  Y ++ K    
Sbjct: 63  LRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFR 122

Query: 101 --------SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTR-FIANHSRELSTMLSTA 151
                   ++   P ++  G+V A     S +   P +V+ TR      +   + M + A
Sbjct: 123 LKQARGGDARFSTPEELVLGIVAA---ATSQLFVNPINVVATRQQTRGQAAGAADMRTVA 179

Query: 152 QEIWRHEGFRGFFKG 166
           +E+    G+RGF+ G
Sbjct: 180 REVHAENGWRGFWAG 194

 Score = 31.6 bits (70), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 38/87 (43%), Gaps = 3/87 (3%)

Query: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGN 75
           Q+ V G LS I + ++T PL   K  LQ   +    +  +L     L   EG  +LWKG 
Sbjct: 240 QNFVMGVLSKIVSTVLTQPLIIAKASLQRSGSCFQDFHQVL---HHLYSTEGPLSLWKGL 296

Query: 76  VPAMAMYILYGSTQFTSYAILNKLLSK 102
            P +   +L     F     L K+L K
Sbjct: 297 GPQITKGVLVQGLLFMFKGELTKMLRK 323

>Scas_671.1*
          Length = 123

 Score = 32.0 bits (71), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/101 (19%), Positives = 44/101 (43%), Gaps = 19/101 (18%)

Query: 200 SSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTST 259
           +S   ++ S +++ +  ++  I  P DT++ R Q+                   K    T
Sbjct: 35  TSTSTVVNSVSAIASASLATAITAPFDTIKTRMQL-------------------KPKVFT 75

Query: 260 NFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300
           NF    ++I + E +  L+ G ++ + +   S  ++ G+YE
Sbjct: 76  NFFTTLVLITKNESIFQLFSGLSMRLTRKALSAGIAWGIYE 116

 Score = 32.0 bits (71), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 7/74 (9%)

Query: 5  HLRKGQEVPVFQSLVAGCLSGIS----ARIVTAPLDTLKIRLQLQLANEAQYGGILVTFK 60
          H ++  +     S V   +S I+    A  +TAP DT+K R+QL+      +     T  
Sbjct: 26 HYKEDMKFSTSTSTVVNSVSAIASASLATAITAPFDTIKTRMQLK---PKVFTNFFTTLV 82

Query: 61 RLVRQEGVRALWKG 74
           + + E +  L+ G
Sbjct: 83 LITKNESIFQLFSG 96

>CAGL0K06545g complement(641129..642667) similar to tr|Q03327
           Saccharomyces cerevisiae YDR470c, hypothetical start
          Length = 512

 Score = 32.0 bits (71), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 14/87 (16%)

Query: 62  LVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQ-----IH-----T 111
           ++ +EG++ LWK N       IL  + +     +++ LL    +P       IH     +
Sbjct: 243 ILDEEGIKGLWKANNTNFIYQILSSTLEAWYTGLISPLL---HIPDPYFIDLIHFPDTQS 299

Query: 112 GMVGALS-GTCSAIASYPCDVLRTRFI 137
            ++  LS G  +A+   P D++RTRFI
Sbjct: 300 AVLLTLSVGVLTALTLIPIDLIRTRFI 326

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 31.6 bits (70), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 69/193 (35%), Gaps = 31/193 (16%)

Query: 112 GMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGXXXXX 171
            + G+L G  S   +YP   + T  +     E    L T +EI+   G  G+F G     
Sbjct: 15  AIAGSLGGAASIAVTYPLVTITTN-LQTKENEARPKLETIKEIYNKNGIIGYFLGLESAV 73

Query: 172 XXXXXXXXXXXXXYESVKIFCEQRPDRDSSVIQLLES----SASVIAGIVSKTIVFPIDT 227
                        YE    +C  +  R  +  Q L +     AS IAG ++     PI  
Sbjct: 74  YGMATTNFVYYYFYE----WCA-KTARTLTTKQYLSTWESILASTIAGSMTAVASNPIWV 128

Query: 228 VRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAK 287
              R  V                   KS  ST  LR  + IV+ +G L L +G    +  
Sbjct: 129 ANTRMTVA------------------KSNHST--LRTVIDIVKTDGPLTLLNGLKPALV- 167

Query: 288 SVPSTVVSLGVYE 300
            V + ++   VYE
Sbjct: 168 LVSNPIIQYTVYE 180

>Kwal_26.7264
          Length = 819

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 54/118 (45%), Gaps = 12/118 (10%)

Query: 53  GGILVTFKRLVRQEGVRALWKG----NVPAMAMYILYGS---TQFTSYAILN-----KLL 100
            G L +F+ LV+    R+  +      +PA+  YI   +      +SYA  +      LL
Sbjct: 405 SGFLSSFEELVKFNLSRSFRRSVELEELPALNDYISQKTLKHDDISSYAFSSIIEDLTLL 464

Query: 101 SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHE 158
            ++ L   ++TG    L G  S +A +  +    + + N+ R+L   L++A  + ++E
Sbjct: 465 VRTCLVLNVNTGEASLLEGFLSMLAKFLQNEFLVKLLQNNLRQLQPRLTSAVVLKKYE 522

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQYGGILVTFKRLVRQEGVRAL 71
           +F  L AG L+G +  IV+AP+D +  R  +   L++  +Y  + +  +  +R+ G+   
Sbjct: 160 MFDFLRAGFLAGAAQAIVSAPIDAIYTRANIDELLSSAKKYDNLWLYSRDKIREIGLIGC 219

Query: 72  WKG 74
           + G
Sbjct: 220 FGG 222

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 5   HLRKGQEVPVFQSLVAGCLSG-ISARIVTAPLDTLKIRLQLQLANEAQYGGILV--TFKR 61
           H R  +++   + +VA  L G +SA     P++ +++ +Q +  +  +   + V  TF+ 
Sbjct: 203 HKRSDEKLSAMEKIVASALGGGLSA--WNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRY 260

Query: 62  LVRQEGVRALWKGNVPAMAMYI 83
           +    G+R L++G  P + + +
Sbjct: 261 IYENNGLRGLYRGVTPRIGLGV 282

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 74/165 (44%), Gaps = 18/165 (10%)

Query: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGI----LVTFKRLVRQEGVRALWK 73
           ++ G   G++   +T    T    +++     A  GG+       FK + ++EG+R + K
Sbjct: 114 ILGGVTGGVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINK 173

Query: 74  G-NVPAMAMYILYGSTQFTSYAI---LNKLLSKSQLPAQIHT-GMVG--ALSGTCSAIAS 126
           G N  A+     +GS    S  +   + K+  K+    +++    +G  AL G  SA  +
Sbjct: 174 GVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIGASALGGGLSAW-N 232

Query: 127 YPCDVLRTRFIA-----NHSRELSTMLSTAQEIWRHEGFRGFFKG 166
            P +V+R    +     N  + L T+  T + I++  G +G ++G
Sbjct: 233 QPIEVIRVEMQSKKEDPNRPKNL-TVGKTFKYIYQSNGLKGLYRG 276

>KLLA0D08734g complement(742009..742932) weakly similar to
           sgd|S0002696 Saccharomyces cerevisiae YDR288w
           hypothetical protein, start by similarity
          Length = 307

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 21/30 (70%)

Query: 186 ESVKIFCEQRPDRDSSVIQLLESSASVIAG 215
           ES+   C++  D D S ++L+E++ +V+AG
Sbjct: 270 ESLTKMCQEMLDLDDSQLELIENTVNVLAG 299

>ACL027C [1022] [Homologous to ScYIL071C (PCI8) - SH]
           (316464..317726) [1263 bp, 420 aa]
          Length = 420

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 4/57 (7%)

Query: 246 TNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302
           T K +      T ++   L L+++E     AL H Y+  I+    STV  +G  EWC
Sbjct: 56  TRKDHNVADPDTISSEYGLQLLVLEN----ALAHNYSKAISLLESSTVGDVGYIEWC 108

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,061,267
Number of extensions: 277198
Number of successful extensions: 2037
Number of sequences better than 10.0: 210
Number of HSP's gapped: 1238
Number of HSP's successfully gapped: 541
Length of query: 303
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 202
Effective length of database: 13,099,691
Effective search space: 2646137582
Effective search space used: 2646137582
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)