Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.350050349625170.0
KLLA0D10021g50349617100.0
AFL201W49749711611e-155
Kwal_23.350750250111471e-153
CAGL0F07777g50449911391e-152
KLLA0D09999g50149810921e-145
YMR170C (ALD2)50649810861e-144
YMR169C (ALD3)50649810801e-143
Scas_669.950348910651e-141
Kwal_26.675252249410241e-134
Kwal_23.591153849410181e-133
ACL044W51349410131e-133
ADR417W50749510101e-132
YOR374W (ALD4)51949510091e-132
KLLA0F00440g52249410031e-131
KLLA0C07777g5144939961e-130
Sklu_2427.25184959941e-130
CAGL0D06688g5244949871e-129
CAGL0J03212g5174949841e-128
Sklu_2369.55144939821e-128
Scas_663.45204959781e-127
Scas_701.145154939671e-126
Sklu_2315.35014949631e-125
YER073W (ALD5)5204949591e-124
KLLA0E23144g5074949351e-121
Kwal_27.119765264949191e-118
Scas_664.244994939101e-117
CAGL0H05137g4974978761e-112
YPL061W (ALD6)5004968581e-110
YBR006W (UGA2)4974316324e-76
KLLA0F12628g5044336282e-75
Scas_716.634944316168e-74
Sklu_2087.35064356099e-73
KLLA0E17545g4974276053e-72
CAGL0C04191g4914796027e-72
AER007W4954316011e-71
Kwal_56.231064954325984e-71
Kwal_23.56996414524323e-46
CAGL0F08965g6394524271e-45
KLLA0C10615g6404474164e-44
AAL075W6374474086e-43
YHR039C (MSC7)6444503937e-41
Scas_690.266514573902e-40
KLLA0B12540g5213493439e-35
CAGL0D03982g5744592911e-27
KLLA0C10549g5764532911e-27
AAL071C5734532902e-27
Kwal_26.75955243532784e-26
YHR037W (PUT2)5754392769e-26
CAGL0K03509g5273272695e-25
Kwal_23.57145764582706e-25
Scas_717.745223242652e-24
Scas_690.415814392475e-22
YMR110C5324372361e-20
YOL157C589113740.58
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3500
         (496 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3500                                                          974   0.0  
KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida ...   663   0.0  
AFL201W [2994] [Homologous to ScYMR170C (ALD2) - SH; ScYMR169C (...   451   e-155
Kwal_23.3507                                                          446   e-153
CAGL0F07777g complement(758205..759719) similar to sp|P47771 Sac...   443   e-152
KLLA0D09999g complement(844368..845873) highly similar to sp|P47...   425   e-145
YMR170C (ALD2) [4125] chr13 complement(601561..603081) Aldehyde ...   422   e-144
YMR169C (ALD3) [4124] chr13 complement(599351..600871) Cytoplasm...   420   e-143
Scas_669.9                                                            414   e-141
Kwal_26.6752                                                          399   e-134
Kwal_23.5911                                                          396   e-133
ACL044W [1005] [Homologous to ScYER073W (ALD5) - SH] complement(...   394   e-133
ADR417W [2157] [Homologous to ScYOR374W (ALD4) - SH] complement(...   393   e-132
YOR374W (ALD4) [5149] chr15 (1039836..1041395) Mitochondrial ald...   393   e-132
KLLA0F00440g 31019..32587 highly similar to sp|P46367 Saccharomy...   390   e-131
KLLA0C07777g complement(682962..684506) highly similar to sp|P40...   388   e-130
Sklu_2427.2 YOR374W, Contig c2427 1739-3295                           387   e-130
CAGL0D06688g 639883..641457 highly similar to sp|P46367 Saccharo...   384   e-129
CAGL0J03212g 307754..309307 highly similar to sp|P40047 Saccharo...   383   e-128
Sklu_2369.5 YER073W, Contig c2369 5264-6808                           382   e-128
Scas_663.4                                                            381   e-127
Scas_701.14                                                           377   e-126
Sklu_2315.3 YPL061W, Contig c2315 5950-7455                           375   e-125
YER073W (ALD5) [1504] chr5 (304027..305589) Mitochondrial aldehy...   374   e-124
KLLA0E23144g complement(2052418..2053941) highly similar to sp|P...   364   e-121
Kwal_27.11976                                                         358   e-118
Scas_664.24                                                           355   e-117
CAGL0H05137g complement(495715..497208) highly similar to sp|P54...   342   e-112
YPL061W (ALD6) [5380] chr16 (432583..434085) Cytosolic acetaldeh...   335   e-110
YBR006W (UGA2) [199] chr2 (246974..248467) Succinate semialdehyd...   248   4e-76
KLLA0F12628g complement(1170396..1171910) similar to sp|P38067 S...   246   2e-75
Scas_716.63                                                           241   8e-74
Sklu_2087.3 , Contig c2087 4336-5856                                  239   9e-73
KLLA0E17545g 1553982..1555475 highly similar to sp|P38067 Saccha...   237   3e-72
CAGL0C04191g complement(409544..411019) highly similar to sp|P38...   236   7e-72
AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH] complement(...   236   1e-71
Kwal_56.23106                                                         234   4e-71
Kwal_23.5699                                                          171   3e-46
CAGL0F08965g complement(880296..882215) highly similar to sp|P38...   169   1e-45
KLLA0C10615g complement(912077..913999) similar to sp|P38694 Sac...   164   4e-44
AAL075W [112] [Homologous to ScYHR039C (MSC7) - SH] complement(2...   161   6e-43
YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein wi...   155   7e-41
Scas_690.26                                                           154   2e-40
KLLA0B12540g 1094239..1095804 similar to sp|Q04458 Saccharomyces...   136   9e-35
CAGL0D03982g 397039..398763 highly similar to sp|P07275 Saccharo...   116   1e-27
KLLA0C10549g 903888..905618 gi|31043861|emb|CAD91310.1 Kluyverom...   116   1e-27
AAL071C [116] [Homologous to ScYHR037W (PUT2) - SH] (223170..224...   116   2e-27
Kwal_26.7595                                                          111   4e-26
YHR037W (PUT2) [2324] chr8 (181969..183696) Delta-1-pyrroline-5-...   110   9e-26
CAGL0K03509g complement(326043..327626) similar to sp|Q04458 Sac...   108   5e-25
Kwal_23.5714                                                          108   6e-25
Scas_717.74                                                           106   2e-24
Scas_690.41                                                           100   5e-22
YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protei...    96   1e-20
YOL157C (YOL157C) [4668] chr15 complement(22524..24293) Protein ...    33   0.58 

>Kwal_23.3500
          Length = 503

 Score =  974 bits (2517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/496 (95%), Positives = 472/496 (95%)

Query: 1   MSTVQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXX 60
           MSTVQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGE                
Sbjct: 1   MSTVQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEVIAAVQAADASVDVDL 60

Query: 61  XXXXXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEA 120
                   FPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEA
Sbjct: 61  AVSAARAAFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEA 120

Query: 121 LAGILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWTAVAT 180
           LAGILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWTAVAT
Sbjct: 121 LAGILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWTAVAT 180

Query: 181 GNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTG 240
           GNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTG
Sbjct: 181 GNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTG 240

Query: 241 STSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300
           STSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS
Sbjct: 241 STSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300

Query: 301 RCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGA 360
           RCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGA
Sbjct: 301 RCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGA 360

Query: 361 RLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEA 420
           RLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEA
Sbjct: 361 RLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEA 420

Query: 421 LRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRE 480
           LRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRE
Sbjct: 421 LRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRE 480

Query: 481 LGEYGLANFTNVKAVY 496
           LGEYGLANFTNVKAVY
Sbjct: 481 LGEYGLANFTNVKAVY 496

>KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida
           albicans aldehyde dehydrogenase, mitochondrial (by
           homology), start by similarity
          Length = 503

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/496 (62%), Positives = 384/496 (77%)

Query: 1   MSTVQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXX 60
           MS   ++L  G  Y QPLGLFINNEYV++H SE + S++ ++GE                
Sbjct: 1   MSFTSIKLADGTEYQQPLGLFINNEYVEAHGSETLTSYNPSSGEEICKVQCADPKIDVDL 60

Query: 61  XXXXXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEA 120
                   FPGW+ TP  EKRDL  KLA L+E + ++L+ +ESLD+GKP+ +NA +D+  
Sbjct: 61  AVKAARDAFPGWKATPAIEKRDLFYKLAGLLERDIDILSKIESLDTGKPIANNAKYDILE 120

Query: 121 LAGILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWTAVAT 180
           +  +LKYYAGW+DKA GQS+APS+++L YTLHQPLGVVGCIIPFNYPL MM+WKWTA+AT
Sbjct: 121 VVEVLKYYAGWIDKAGGQSFAPSSEKLAYTLHQPLGVVGCIIPFNYPLAMMSWKWTAIAT 180

Query: 181 GNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTG 240
           GNTTVFKSA+QTPLSILYFA+LV  AGFP GVFNVLSG GA+VG A+ +HTG+DKIAFTG
Sbjct: 181 GNTTVFKSADQTPLSILYFAKLVKEAGFPAGVFNVLSGTGASVGSAIVKHTGVDKIAFTG 240

Query: 241 STSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300
           ST+VGQ IQ+ +AVNLK +TLECGGKS  ++F D D EQAV+W+A GIF NMGQICSGTS
Sbjct: 241 STAVGQIIQQQSAVNLKPITLECGGKSANMIFEDCDLEQAVKWSAWGIFNNMGQICSGTS 300

Query: 301 RCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGA 360
           R +V++SIY++FV  LA HV  TY+VG PS     VGPQVS+ QQERV  YI+ G+EEG 
Sbjct: 301 RVFVQESIYEEFVAQLADHVKKTYIVGAPSDDAVIVGPQVSKKQQERVLEYIKIGIEEGC 360

Query: 361 RLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEA 420
           ++ LGG G PE IAND    NG+YV+PTILADVK S+ +A+EEIFGPVI V  F DY EA
Sbjct: 361 KVPLGGLGAPEPIANDPALANGYYVKPTILADVKASYRIAKEEIFGPVIVVGSFKDYKEA 420

Query: 421 LRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRE 480
           L +ANDS+YGLGSAIF+ D+   HKFA +VE+G+ +INSSN++D   PFGG+KMSG+GRE
Sbjct: 421 LDIANDSDYGLGSAIFSKDIVTCHKFAQDVEAGMVWINSSNDVDINVPFGGVKMSGHGRE 480

Query: 481 LGEYGLANFTNVKAVY 496
           LGEYGLANFTNVK+V+
Sbjct: 481 LGEYGLANFTNVKSVH 496

>AFL201W [2994] [Homologous to ScYMR170C (ALD2) - SH; ScYMR169C
           (ALD3) - SH] complement(58424..59917) [1494 bp, 497 aa]
          Length = 497

 Score =  451 bits (1161), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 238/497 (47%), Positives = 314/497 (63%), Gaps = 15/497 (3%)

Query: 5   QVQLP-LGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           ++ +P  G +Y QPLGLFI+NE+V      ++++ + A GE                   
Sbjct: 7   EINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYAAGAADVDAAVAA 66

Query: 64  XXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123
                   WR T   E+  LL +LA LV+EE+E+LA +E+LDSGKP  +NA+ D++ +A 
Sbjct: 67  ARRAYEERWRHTSAQERGALLARLAELVDEEREVLAGIETLDSGKPYHTNALADLDQVAY 126

Query: 124 ILKYYAGWVDKA-QGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATG 181
           + +YYAG  DK  QG ++A S  +  YTL  P GVV  I+P+NYPL M +WK    +A G
Sbjct: 127 VTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCLAAG 186

Query: 182 NTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGS 241
           N  V K +E T LS+LYFA LV RAGFPPGVFNVL G G  VG  +A H G+DKIAFTGS
Sbjct: 187 NCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAFTGS 246

Query: 242 TSVGQQIQRTAAV-NLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300
           T+VGQ++   AA+ NLK +TLECGGKSPA++FADAD + AV + AAGIFYN GQ C+  S
Sbjct: 247 TAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCTANS 306

Query: 301 RCYVEDSIYDKFVDALAAHVADTYVVGPPSQST-TRVGPQVSRTQQERVQNYIRKGVEEG 359
           R YV++++YD F+D   AHV  TY  G    S    +GP +S+TQ +RV  YI  G+ E 
Sbjct: 307 RIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKDCNMGPVISKTQYDRVMGYINHGINEK 366

Query: 360 ARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDE 419
                 G  +PE          G+Y+ PTI  DV QS  + REEIFGPV  V+KF DYDE
Sbjct: 367 LAYEQFGS-VPE---------KGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDE 416

Query: 420 ALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGR 479
           A+R AND+ YGL S +FT ++  AH+F  +V+SG  ++NSSN+ +   PFGG KMSG GR
Sbjct: 417 AIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGR 476

Query: 480 ELGEYGLANFTNVKAVY 496
           ELG+ GL  +   KAV+
Sbjct: 477 ELGKAGLQTYLQTKAVH 493

>Kwal_23.3507
          Length = 502

 Score =  446 bits (1147), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 233/501 (46%), Positives = 317/501 (63%), Gaps = 15/501 (2%)

Query: 3   TVQVQLP-LGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXX 61
           + ++ +P L  +Y QPLGL+INNE+V S     IES + ATG+                 
Sbjct: 4   STEIHIPQLDLTYQQPLGLYINNEFVASSDGGSIESVNPATGKPVASFQAATDADVDRAV 63

Query: 62  XXXXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEAL 121
                     WR T   ++  LL KLA LVE+E+E+LAA+E+LDSGKP  +NA  D++ +
Sbjct: 64  AAARKAYQSHWRHTSAEQRSALLAKLAELVEQERELLAAIETLDSGKPFHTNAKGDLDQI 123

Query: 122 AGILKYYAGWVDK-AQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVA 179
             + KYYAG  DK  +GQ       +  YT+  P GVV  ++P+NYPL M +WK    +A
Sbjct: 124 VQLTKYYAGGADKFNKGQHIPVGPDKYAYTVQAPYGVVAQVVPWNYPLAMASWKMQGCLA 183

Query: 180 TGNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFT 239
            GNT V K AE T LS+LYFAQL  RAGFP GV NV+ G GA  G  +A H  +DKIAFT
Sbjct: 184 AGNTVVIKPAENTSLSLLYFAQLFERAGFPAGVVNVVPGHGAVAGSRLAAHMDVDKIAFT 243

Query: 240 GSTSVGQQIQRTAAV-NLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSG 298
           GST+VGQ++   AA  NLKA+TLECGGKSPA++FADAD +QAV WTAAGI+YN GQ C+ 
Sbjct: 244 GSTAVGQKVMGLAAASNLKAVTLECGGKSPAVIFADADLDQAVEWTAAGIYYNSGQNCTA 303

Query: 299 TSRCYVEDSIYDKFVDALAAHVADTYVVGP---PSQSTTRVGPQVSRTQQERVQNYIRKG 355
            SR YV++S+YD+FV    A+V  T+  G    P      VGP VS+ Q +R++ YI  G
Sbjct: 304 NSRLYVQESVYDEFVAKFCAYVEKTWKFGAKHDPFDPECTVGPVVSQVQYDRIRGYIEHG 363

Query: 356 VEEGARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFS 415
            +   +L +   G+ +          GF++ PT+  DV Q   ++REEIFGPV  ++KF 
Sbjct: 364 -KSSEQLGIRQIGVADVAP-------GFFIPPTLFTDVPQDSKLSREEIFGPVAVIAKFK 415

Query: 416 DYDEALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMS 475
           DYD+AL  AND+ YGL +A+FT D+ +A+ FA ++++G  +INSSN+ + + PFGG KMS
Sbjct: 416 DYDDALARANDTNYGLAAAVFTEDVRKANHFARDIDAGTVWINSSNDEEVSVPFGGFKMS 475

Query: 476 GYGRELGEYGLANFTNVKAVY 496
           G GRELG+ G+  +T +KAV+
Sbjct: 476 GIGRELGQSGMDVYTQIKAVH 496

>CAGL0F07777g complement(758205..759719) similar to sp|P47771
           Saccharomyces cerevisiae YMR170c ALD5 or sp|P54114
           Saccharomyces cerevisiae YMR169c ALD4, start by
           similarity
          Length = 504

 Score =  443 bits (1139), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 228/499 (45%), Positives = 308/499 (61%), Gaps = 15/499 (3%)

Query: 5   QVQLP-LGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           ++ +P +G SY QP+G+FI+NE+V S + EKIE+ + AT E                   
Sbjct: 7   EINIPQIGRSYKQPIGIFIDNEFVPSSNGEKIETINPATEEVITSFYAATEDDVDKAVKS 66

Query: 64  XXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123
                   W      EKRD+LLKLA L+EEEK +LAA+E+LD+GKP  +NA+ D++ +  
Sbjct: 67  ARESYENVWFKISPAEKRDMLLKLADLIEEEKPLLAALETLDAGKPYHTNAMDDIDQIIH 126

Query: 124 ILKYYAGWVDK-AQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATG 181
           + KY+AG  DK  QG++     ++L YTL  P GV G IIP+NYPL M +WK    +A G
Sbjct: 127 LTKYFAGATDKFTQGKTIPIDHEKLVYTLKSPYGVCGMIIPWNYPLAMASWKMQGCLAAG 186

Query: 182 NTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGS 241
           NT V K AE T LS+LY AQL  +AGFP GV NV+ G+G+ VG+++  H  +DKI+FTGS
Sbjct: 187 NTLVIKPAENTSLSLLYLAQLFKKAGFPKGVVNVVPGKGSVVGNSLGLHMDVDKISFTGS 246

Query: 242 TSVGQQIQRTAA-VNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300
           T VG  I   A   N+K +TLECGGKSPA+VF DAD + A+ + A GIFYN GQ C+  S
Sbjct: 247 TKVGSSILELAGKSNMKDVTLECGGKSPAVVFQDADIDNAIEYIANGIFYNSGQNCTANS 306

Query: 301 RCYVEDSIYDKFVDALAAHVADTYVVGP---PSQSTTRVGPQVSRTQQERVQNYIRKGVE 357
           R YV++ IYD F+     H  + +  G    P      VGP VS  Q E V +YIR G E
Sbjct: 307 RVYVQEDIYDDFIKRFTEHTKENWKFGSKCDPFDKDCTVGPVVSEKQFETVNDYIRHGKE 366

Query: 358 EGARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDY 417
           E        E L      ++    G+++ PTI  DV Q   + +EEIFGPV+ V+KF DY
Sbjct: 367 E--------ENLQIHQTVEKCDCKGYFISPTIFTDVPQGSKLMKEEIFGPVVVVAKFKDY 418

Query: 418 DEALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGY 477
            EA++LAND+ YGL S +FT +++ A+ FA +++SG  +INSSNE DP  PFGG K SG 
Sbjct: 419 KEAIKLANDTNYGLASMVFTKNISVANWFARDIKSGTVWINSSNEEDPTVPFGGFKQSGI 478

Query: 478 GRELGEYGLANFTNVKAVY 496
           GRELGE G+ ++  +K V+
Sbjct: 479 GRELGETGVESYMQIKTVH 497

>KLLA0D09999g complement(844368..845873) highly similar to sp|P47771
           Saccharomyces cerevisiae YMR170c ALD5 aldehyde
           dehydrogenase 2 (NAD+), start by similarity
          Length = 501

 Score =  425 bits (1092), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 225/498 (45%), Positives = 304/498 (61%), Gaps = 16/498 (3%)

Query: 6   VQLP-LGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXXX 64
           V +P L  +Y QPLGLFINNE+V S   +KIES + +T E                    
Sbjct: 7   VNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAA 66

Query: 65  XXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGI 124
                  W  T   ++  LL KL  L+E +K +LAA+E+LDSGKP  SN++ D+E +  +
Sbjct: 67  RDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQL 126

Query: 125 LKYYAGWVDKAQGQSYAPSTQ-RLTYTLHQPLGVVGCIIPFNYPLGMMAWK-WTAVATGN 182
            +YYAG  DK  G  Y P  Q +  YT+  P GVV  I+P+NYPL M +WK  + +A GN
Sbjct: 127 TRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGN 186

Query: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242
           T V K AE T LS+LYFAQLV  AGFPPGV N+L G G+  G AMA HT IDKIAFTGST
Sbjct: 187 TIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGST 246

Query: 243 SVGQQIQRTAA-VNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301
           +VGQ++   AA  NLKA+TLECGGKSP L+FADA+ ++A+ W A GIFYN GQ C+  SR
Sbjct: 247 AVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSR 306

Query: 302 CYVEDSIYDKFVDALAAHVADTYVVGP---PSQSTTRVGPQVSRTQQERVQNYIRKGVEE 358
            YV + IY++F+     +    +  G    P      +GP +S+ Q +R+Q+Y+  G   
Sbjct: 307 IYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHG--- 363

Query: 359 GARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYD 418
            A   LG +   E          G+++ PTI +DV  S  +++EEIFGPV  V+ FS Y+
Sbjct: 364 KASEKLGFKEFAE------YPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYE 417

Query: 419 EALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYG 478
           EA++LANDS YGL S +F+ +     +FA ++ +G  +INSSN+ + + PFGG KMSG G
Sbjct: 418 EAIKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIG 477

Query: 479 RELGEYGLANFTNVKAVY 496
           RELG  G+ ++   KAV+
Sbjct: 478 RELGRNGVDSYLQTKAVH 495

>YMR170C (ALD2) [4125] chr13 complement(601561..603081) Aldehyde
           dehydrogenase (NAD(P)+), likely cytosolic [1521 bp, 506
           aa]
          Length = 506

 Score =  422 bits (1086), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 224/498 (44%), Positives = 303/498 (60%), Gaps = 13/498 (2%)

Query: 6   VQLP-LGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXXX 64
           +++P L  S  QPLGLFINNE+  S   + IE+ + ATGE                    
Sbjct: 8   IEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDVDKAVKAA 67

Query: 65  XXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGI 124
                  W  T + ++   L  L  L+EEE++ LAA+E+LD+GKP  SNA  D+  +  +
Sbjct: 68  RAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGDLAQILQL 127

Query: 125 LKYYAGWVDKAQGQSYAPST-QRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATGN 182
            +Y+AG  DK    +  P T  +  YTL  P GVV  I+P+NYPL M  WK   A+A GN
Sbjct: 128 TRYFAGSADKFDKGATIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACWKLQGALAAGN 187

Query: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242
           T + K AE T LS+LYFA L+ +AGFPPGV N++ G G+ VG A+A H  IDKI+FTGST
Sbjct: 188 TVIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDKISFTGST 247

Query: 243 SVGQQI-QRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301
            VG  + + +   NLK +TLECGGKSPALVF DAD ++A+ W AAGIFYN GQ C+  SR
Sbjct: 248 KVGGFVLEASGQSNLKDVTLECGGKSPALVFEDADLDKAIDWIAAGIFYNSGQNCTANSR 307

Query: 302 CYVEDSIYDKFVDALAAHVADTYVVG---PPSQSTTRVGPQVSRTQQERVQNYIRKGVEE 358
            YV+ SIYDKFV+         + V     P      VGP +S TQ +R+++YI +G  E
Sbjct: 308 VYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKRE 367

Query: 359 GARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYD 418
               +      P   A       G+++ PTI  DV Q+  + ++EIFGPV+ VSKF++YD
Sbjct: 368 EKLDMFQTSEFPIGGAK------GYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNYD 421

Query: 419 EALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYG 478
           +AL+LAND+ YGL SA+FT D+ +AH FA ++++G  +INSSN+ D   PFGG KMSG G
Sbjct: 422 DALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINSSNDEDVTVPFGGFKMSGIG 481

Query: 479 RELGEYGLANFTNVKAVY 496
           RELG+ G+  +   KAV+
Sbjct: 482 RELGQSGVDTYLQTKAVH 499

>YMR169C (ALD3) [4124] chr13 complement(599351..600871) Cytoplasmic,
           stress inducible aldehyde dehydrogenase, probable
           isoform of Ald2p [1521 bp, 506 aa]
          Length = 506

 Score =  420 bits (1080), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 219/498 (43%), Positives = 304/498 (61%), Gaps = 13/498 (2%)

Query: 6   VQLP-LGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXXX 64
           +++P L  S  QPLGLFINNE+  S   + IE+ + ATGE                    
Sbjct: 8   IEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDVDKAVKAA 67

Query: 65  XXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGI 124
                  W  T + ++   L  L  L+EEE++ LAA+E+LD+GKP  SNA  D+  +  +
Sbjct: 68  RAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIEL 127

Query: 125 LKYYAGWVDK-AQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATGN 182
            +YYAG VDK   G++   +  +  YTL  P GVV  I+P+NYPL M   K   A+A GN
Sbjct: 128 TRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGN 187

Query: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242
           T + K AE T LS+LYFA L+ +AGFPPGV NV+ G G+ VG A+  H  IDKI+FTGST
Sbjct: 188 TVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGST 247

Query: 243 SVGQQI-QRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301
            VG  + + +   NLK +TLECGGKSPALVF DAD ++A+ W A GIF+N GQIC+  SR
Sbjct: 248 KVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSR 307

Query: 302 CYVEDSIYDKFVDALAAHVADTYVVG---PPSQSTTRVGPQVSRTQQERVQNYIRKGVEE 358
            YV+ SIYDKFV+         + V     P      VGP +S TQ +R+++YI +G +E
Sbjct: 308 VYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKE 367

Query: 359 GARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYD 418
               +      P   A       G+++ PTI  DV ++  + R+EIFGPV+ VSKF++YD
Sbjct: 368 EKLDMFQTSEFPIGGAK------GYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYD 421

Query: 419 EALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYG 478
           +AL+LAND+ YGL SA+FT D+ +AH FA ++++G  +IN +N+ +   PFGG KMSG G
Sbjct: 422 DALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIG 481

Query: 479 RELGEYGLANFTNVKAVY 496
           RE G+ G+ N+  +K+V+
Sbjct: 482 RESGDTGVDNYLQIKSVH 499

>Scas_669.9
          Length = 503

 Score =  414 bits (1065), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 212/489 (43%), Positives = 298/489 (60%), Gaps = 13/489 (2%)

Query: 13  SYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXXXXXXXFPGW 72
           S  QP+GLFI+NE+V S    +I++F+ AT E                           W
Sbjct: 13  SIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTW 72

Query: 73  RDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYYAGWV 132
             T   ++ DLLLKLASLVE +KE+LA++E+ DSGKP  +NA+ D++ +  + KY+AG  
Sbjct: 73  SKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGST 132

Query: 133 DK-AQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATGNTTVFKSAE 190
           DK   G++     + L YTL  P GVV  I+P+NYPL M +WK  + +A GNT V K +E
Sbjct: 133 DKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSE 192

Query: 191 QTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQI-Q 249
            + LS+LYFAQL+V AGFPPGV N++ G G  VGDA++ H  +DKI+FTGST VG  + +
Sbjct: 193 NSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLE 252

Query: 250 RTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRCYVEDSIY 309
           ++   NLK +TLECGGKSPA++F DA+ E+AV+WT+ GIF+N GQ C+  SR  V+  I+
Sbjct: 253 QSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIF 312

Query: 310 DKFVDALAAHVADTYVVGP---PSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARLVLGG 366
           D+FV     +    +  G    P      VGP +S+ Q E++Q Y+     EG  + +  
Sbjct: 313 DEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMT--CPEGCPVEVS- 369

Query: 367 EGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALRLAND 426
                 I       NG+++ PTI  +V Q     +EEIFGP + +S+F DYDEAL LAND
Sbjct: 370 ----HIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLAND 425

Query: 427 SEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELGEYGL 486
           + YGL +A+FT ++  AH+FA ++ +G  ++N+SN  D   PFGG KMSG GRELG  G+
Sbjct: 426 TSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGV 485

Query: 487 ANFTNVKAV 495
            +F   K V
Sbjct: 486 ESFMQTKTV 494

>Kwal_26.6752
          Length = 522

 Score =  399 bits (1024), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 214/494 (43%), Positives = 294/494 (59%), Gaps = 13/494 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V V++P G  Y QP GLFINN++V +   +  E    AT E                   
Sbjct: 31  VPVKMPNGIEYEQPTGLFINNKFVRAKQGKTFEVISPATEEEITHVYEAREDDVEDAIAA 90

Query: 64  XXXXXFPG-WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALA 122
                  G W       +   L KLA L+E++ E +A++E+LD+GK + S A  DV+ +A
Sbjct: 91  ADQAFKSGVWSQVDPLVRAKALNKLAELIEDDLETIASIETLDNGKAITS-ARGDVQLVA 149

Query: 123 GILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATG 181
             L+  AGW DK  G+     +   +YT+ QPLGV G IIP+N+PL M AWK   A+ATG
Sbjct: 150 NYLRSCAGWCDKVDGRLINTGSTHFSYTVRQPLGVCGQIIPWNFPLLMWAWKVGPALATG 209

Query: 182 NTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGS 241
           NT V K+AE TPLS LY +Q + +AG PPGV N++SG G  +G+A+  H  I KIAFTGS
Sbjct: 210 NTVVLKTAESTPLSALYVSQFISKAGIPPGVVNIISGFGKIIGEALTTHPKIKKIAFTGS 269

Query: 242 TSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301
           T+ G+ I + A  NLK +TLE GGKSP +VF DAD +QAV+    GI+YN G++C   SR
Sbjct: 270 TATGRHIYQNAGSNLKKVTLELGGKSPNMVFGDADLKQAVQNIILGIYYNSGEVCCAGSR 329

Query: 302 CYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGAR 361
            YVE+S+YD+F++   A  A+   VG P    T  G Q S+ Q  ++  Y+  G EEGA 
Sbjct: 330 VYVEESVYDQFLEEFKA-AAENVKVGDPFDDATFQGAQTSQMQLSKILKYVEIGKEEGAT 388

Query: 362 LVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL 421
           LV GG    E I N      GF+++PTI  +V++   + +EEIFGPV+ VSKF   DE +
Sbjct: 389 LVTGG----ERIGN-----KGFFIKPTIFGNVEEDMRIVKEEIFGPVVTVSKFKTIDELI 439

Query: 422 RLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGREL 481
             ANDSEYGL + + TSD+N+A + ++ V +G  ++N+ N+     PFGG   SG GRE+
Sbjct: 440 EKANDSEYGLAAGVHTSDINKALEVSNRVNAGTVWVNTFNDFHHCVPFGGFNASGIGREM 499

Query: 482 GEYGLANFTNVKAV 495
           G   L ++T VKAV
Sbjct: 500 GSEALDSYTQVKAV 513

>Kwal_23.5911
          Length = 538

 Score =  396 bits (1018), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 212/494 (42%), Positives = 295/494 (59%), Gaps = 14/494 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V + LP G +Y QP GLFIN E+V S   +  E  + +T +                   
Sbjct: 48  VPITLPSGVTYDQPTGLFINGEFVPSRQHKTFEVLNPSTEQEIAHVYEAREDDVDVAIAA 107

Query: 64  XXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123
                   W       +   L KLA LV++  E+LA +ESLD+GK L  +   DV+ +A 
Sbjct: 108 AKRAFEDKWSTADPEFRSRCLYKLADLVDQHAEILAGIESLDNGKSLLCSRT-DVDLVAK 166

Query: 124 ILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATGN 182
            L+  AGW DK  G++    +   +YTL +PLGV   IIP+N+PL M +WK   A+ATGN
Sbjct: 167 YLRSCAGWADKIFGRTIDTGSGHFSYTLREPLGVCAQIIPWNFPLLMWSWKLGPALATGN 226

Query: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242
           T V K AE TPLS LY +QLV  AG P GV N+L G G  +G+ +  H  + KIAFTGST
Sbjct: 227 TVVLKPAEATPLSALYASQLVQEAGIPAGVVNILPGFGKLLGERLCTHKDVKKIAFTGST 286

Query: 243 SVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRC 302
           + G+ I RTAA  +K +TLE GGKSP +VFADAD E+AVR  A GIF+N G++C   SR 
Sbjct: 287 ATGRHIMRTAAGTIKKVTLELGGKSPNIVFADADLEKAVRNIAFGIFFNSGEVCCAGSRV 346

Query: 303 YVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARL 362
           YV+D++Y++ ++   A+  +T  VG P Q     G Q S+ Q +++ +Y++ G  EGAR+
Sbjct: 347 YVQDTVYEEVLEKFKAY-TETLKVGDPFQEGVFQGSQTSQMQIDKILDYVQVGTAEGARV 405

Query: 363 VLGGEGLPETIANDERHRN-GFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL 421
           + GG          ERH + G++V+PTI ADV +   + +EEIFGP++ +SKFS  DE +
Sbjct: 406 ITGG----------ERHGDKGYFVKPTIFADVTEDMRIVKEEIFGPIVTISKFSTVDEVI 455

Query: 422 RLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGREL 481
            +ANDSEYGL + I T D+N+A   ++ V++G  +IN+ N    + PFGG   SG GRE+
Sbjct: 456 EMANDSEYGLAAGIHTKDVNKAIDVSNRVKAGTVWINTYNNFHQSVPFGGFGQSGIGREM 515

Query: 482 GEYGLANFTNVKAV 495
           G   L N+T VKAV
Sbjct: 516 GAEALDNYTQVKAV 529

>ACL044W [1005] [Homologous to ScYER073W (ALD5) - SH]
           complement(286308..287849) [1542 bp, 513 aa]
          Length = 513

 Score =  394 bits (1013), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 210/494 (42%), Positives = 291/494 (58%), Gaps = 13/494 (2%)

Query: 3   TVQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXX 62
           TVQV+LP G SY QP GLFI+ ++V SH ++  E  D  T E                  
Sbjct: 23  TVQVRLPNGNSYEQPTGLFIDGKFVPSHQAKTFEVIDPGTEEEITHVYEAREEDVDAAVA 82

Query: 63  XXXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALA 122
                  P  R  P   +   L KLA L+E+ +E LA +ESLD+GK L  +   DV  +A
Sbjct: 83  AAKRAFLPWSRADPEV-RAQCLFKLADLIEKHQETLANIESLDNGKSLLCSR-GDVALVA 140

Query: 123 GILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATG 181
             L+   GW DK  G          +YT  +PLGV G IIP+N+PL M +WK   A+ATG
Sbjct: 141 RYLRTCGGWADKIYGNVMETGPDHFSYTRREPLGVCGQIIPWNFPLLMWSWKIGPALATG 200

Query: 182 NTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGS 241
           NT V K AE TPLS LY   L   AG P GV N++ G G  VG+ +  H  + K+AFTGS
Sbjct: 201 NTVVLKPAESTPLSALYVCNLANEAGIPKGVMNIVPGFGKIVGEHLCTHPDVKKVAFTGS 260

Query: 242 TSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301
           T+ G+ I RT A  +K +TLE GGKSP +VFADAD ++AV+    GIFYN G++C   SR
Sbjct: 261 TATGRHIMRTCAETVKKVTLELGGKSPNIVFADADIDKAVKNIGFGIFYNAGEVCCAGSR 320

Query: 302 CYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGAR 361
            YV+DS+YD+ ++      ++   VG P +     G Q S+ Q +++ +Y+  GV+EGAR
Sbjct: 321 VYVQDSVYDEVLEKF-KQFSENLKVGNPFEEGVFQGAQTSQMQVDKILSYVDIGVKEGAR 379

Query: 362 LVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL 421
           +V GGE L          R GF+++PTI ADV ++  V ++EIFGPV+ VSKFS  DE +
Sbjct: 380 IVAGGERL---------GRKGFFIKPTIFADVNENMRVVKDEIFGPVVTVSKFSTVDEVI 430

Query: 422 RLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGREL 481
            +AN+S+YGL + I T+D+N+A   ++++++G  ++N+ N+  P  PFGG   SG G E+
Sbjct: 431 AMANNSQYGLAAGIHTTDINKAIDVSNQIKAGTVWVNTYNDFHPNVPFGGFGQSGIGSEM 490

Query: 482 GEYGLANFTNVKAV 495
           G   L N+T  KAV
Sbjct: 491 GVQALDNYTQTKAV 504

>ADR417W [2157] [Homologous to ScYOR374W (ALD4) - SH]
           complement(1457469..1458992) [1524 bp, 507 aa]
          Length = 507

 Score =  393 bits (1010), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 212/495 (42%), Positives = 304/495 (61%), Gaps = 13/495 (2%)

Query: 3   TVQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXX 62
           +V ++LP G  Y QP GLFINNE+V S     +E    AT E                  
Sbjct: 19  SVTIKLPNGVEYEQPTGLFINNEFVRSKLGGMMEVIAPATEEVVTRVYEGTSEDVDIAVS 78

Query: 63  XXXXXXFPG-WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEAL 121
                   G W       +   L KLA L+EE+ E++A++E LD+GK   S+A  D+  +
Sbjct: 79  AAQKAFKSGKWFGADPMVRVKALSKLADLIEEDLEVIASIEFLDNGKVF-SHARFDIGMV 137

Query: 122 AGILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVAT 180
              L+  AG  DK  G+S    +  LTYT  +P+GV G IIP+N+PL M AWK   A+AT
Sbjct: 138 VNYLRCCAGLADKVDGRSIDTGSSHLTYTRREPIGVCGQIIPWNFPLLMWAWKVGPALAT 197

Query: 181 GNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTG 240
           GNT V K+AE TPLS LY +  V +AG P GV N++SG G TVG+A+ RH G+ KIAFTG
Sbjct: 198 GNTVVLKTAEFTPLSALYVSNHVRKAGIPAGVVNIISGYGKTVGEAIIRHPGVKKIAFTG 257

Query: 241 STSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300
           ST+ G+ I   AA +LK ++LE GGKSP ++FADAD ++A +     IF+N G++C   S
Sbjct: 258 STATGRHIYEVAAKDLKKVSLELGGKSPNIIFADADLKKAAQNVLNSIFFNGGEVCCAGS 317

Query: 301 RCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGA 360
           R Y+E+ IY++F+  + A VA++  VG PS   T  G Q S+ Q +++ +YI  G +EGA
Sbjct: 318 RMYIEEPIYEEFLQEIKA-VAESVKVGDPSWKDTFQGAQTSQMQLDKILSYIEIGKQEGA 376

Query: 361 RLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEA 420
           R+V GGE L E          G+YV+PTI ADV++   + +EEIFGPV+ V+KF++ D+ 
Sbjct: 377 RVVTGGERLGE---------KGYYVKPTIFADVREDMRIVKEEIFGPVVTVTKFTNIDDL 427

Query: 421 LRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRE 480
           L +AND++YGL + +++S + +A   A+ +++G  +IN+ N+   + PFGG K SG+GRE
Sbjct: 428 LEMANDTQYGLAAGVYSSSMKKAIDVANRLDAGTVWINTYNDFHCSVPFGGYKGSGFGRE 487

Query: 481 LGEYGLANFTNVKAV 495
           +G   + N+T VKAV
Sbjct: 488 MGAEVVENYTQVKAV 502

>YOR374W (ALD4) [5149] chr15 (1039836..1041395) Mitochondrial
           aldehyde dehydrogenase [1560 bp, 519 aa]
          Length = 519

 Score =  393 bits (1009), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 209/495 (42%), Positives = 296/495 (59%), Gaps = 13/495 (2%)

Query: 3   TVQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXX 62
           TV ++LP G  Y QP GLFINN++V S  ++  E  + +T E                  
Sbjct: 30  TVPIKLPNGLEYEQPTGLFINNKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQ 89

Query: 63  XXXXXXFPG-WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEAL 121
                   G W      ++   L +LA L+E++K+++A++E+LD+GK + S+   DV+ +
Sbjct: 90  AADRAFSNGSWNGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSR-GDVDLV 148

Query: 122 AGILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVAT 180
              LK  AG+ DK  G+         +YT  QPLGV G IIP+N+PL M AWK   A+ T
Sbjct: 149 INYLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAWKIAPALVT 208

Query: 181 GNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTG 240
           GNT V K+AE TPLS LY ++ + +AG PPGV N++SG G  VG+A+  H  I K+AFTG
Sbjct: 209 GNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKIVGEAITNHPKIKKVAFTG 268

Query: 241 STSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300
           ST+ G+ I ++AA  LK +TLE GGKSP +VFADA+ ++AV+    GI+YN G++C   S
Sbjct: 269 STATGRHIYQSAAAGLKKVTLELGGKSPNIVFADAELKKAVQNIILGIYYNSGEVCCAGS 328

Query: 301 RCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGA 360
           R YVE+SIYDKF++   A  +++  VG P   +T  G Q S+ Q  ++  Y+  G  EGA
Sbjct: 329 RVYVEESIYDKFIEEFKA-ASESIKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGA 387

Query: 361 RLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEA 420
            L+ GGE L            G++++PT+  DVK+   + +EEIFGPV+ V+KF   DE 
Sbjct: 388 TLITGGERL---------GSKGYFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEV 438

Query: 421 LRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRE 480
           + +ANDSEYGL + I TS++N A K A  V +G  +IN+ N+   A PFGG   SG GRE
Sbjct: 439 INMANDSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGRE 498

Query: 481 LGEYGLANFTNVKAV 495
           +    L N+  VKAV
Sbjct: 499 MSVDALQNYLQVKAV 513

>KLLA0F00440g 31019..32587 highly similar to sp|P46367 Saccharomyces
           cerevisiae YOR374w ALD4 aldehyde dehydrogenase,
           mitochondrial, start by similarity
          Length = 522

 Score =  390 bits (1003), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 210/494 (42%), Positives = 296/494 (59%), Gaps = 13/494 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V+V LP G SY QP GLFINN++V S   +  E    +T E                   
Sbjct: 35  VKVDLPNGISYEQPTGLFINNQFVPSKQGKTFEVLSPSTEEEITHVYEGREEDVDAAVEA 94

Query: 64  XXXXXFPG-WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALA 122
                  G W       +   L KLA  +E++ + +A++ESLD+GK + S+A  DV+ + 
Sbjct: 95  ADKAFKSGVWSKVDPLVRSQCLSKLADYIEKDLDTIASIESLDNGKAI-SSAKGDVQLVV 153

Query: 123 GILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATG 181
             L+  AG+ DK  G+     +   +YT+ +PLGV G IIP+N+PL M AWK   A+ATG
Sbjct: 154 NYLRSAAGYADKVDGRVIDTGSTHFSYTVREPLGVCGQIIPWNFPLLMWAWKIAPALATG 213

Query: 182 NTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGS 241
           NT V K+AE TPLS LY +Q + +AG P GV N++SG G  VG+A+  H  I K+AFTGS
Sbjct: 214 NTVVLKTAESTPLSALYVSQYIPKAGIPDGVVNIVSGFGKIVGEAITTHPKIKKVAFTGS 273

Query: 242 TSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301
           T+ G+ I + A VNLK +TLE GGKSP +VFADA+ + AV+ +  GI+YN G++C   SR
Sbjct: 274 TATGRHIYQNAGVNLKKVTLELGGKSPNVVFADANLKSAVQNSLLGIYYNSGEVCCAGSR 333

Query: 302 CYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGAR 361
            YVE+SIYD F+  + +  ++   VG P  + T  G Q S+ Q +++  Y+  G  EGA 
Sbjct: 334 LYVEESIYDDFLKEIKS-ASEALKVGDPFDAETFQGAQTSQNQLDKILKYVEIGKNEGAT 392

Query: 362 LVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL 421
           L+ GGE + +          G++VRPTI ADV++S  + +EEIFGPV+ V+KF   DE +
Sbjct: 393 LITGGERIGD---------KGYFVRPTIFADVEESMRIVKEEIFGPVVTVTKFKTIDELI 443

Query: 422 RLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGREL 481
             ANDSEYGL + I TS++N A + ++ + +G  +IN+ N+     PFGG   SG GRE+
Sbjct: 444 EKANDSEYGLAAGIHTSNINTAIQVSNRLNAGTVWINTYNDFHHCVPFGGFNASGIGREM 503

Query: 482 GEYGLANFTNVKAV 495
           G   L N+T VKAV
Sbjct: 504 GSEALDNYTQVKAV 517

>KLLA0C07777g complement(682962..684506) highly similar to sp|P40047
           Saccharomyces cerevisiae YER073w ALD5 aldehyde
           dehydrogenase (NAD+), mitochondrial, start by similarity
          Length = 514

 Score =  388 bits (996), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 209/493 (42%), Positives = 289/493 (58%), Gaps = 12/493 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V VQLP G +Y QP GLFIN E+V S   +  E  + +  E                   
Sbjct: 24  VPVQLPNGITYEQPTGLFINGEFVPSRQHKTFEVLNPSNEEEITHIYEAREDDVDIAVAA 83

Query: 64  XXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123
                  GW      ++   LLKLA L+++  E LA++ESLD+GK L  +   DV  +A 
Sbjct: 84  AKKAFNNGWSTAEPEDRAKCLLKLADLIDQHAETLASIESLDNGKSLFCSR-GDVALVAK 142

Query: 124 ILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATGN 182
            L+  AGW DK  G+         +YT  +PLGV G IIP+N+PL M +WK   A+ATGN
Sbjct: 143 YLRSCAGWADKIYGKVIDTGADHFSYTKREPLGVCGQIIPWNFPLLMWSWKVGPALATGN 202

Query: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242
           T V K AE TPLS LY  QLV  AG P GV N++ G G  VG+ +  H  I K+AFTGST
Sbjct: 203 TVVLKPAEATPLSALYACQLVQEAGVPKGVVNIIPGFGKIVGERICTHPDIKKVAFTGST 262

Query: 243 SVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRC 302
           + G+ I +T A ++K +TLE GGKSP +VF DAD ++AV+  A GIFYN G++C   SR 
Sbjct: 263 ATGRHIMKTCADSIKKVTLELGGKSPNIVFGDADLDKAVKNIAFGIFYNSGEVCCAGSRI 322

Query: 303 YVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARL 362
           YV+D++Y++ ++    + A++  VG P +     G Q S+ Q +++ +Y+  G  EGAR+
Sbjct: 323 YVQDTVYEEVLEKFKQY-AESLKVGNPFEENVFQGAQTSQMQIDKILSYVDVGTSEGARV 381

Query: 363 VLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALR 422
           + GG    E I N      G++++PTI ADVK+   + +EEIFGPV+ VSKF+  DE + 
Sbjct: 382 ITGG----ERIGN-----KGYFIKPTIFADVKEDMQIVKEEIFGPVVTVSKFTTVDEVVA 432

Query: 423 LANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELG 482
            ANDSEYGL + I T D+N+A   ++ V++G  +IN+ N      PFGG   SG GRE+G
Sbjct: 433 KANDSEYGLAAGIHTKDVNKAIDVSNRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMG 492

Query: 483 EYGLANFTNVKAV 495
              L N+T  KAV
Sbjct: 493 AEALDNYTQTKAV 505

>Sklu_2427.2 YOR374W, Contig c2427 1739-3295
          Length = 518

 Score =  387 bits (994), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 205/495 (41%), Positives = 299/495 (60%), Gaps = 13/495 (2%)

Query: 3   TVQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXX 62
           ++ ++LP G  Y QP GLFINN++V S   +  E    +T E                  
Sbjct: 30  SIPIKLPNGIEYEQPTGLFINNKFVPSKQGKTFEVISPSTEEEICHIYEGREEDVDLAVE 89

Query: 63  XXXXXXFPG-WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEAL 121
                   G W       + + L KLA L+E++KE +A++ESLD+GK + S A  D+  +
Sbjct: 90  AADKAFKNGSWSTVDPLVRANALNKLADLIEKDKETIASIESLDNGKAITS-ARGDISLV 148

Query: 122 AGILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVAT 180
              L+  AG+ DK  G+     +   +YT  +PL V G IIP+N+PL M AWK   A+AT
Sbjct: 149 VNYLRSSAGYADKIDGRLINTGSTHFSYTRREPLCVCGQIIPWNFPLLMWAWKIAPALAT 208

Query: 181 GNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTG 240
           GNT V K+AE TPLS LY +Q + +AG PPGV N++SG G  VG+A+  H  I K+AFTG
Sbjct: 209 GNTVVLKTAESTPLSALYVSQYIPKAGIPPGVVNIVSGFGKIVGEAITTHPKIKKVAFTG 268

Query: 241 STSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300
           ST+ G+ I + A VNLK +TLE GGKSP ++FADA+ ++AV+    GI++N G++C   S
Sbjct: 269 STATGRHIYQNAGVNLKKVTLELGGKSPNIIFADANLKEAVKNVILGIYFNSGEVCCAGS 328

Query: 301 RCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGA 360
           R YVE+SIYDK V+ + A  ++   VG P   +T  G Q S+ Q +++  Y+  G +EGA
Sbjct: 329 RVYVEESIYDKAVEEIKA-ASEAVKVGDPFDESTFQGAQTSQNQLDKILKYVEIGRKEGA 387

Query: 361 RLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEA 420
            LV GGE L +          G++++PTI +DV+++  + +EEIFGPV+ ++KF D ++ 
Sbjct: 388 TLVTGGERLGD---------KGYFIKPTIFSDVEENMRIVKEEIFGPVVTITKFKDVEDL 438

Query: 421 LRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRE 480
           +  ANDSEYGL + I TS++N A   ++ + +G  +IN+ N+   + PFGG   SG GRE
Sbjct: 439 VEKANDSEYGLAAGIHTSNINNAINVSNRLNAGTVWINTFNDFHHSVPFGGFNASGIGRE 498

Query: 481 LGEYGLANFTNVKAV 495
           +G   L N+T VKAV
Sbjct: 499 MGSEALDNYTQVKAV 513

>CAGL0D06688g 639883..641457 highly similar to sp|P46367
           Saccharomyces cerevisiae YOR374w ALD4 or sp|P40047
           Saccharomyces cerevisiae YER073w ALD5, hypothetical
           start
          Length = 524

 Score =  384 bits (987), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 206/494 (41%), Positives = 291/494 (58%), Gaps = 13/494 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V ++LP G  Y QP GLFINN++V S   +  E  + +T E                   
Sbjct: 37  VPIKLPNGLEYEQPTGLFINNQFVPSKQHKTFEVINPSTEEEICHIYEGREDDVESAVQA 96

Query: 64  XXXXXFPG-WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALA 122
                  G W D    E+   L KLA L+E++KE++A++ESLD+GK + S A  DV+ + 
Sbjct: 97  ADTAFKNGSWTDIDPFERGQALYKLAELIEKDKEIVASIESLDNGKAINS-ARGDVQLVI 155

Query: 123 GILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATG 181
             LK  AG  DK  G+     +    Y   +PLGV G IIP+N+PL M AWK   A+ TG
Sbjct: 156 NYLKSSAGVADKIDGRLVNTGSNYFNYVKKEPLGVCGQIIPWNFPLLMWAWKIAPALVTG 215

Query: 182 NTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGS 241
           NT V K+AE TPLS LY ++ + +AG PPGV N++SG G  VG+A+  H  I KIAFTGS
Sbjct: 216 NTVVLKTAESTPLSALYVSKYIPKAGIPPGVINIVSGFGKIVGEALTTHPKIKKIAFTGS 275

Query: 242 TSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301
           T+ G+ I  +AA  LK +TLE GGKSP +VFADAD ++AV+    GI+YN G++C   SR
Sbjct: 276 TATGKHIYSSAAQTLKKVTLELGGKSPNIVFADADLKKAVQNIILGIYYNSGEVCCAGSR 335

Query: 302 CYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGAR 361
            YVE+SIYD+F        ++   VG P   +T  G Q S+ Q +++ +Y+  G +EGA 
Sbjct: 336 VYVEESIYDEFAQEFKT-ASEALKVGNPFDESTFQGAQTSQMQLDKILSYVEIGKKEGAT 394

Query: 362 LVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL 421
           L+ GGE + E          G++++PTI  DV +   + +EEIFGPV+ V+KF D D  +
Sbjct: 395 LITGGERIGE---------KGYFIKPTIFGDVTEDMRIVKEEIFGPVVTVTKFKDLDHVV 445

Query: 422 RLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGREL 481
           ++ANDSEYGL + I T+++N A K A  +++G  ++N+ N+     PFGG   SG GRE+
Sbjct: 446 QMANDSEYGLAAGIHTTNINSAVKVADRLKAGTVWVNTYNDFHQNIPFGGFNASGLGREM 505

Query: 482 GEYGLANFTNVKAV 495
            +  L  +   KAV
Sbjct: 506 SKEALDGYLQAKAV 519

>CAGL0J03212g 307754..309307 highly similar to sp|P40047
           Saccharomyces cerevisiae YER073w ALD5 or sp|P46367
           Saccharomyces cerevisiae YOR374w ALD4, start by
           similarity
          Length = 517

 Score =  383 bits (984), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 209/494 (42%), Positives = 289/494 (58%), Gaps = 14/494 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V V LP G  Y QP GLFIN E+V SH  +  +  + +T E                   
Sbjct: 27  VPVTLPNGIKYMQPTGLFINGEFVKSHEGKTFDVLNPSTEETIATLYEAQAADVDIAVKA 86

Query: 64  XXXXXFPGW-RDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALA 122
                   W R+ P    R  L  LA LVE   E LA ++SLD+GK L  +   DV  +A
Sbjct: 87  AKEAFENHWSREDPEVRAR-ALFNLADLVEANLETLAGIDSLDNGKSLLCSR-ADVALVA 144

Query: 123 GILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATG 181
             L+   GW DK  G          TY++ +PLGV G IIP+N+PL M +WK   A+ATG
Sbjct: 145 KYLRSCGGWADKIYGDVIDTGKSHFTYSVKEPLGVCGQIIPWNFPLLMWSWKIGPALATG 204

Query: 182 NTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGS 241
           NT V K AE TPLS L+ ++L   AG P GV N++ G G TVG+ +  H  I K+AFTGS
Sbjct: 205 NTVVLKPAELTPLSALFASKLCQEAGIPAGVVNIIPGPGKTVGERICTHPDIKKVAFTGS 264

Query: 242 TSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301
           T+ G +I +TAA ++K +TLE GGKSP +VFADAD EQAV   A GIF+N G++C   SR
Sbjct: 265 TATGSRIMKTAADSIKKVTLELGGKSPNIVFADADLEQAVENIAHGIFFNSGEVCCAGSR 324

Query: 302 CYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGAR 361
            YV+D  YD+ +D L  +  ++  VG P    T  G Q S+ Q +++  Y+  G +EGAR
Sbjct: 325 IYVQDKCYDEVLDRLKKY-TESLKVGNPFGDNTYQGSQTSQQQLDKILEYVDIGKQEGAR 383

Query: 362 LVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL 421
           +V GGE + E          G++ +PT+ ADVK++  + ++EIFGP++ VS+FS  DE +
Sbjct: 384 IVTGGERIGE---------KGYFFKPTVFADVKENMRIVKDEIFGPIVTVSQFSTVDEVI 434

Query: 422 RLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGREL 481
            +ANDS+YGL + I T+D+N+A + +S +++G  +IN+ N      PFGG   SG GRE+
Sbjct: 435 AMANDSQYGLAAGIHTNDVNKAVEVSSRLKAGTIWINTYNAFHQNVPFGGFGQSGIGREM 494

Query: 482 GEYGLANFTNVKAV 495
           G   L N+T VK+V
Sbjct: 495 GSAALDNYTQVKSV 508

>Sklu_2369.5 YER073W, Contig c2369 5264-6808
          Length = 514

 Score =  382 bits (982), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 202/493 (40%), Positives = 289/493 (58%), Gaps = 12/493 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V V LP G +Y QP GLFIN E+V S   +  E  + +  E                   
Sbjct: 24  VPVTLPNGITYEQPTGLFINGEFVPSRQHKTFEVINPSNEEEVTHVYEAREDDVDIAVAA 83

Query: 64  XXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123
                  GW       +   L KLA L+E+  E LA +ESLD+GK L  +   DV  ++ 
Sbjct: 84  AKKAFDNGWSTAEPEFRAQCLYKLADLIEKNAETLAGIESLDNGKSLFCSR-GDVALVSK 142

Query: 124 ILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATGN 182
            L+  AGW DK  G+     +    YT  +PLGV G IIP+N+PL M +WK   A+ATGN
Sbjct: 143 YLRSCAGWSDKLFGKVIDTGSDHFAYTKREPLGVCGQIIPWNFPLLMWSWKIGPALATGN 202

Query: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242
           T V K AE TPLS LY +QL   AG P GV N++ G G  VG+ +  H  + K+AFTGST
Sbjct: 203 TVVLKPAEATPLSALYASQLCQEAGIPKGVVNIIPGFGKIVGERLCTHPEVKKVAFTGST 262

Query: 243 SVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRC 302
           + G+ I +TAA ++K +TLE GGKSP +VF DAD ++AV+  A GIF+N G++C   SR 
Sbjct: 263 ATGRHIMKTAADSIKKVTLELGGKSPNIVFGDADLDKAVKNIAFGIFFNSGEVCCAGSRV 322

Query: 303 YVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARL 362
           YV+D++Y++ +     +  ++  VG P +     G Q S+ Q +++ +Y+  G +EGAR+
Sbjct: 323 YVQDTVYEEVLQKFKEY-TESLKVGNPFEDGVFQGAQTSKMQIDKILSYVDIGTKEGARI 381

Query: 363 VLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALR 422
           + GGE         ++   G++++PTI ADVK+   + +EEIFGP+++VSKFS  DE + 
Sbjct: 382 ITGGE---------KKGEKGYFIKPTIFADVKEDMRIVKEEIFGPIVSVSKFSSVDEVIA 432

Query: 423 LANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELG 482
           +ANDSEYGL + I T D+N+A   ++ +++G  +IN+ N    + PFGG   SG GRE+G
Sbjct: 433 MANDSEYGLAAGIHTKDVNKAIDVSNRIKAGTIWINTYNAFHQSVPFGGFGQSGIGREMG 492

Query: 483 EYGLANFTNVKAV 495
              L N+T VKAV
Sbjct: 493 AEALDNYTQVKAV 505

>Scas_663.4
          Length = 520

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 206/495 (41%), Positives = 292/495 (58%), Gaps = 13/495 (2%)

Query: 3   TVQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXX 62
           T+ ++LP G  + QP GLFINN+ V S   +  E  + +T +                  
Sbjct: 31  TIPIKLPNGLEFEQPTGLFINNKNVPSKQGKTFEVINPSTEDEICHIYEGREDDVDIAVK 90

Query: 63  XXXXXXFPG-WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEAL 121
                   G W       +   L KLA L+E++KE++A++ESLD+GK + S A  DVE +
Sbjct: 91  AASDAFNNGSWSTIDPIYRGQALYKLAELIEKDKEIIASIESLDNGKAINS-ARGDVELV 149

Query: 122 AGILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVAT 180
              LK  AG  +K  G+     +    YT  +PLGV G IIP+N+PL M AWK   A+ T
Sbjct: 150 VNYLKSSAGMANKLDGRLIDSGSNYFNYTKREPLGVCGQIIPWNFPLLMWAWKIAPALIT 209

Query: 181 GNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTG 240
           GNT V K+AE TPLS LY A+ +  AG PPGV N++SG G  VG+AM  H  I KIAFTG
Sbjct: 210 GNTVVLKTAESTPLSALYAAKYIPEAGIPPGVVNIVSGFGKIVGEAMTSHPLIKKIAFTG 269

Query: 241 STSVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300
           ST+ G+ I + AA +LK +TLE GGKSP ++FADA+ ++AV+    GI+YN G++C   S
Sbjct: 270 STATGKHIYQNAAASLKKVTLELGGKSPNIIFADANLKKAVQNVITGIYYNSGEVCCAGS 329

Query: 301 RCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGA 360
           R YV++SIYD+ ++ + A  ++   VG P   TT  G Q S+ Q  ++  Y+  G  EGA
Sbjct: 330 RVYVQESIYDELIEEIKA-ASEAVKVGDPFDETTFQGAQTSQMQLNKILKYVEIGKNEGA 388

Query: 361 RLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEA 420
           +L+ GGE +          + G++V+PTI   V++   + +EEIFGPV+ +SKF   DE 
Sbjct: 389 QLITGGERV---------GKKGYFVKPTIFGGVQEDMRIVKEEIFGPVVTISKFKTLDEV 439

Query: 421 LRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRE 480
           +++ANDSEYGL + I TS++N A K A  +++G  +IN+ N+     PFGG   SG GRE
Sbjct: 440 VQMANDSEYGLAAGIHTSNINTATKVADRLKAGTVWINTYNDFHCNVPFGGFNASGLGRE 499

Query: 481 LGEYGLANFTNVKAV 495
           +G   L N+   KAV
Sbjct: 500 MGTEALENYLQSKAV 514

>Scas_701.14
          Length = 515

 Score =  377 bits (967), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 201/493 (40%), Positives = 282/493 (57%), Gaps = 13/493 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V V LP G  Y QP GLFIN ++V S  ++  E  + +T E                   
Sbjct: 26  VPVTLPNGLKYEQPTGLFINGDFVPSKQNKIFEVINPST-EEVITPVYEAMEDDVDIAVA 84

Query: 64  XXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123
                F  W       +   L KLA+LVE+  E+LA++E+ D+GK L  +   DV  ++ 
Sbjct: 85  AAKKAFKSWSIADPEVRASALFKLANLVEKNAELLASIETADNGKSLLCSR-GDVALVSK 143

Query: 124 ILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATGN 182
            L+   GW DK  G           YT  +PLGV G IIP+N+PL M +WK   A+ATGN
Sbjct: 144 YLRSCGGWADKINGNVINTGDNHFAYTTREPLGVCGQIIPWNFPLLMWSWKIGPALATGN 203

Query: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242
           T V K AE TPLS L+ +QL + AG P GV N++ G G  VG+ + +H  + KIAFTGST
Sbjct: 204 TVVLKPAETTPLSALFASQLCIEAGIPKGVVNIIPGSGRVVGEKLCKHPDVKKIAFTGST 263

Query: 243 SVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRC 302
             G  I +TAA  +K +TLE GGKSP +VFADAD ++A+   A GIFYN G++C   SR 
Sbjct: 264 KTGSHIMKTAADTVKKVTLELGGKSPNIVFADADLDKAIENIAFGIFYNSGEVCCAGSRI 323

Query: 303 YVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARL 362
           YV+D++YD  ++    +  +   VG P   +T  G Q S+ Q  ++  Y++ G +EGAR+
Sbjct: 324 YVQDTVYDTVLNKFKKY-TENLKVGDPFDESTFQGAQTSKAQLTKILKYVKVGTDEGARV 382

Query: 363 VLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALR 422
           V GGE              G++V+PTI ADVK+   + +EE+FGP++ +SKFS  DE + 
Sbjct: 383 VTGGERF---------GNKGYFVKPTIFADVKEDMQIVKEEVFGPLVTISKFSTVDEVID 433

Query: 423 LANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELG 482
           +ANDS+YGL + I T D+N+A   +  +++G  +IN+ N      PFGG   SG GRE+G
Sbjct: 434 MANDSQYGLAAGIHTKDVNKAIHVSKRIQAGTVWINTYNAFHQNVPFGGFGQSGIGREMG 493

Query: 483 EYGLANFTNVKAV 495
              L N+T VK+V
Sbjct: 494 AAALDNYTQVKSV 506

>Sklu_2315.3 YPL061W, Contig c2315 5950-7455
          Length = 501

 Score =  375 bits (963), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 201/494 (40%), Positives = 290/494 (58%), Gaps = 12/494 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           +++ LP G SY QP GLFINNE++ S   + ++  + +T E                   
Sbjct: 13  LKITLPNGLSYEQPTGLFINNEFIKSQDQKTLKVENPSTEEIVAEVYSATKDDVEYAVEC 72

Query: 64  XXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123
                   W       +   L KLA+LVEE KE+++++E+LD+GK L   A  DV  +  
Sbjct: 73  ADKAFNSSWSTCDPRIRASYLFKLANLVEERKELISSIEALDNGKTLAL-ARGDVGLVVD 131

Query: 124 ILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATGN 182
            LK  AG+ DK  G++       + YTL +P+GV G IIP+N+PL M++WK   A+A GN
Sbjct: 132 YLKIAAGYADKLGGRTINTGEGYVNYTLREPVGVCGQIIPWNFPLMMLSWKIAPALAAGN 191

Query: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242
           T V K A  TPL+ LYFA L    G P GV N++ G G +VGD +  H  I KIAFTGST
Sbjct: 192 TVVLKPASPTPLNALYFASLCKEVGIPDGVVNIVPGPGRSVGDTITNHPKIRKIAFTGST 251

Query: 243 SVGQQIQ-RTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301
            +G+ +  + AA NLK +TLE GGKS  LVF D   E+ ++    GIF N GQICS  SR
Sbjct: 252 EIGRDVAIKAAASNLKKVTLELGGKSAHLVFDDCKLEKTLQNLVNGIFKNAGQICSSGSR 311

Query: 302 CYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGAR 361
            YV++ I+D+ + A   ++ +   VG P   +   G   +++Q + V NYI  G EEGA+
Sbjct: 312 IYVQEGIHDRLLAAFKEYLENNIKVGSPFDESNYQGAINNKSQFDTVINYINIGKEEGAK 371

Query: 362 LVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL 421
           L+ GGE + +          G+++RPT+  DVK+   + +EEIFGPV+ +SKF D ++ +
Sbjct: 372 LLTGGERVGD---------KGYFIRPTVFYDVKEDMRIVKEEIFGPVVTISKFKDIEDGV 422

Query: 422 RLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGREL 481
            +ANDSE+GLG+ I T +L+ A K +  +++G  ++N+ N+ D + PFGG K SGYGRE+
Sbjct: 423 AMANDSEFGLGAGIETENLSTALKVSKMLKAGTVWVNTYNDFDASVPFGGCKQSGYGREM 482

Query: 482 GEYGLANFTNVKAV 495
           GE     +T VKAV
Sbjct: 483 GEEVFEAYTQVKAV 496

>YER073W (ALD5) [1504] chr5 (304027..305589) Mitochondrial aldehyde
           dehydrogenase [1563 bp, 520 aa]
          Length = 520

 Score =  374 bits (959), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 201/494 (40%), Positives = 281/494 (56%), Gaps = 14/494 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V + LP G +Y QP GLFIN E+V S   +  +  + +  E                   
Sbjct: 30  VPITLPNGFTYEQPTGLFINGEFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDEAVAA 89

Query: 64  XXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123
                   W       +   L  LA LVE+ +E LAA+ES+D+GK L   A  DV  ++ 
Sbjct: 90  AKKAFETKWSIVEPEVRAKALFNLADLVEKHQETLAAIESMDNGKSLFC-ARGDVALVSK 148

Query: 124 ILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATGN 182
            L+   GW DK  G          TY++ +PLGV G IIP+N+PL M +WK   A+ATGN
Sbjct: 149 YLRSCGGWADKIYGNVIDTGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWKIGPALATGN 208

Query: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242
           T V K AE TPLS L+ +QL   AG P GV N+L G G  VG+ ++ H  + KIAFTGST
Sbjct: 209 TVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVGERLSAHPDVKKIAFTGST 268

Query: 243 SVGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRC 302
           + G+ I + AA  +K +TLE GGKSP +VFADAD ++AV+  A GIFYN G++C   SR 
Sbjct: 269 ATGRHIMKVAADTVKKVTLELGGKSPNIVFADADLDKAVKNIAFGIFYNSGEVCCAGSRI 328

Query: 303 YVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARL 362
           Y++D++Y++ +  L  +  ++  VG P       G Q S  Q  ++ +Y+     EGARL
Sbjct: 329 YIQDTVYEEVLQKLKDY-TESLKVGDPFDEEVFQGAQTSDKQLHKILDYVDVAKSEGARL 387

Query: 363 VLGGEGLPETIANDERH-RNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL 421
           V GG           RH   G++V+PT+ ADVK    + +EE+FGP++ VSKFS  DE +
Sbjct: 388 VTGG----------ARHGSKGYFVKPTVFADVKGDMRIVKEEVFGPIVTVSKFSTVDEVI 437

Query: 422 RLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGREL 481
            +ANDS+YGL + I T+D+N+A   +  V++G  +IN+ N      PFGG   SG GRE+
Sbjct: 438 AMANDSQYGLAAGIHTNDINKAVDVSKRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREM 497

Query: 482 GEYGLANFTNVKAV 495
           GE  L+N+T  K+V
Sbjct: 498 GEAALSNYTQTKSV 511

>KLLA0E23144g complement(2052418..2053941) highly similar to
           sp|P54115 Saccharomyces cerevisiae YPL061w ALD6 aldehyde
           dehydrogenase, cytosolic, start by similarity
          Length = 507

 Score =  364 bits (935), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 195/494 (39%), Positives = 284/494 (57%), Gaps = 12/494 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V + LP G +Y QP GLFINN+++ S   + ++  + +T E                   
Sbjct: 19  VSITLPNGLTYQQPTGLFINNQFIKSQDGKTLKVENPSTEEIIVEVQSATSQDVEYAVEA 78

Query: 64  XXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123
                   W      ++  LL KLA L+E +KE++A++ES D+GK L   A  DV  +  
Sbjct: 79  ADAAFNSEWSTMDPKKRGSLLFKLADLIEAQKELIASIESADNGKTLAL-ARGDVGLVID 137

Query: 124 ILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATGN 182
            ++  AG+ DK  G++         +T  +PLGV G IIP+N+PL M++WK   A+  GN
Sbjct: 138 YIRSAAGYADKLGGRTINTGDGYANFTYKEPLGVCGQIIPWNFPLMMLSWKIAPALVAGN 197

Query: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242
           T + K A  TPL+ L+FA L   AG P GV N++ G G +VGD +  H  I KIAFTGST
Sbjct: 198 TVILKPASPTPLNALFFASLCKEAGIPAGVVNIVPGPGRSVGDTITNHPKIRKIAFTGST 257

Query: 243 SVGQQIQ-RTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301
            +G+ +  + A  NLK +TLE GGKS  LVF DA+ ++ +     GIF N GQICS  SR
Sbjct: 258 DIGRDVAIKAAQSNLKKVTLELGGKSAHLVFEDANIKKTIPNLVNGIFKNAGQICSSGSR 317

Query: 302 CYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGAR 361
            YV+D+IYD+ +     ++     VG P   +       ++ Q E + NYI  G +EGA 
Sbjct: 318 IYVQDTIYDQLLSEFKTYLETEIKVGSPFDESNFQAAINNKAQFETILNYIDIGKKEGAS 377

Query: 362 LVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL 421
           ++ GGE +            G++++PT+  +VK+   + +EEIFGPV+ +SKFS  DEA+
Sbjct: 378 ILTGGERV---------GNKGYFIKPTVFYNVKEDMRIVKEEIFGPVVTISKFSTVDEAV 428

Query: 422 RLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGREL 481
            LANDSE+GLG+ I T +++ A K A  +++G  +IN+ N+ D A PFGG K SGYGRE+
Sbjct: 429 ALANDSEFGLGAGIETENISVALKVAKRLKAGTVWINTYNDFDAAVPFGGYKQSGYGREM 488

Query: 482 GEYGLANFTNVKAV 495
           GE    ++T +KAV
Sbjct: 489 GEEAFESYTQIKAV 502

>Kwal_27.11976
          Length = 526

 Score =  358 bits (919), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 193/494 (39%), Positives = 281/494 (56%), Gaps = 12/494 (2%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V+V  P G +Y QP GLFINNE+V SH+   I   D AT +                   
Sbjct: 38  VKVTTPNGLTYEQPTGLFINNEFVKSHNGATIAVEDPATEKKIVEVQSGTKEDVEYAVEC 97

Query: 64  XXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123
                   W       +   LLKLA L+E+ KE+++++E +D+GK L   A +DV  +  
Sbjct: 98  AEKAFNSSWSTGDPRVRARALLKLADLIEQRKELISSIECMDNGKALFL-AKNDVRIVID 156

Query: 124 ILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATGN 182
            ++  AG+ DK  G++       + YTL +P+GV G IIP+N+PL M++WK   A+A GN
Sbjct: 157 YIRSSAGFADKLDGRTINTGDGYVNYTLREPVGVCGQIIPWNFPLLMLSWKIAPALAAGN 216

Query: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242
           T + K A  TPL+ LYFA L   AG P GV N++ G G  VG+ +  H  I KIAFTGST
Sbjct: 217 TVILKPASPTPLNALYFASLCKEAGIPAGVVNIIPGPGRDVGETLTTHPKIRKIAFTGST 276

Query: 243 SVGQQIQ-RTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301
             G+ I  + A  NLK +TLE GGKS  +VF DA+ E+ +     GIF N GQICS  SR
Sbjct: 277 GTGKGIAVKAAQSNLKKVTLELGGKSAHMVFNDANLEKTIPNLVNGIFLNAGQICSSGSR 336

Query: 302 CYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGAR 361
            YV++ IYDK + A   +V +   VG P   +   G   ++ Q + + NY+  G EEGA+
Sbjct: 337 IYVQEGIYDKLLPAFKKYVEEVITVGSPFDESNFQGAINNKAQFDTIMNYVGIGKEEGAK 396

Query: 362 LVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL 421
           ++ GG+              G+++RPTI  DV +   + +EEIFGPV+ +SKF + ++ +
Sbjct: 397 VLTGGK---------RSGDQGYFIRPTIFYDVNEDMRIVKEEIFGPVVTISKFKEIEDGV 447

Query: 422 RLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGREL 481
            +AN+SE+GLG+ I T  ++ A K +  +++G  ++N+ N+ D + PFGG K SGYG E+
Sbjct: 448 AMANNSEFGLGAGIQTESVSTALKVSKMLKAGTVWVNTYNDFDSSVPFGGCKQSGYGSEM 507

Query: 482 GEYGLANFTNVKAV 495
           G     ++T  KAV
Sbjct: 508 GIEAFDSYTTTKAV 521

>Scas_664.24
          Length = 499

 Score =  355 bits (910), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/493 (40%), Positives = 283/493 (57%), Gaps = 14/493 (2%)

Query: 6   VQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXX-XXXXXXXXXXXXX 64
           + LP G +Y QP GLFINNE++ S   + I+  + AT E                     
Sbjct: 14  ITLPNGITYNQPTGLFINNEFMKSQDYKTIKVENPATAEIVCEVSSGTSEDVEYAVESAE 73

Query: 65  XXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGI 124
                  W       +   L KLA L+EE  E++A++E+LD+GK L  +   DV      
Sbjct: 74  HAFNDTDWATQDPKIRGRYLSKLADLMEENLELMASIETLDNGKTLALSR-GDVGLAINC 132

Query: 125 LKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATGNT 183
           ++  A + DK  G++       + +T+ +P+GV G IIP+N+PL M++WK   A+A GN 
Sbjct: 133 IRDAASYADKINGRTINSGDGYMNFTVKEPIGVCGQIIPWNFPLMMLSWKIAPALAMGNV 192

Query: 184 TVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGSTS 243
            + K A  TPL+ L+FA L  + G P GV N++ G G TVG+A+  H  I K AFTGST 
Sbjct: 193 IILKPASATPLNALFFASLCKKVGIPAGVVNIIPGPGRTVGNAITTHPRIRKAAFTGSTE 252

Query: 244 VGQQIQ-RTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRC 302
           +G+ I  + +  NLK +TLE GGKS  LVF DA+ E+ +     GIF N GQICS  SR 
Sbjct: 253 IGKDIAIKASGSNLKKITLELGGKSAHLVFDDANIEKTLPNLVNGIFKNAGQICSSGSRI 312

Query: 303 YVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARL 362
           YV++ IYDK + A   +V +   VG P   +   G   +R Q E +  YI+ G EEGA++
Sbjct: 313 YVQEGIYDKLMPAFKKYV-ENLKVGDPFDESNFQGAITNREQYETILKYIKIGKEEGAKI 371

Query: 363 VLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALR 422
           + GGE    TI N      G++++PTI  DVK+   + REEIFGPV+ VSKF D ++ + 
Sbjct: 372 LTGGE----TIGN-----KGYFIKPTIFYDVKEDMEIVREEIFGPVVTVSKFKDIEDGVA 422

Query: 423 LANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELG 482
           +AN SE+GLG+ I T +L+ A K A  ++SG  +IN+ N+ D   PFGG+K SGYGRE+G
Sbjct: 423 MANASEFGLGAGIETENLSTALKVAKMLKSGTVWINTYNDFDSRVPFGGVKQSGYGREMG 482

Query: 483 EYGLANFTNVKAV 495
           E     +T VKA+
Sbjct: 483 EEVYDCYTEVKAI 495

>CAGL0H05137g complement(495715..497208) highly similar to sp|P54115
           Saccharomyces cerevisiae YPL061w ALD6, hypothetical
           start
          Length = 497

 Score =  342 bits (876), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/497 (38%), Positives = 276/497 (55%), Gaps = 13/497 (2%)

Query: 2   STVQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGE-XXXXXXXXXXXXXXXX 60
           +T  ++LP G +Y QP GLFINNE+V+S   + +   + +T E                 
Sbjct: 7   ATKTIKLPNGLTYEQPTGLFINNEFVESSDGKTMTIENPSTQEPIVDVFSATKEDVDYAV 66

Query: 61  XXXXXXXXFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEA 120
                      W       +   L KLA L+EE+ E++A++E+LD+GK +  +   DV+ 
Sbjct: 67  DCAERAFEKSDWATQDPKVRARYLSKLADLMEEQLELIASIETLDNGKTIALSR-GDVQL 125

Query: 121 LAGILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVA 179
               ++  A + DK  G+S       + YT+ +P+GV   IIP+N+PL M++WK   A+A
Sbjct: 126 SINCIRDAASYADKVDGRSIDTGDGYMNYTIREPIGVCAQIIPWNFPLMMLSWKVGPALA 185

Query: 180 TGNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFT 239
            GN  V K A  TPL+ LYF+ L  + G P GV N++ G G  VG A+  H  + K+AFT
Sbjct: 186 MGNCIVLKPASATPLNALYFSSLCKQVGIPAGVVNIIPGPGGMVGTALTTHPKVRKVAFT 245

Query: 240 GSTSVGQQIQ-RTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSG 298
           GST +G+ I  + +A NLK +TLE GGKS  LVF DA+ E+ +     GIF N GQICS 
Sbjct: 246 GSTDIGKDIAVKASASNLKKITLELGGKSAHLVFNDANLEKTLPNLVNGIFKNAGQICSS 305

Query: 299 TSRCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEE 358
            SR Y +  IYD+ +    A++     VG P   +   G   ++ Q   +  YI  G EE
Sbjct: 306 GSRIYAQAGIYDRLLKEFKAYIEKNIKVGNPFDESNFQGAITNKEQYNTILKYINIGKEE 365

Query: 359 GARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYD 418
           GA+++ GGE   E          G++++PT+  DVK+   V +EEIFGP + +SKF + +
Sbjct: 366 GAKVLTGGETAAE---------KGYFIKPTVFYDVKEDMRVVKEEIFGPCVTISKFEEIE 416

Query: 419 EALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYG 478
           + + +ANDSE+GLG+ I T +L+ A K A  + SG  +IN+ N+ D   PFGG K SGYG
Sbjct: 417 DGVAMANDSEFGLGAGIETENLSTALKVAKMLHSGTVWINTYNDFDSRVPFGGYKQSGYG 476

Query: 479 RELGEYGLANFTNVKAV 495
           RE+G      +T  KAV
Sbjct: 477 REMGSEVYECYTQTKAV 493

>YPL061W (ALD6) [5380] chr16 (432583..434085) Cytosolic acetaldehyde
           dehydrogenase [1503 bp, 500 aa]
          Length = 500

 Score =  335 bits (858), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/496 (38%), Positives = 277/496 (55%), Gaps = 15/496 (3%)

Query: 4   VQVQLPLGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXX 63
           V++ LP G +Y QP GLFINN+++ +   +     D +T E                   
Sbjct: 12  VKITLPNGLTYEQPTGLFINNKFMKAQDGKTYPVEDPST-ENTVCEVSSATTEDVEYAIE 70

Query: 64  XXXXXFPG--WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEAL 121
                F    W      E+  LL KLA  +E + ++++++E+LD+GK L   A  DV   
Sbjct: 71  CADRAFHDTEWATQDPRERGRLLSKLADELESQIDLVSSIEALDNGKTLAL-ARGDVTIA 129

Query: 122 AGILKYYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVAT 180
              L+  A + DK  G++       + +T  +P+GV G IIP+N+P+ M+AWK   A+A 
Sbjct: 130 INCLRDAAAYADKVNGRTINTGDGYMNFTTLEPIGVCGQIIPWNFPIMMLAWKIAPALAM 189

Query: 181 GNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTG 240
           GN  + K A  TPL+ LYFA L  + G P GV N++ G G TVG A+     I K+AFTG
Sbjct: 190 GNVCILKPAAVTPLNALYFASLCKKVGIPAGVVNIVPGPGRTVGAALTNDPRIRKLAFTG 249

Query: 241 STSVGQQIQ-RTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGT 299
           ST VG+ +   ++  NLK +TLE GGKS  LVF DA+ ++ +     GIF N GQICS  
Sbjct: 250 STEVGKSVAVDSSESNLKKITLELGGKSAHLVFDDANIKKTLPNLVNGIFKNAGQICSSG 309

Query: 300 SRCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEG 359
           SR YV++ IYD+ + A  A++     VG P       G   +R Q + + NYI  G +EG
Sbjct: 310 SRIYVQEGIYDELLAAFKAYLETEIKVGNPFDKANFQGAITNRQQFDTIMNYIDIGKKEG 369

Query: 360 ARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDE 419
           A+++ GGE + +          G+++RPT+  DV +   + +EEIFGPV+ V+KF   +E
Sbjct: 370 AKILTGGEKVGD---------KGYFIRPTVFYDVNEDMRIVKEEIFGPVVTVAKFKTLEE 420

Query: 420 ALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGR 479
            + +AN SE+GLGS I T  L+   K A  +++G  +IN+ N+ D   PFGG+K SGYGR
Sbjct: 421 GVEMANSSEFGLGSGIETESLSTGLKVAKMLKAGTVWINTYNDFDSRVPFGGVKQSGYGR 480

Query: 480 ELGEYGLANFTNVKAV 495
           E+GE     +T VKAV
Sbjct: 481 EMGEEVYHAYTEVKAV 496

>YBR006W (UGA2) [199] chr2 (246974..248467) Succinate semialdehyde
           dehydrogenase (4-Aminobutyrate catabolic enzyme) [1494
           bp, 497 aa]
          Length = 497

 Score =  248 bits (632), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 147/431 (34%), Positives = 236/431 (54%), Gaps = 14/431 (3%)

Query: 69  FPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYY 128
           F  +++T   E+   L  + +L+ E  + LA + +L++GK LG  A  +++  A   ++Y
Sbjct: 68  FKTYKNTTPRERAKWLRNMYNLMLENLDDLATIITLENGKALGE-AKGEIKYAASYFEWY 126

Query: 129 AGWVDKAQGQSYAP-STQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWTA-VATGNTTVF 186
           A    +  G +  P +     +T+ QP+GV G I P+N+P  M+  K  A +A G T V 
Sbjct: 127 AEEAPRLYGATIQPLNPHNRVFTIRQPVGVCGIICPWNFPSAMITRKAAAALAVGCTVVI 186

Query: 187 KSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGAT--VGDAMARHTGIDKIAFTGSTSV 244
           K   QTPLS L  A L  +AGFP G FNV+     T  +G  +     + K+ FTGST+V
Sbjct: 187 KPDSQTPLSALAMAYLAEKAGFPKGSFNVILSHANTPKLGKTLCESPKVKKVTFTGSTNV 246

Query: 245 GQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRCYV 304
           G+ + + ++  LK L+ E GG +P +VF DAD +QA+    A  F  +GQ C   +R YV
Sbjct: 247 GKILMKQSSSTLKKLSFELGGNAPFIVFEDADLDQALEQAMACKFRGLGQTCVCANRLYV 306

Query: 305 EDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARLVL 364
             SI DKF   LA  V   +V+G      T  G  ++ +  E+V+ + +  +++GA++VL
Sbjct: 307 HSSIIDKFAKLLAERVKK-FVIGHGLDPKTTHGCVINSSAIEKVERHKQDAIDKGAKVVL 365

Query: 365 GGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALRLA 424
            G  L E   N       FY  P IL+ V  +  V++EE FGP+  +  F   +E +  A
Sbjct: 366 EGGRLTELGPN-------FYA-PVILSHVPSTAIVSKEETFGPLCPIFSFDTMEEVVGYA 417

Query: 425 NDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELGEY 484
           ND+E+GL + +F+ ++N  +  +  +E+G+   N+    D + PFGG+K SG+GRE   Y
Sbjct: 418 NDTEFGLAAYVFSKNVNTLYTVSEALETGMVSCNTGVFSDCSIPFGGVKESGFGREGSLY 477

Query: 485 GLANFTNVKAV 495
           G+ ++T +K +
Sbjct: 478 GIEDYTVLKTI 488

>KLLA0F12628g complement(1170396..1171910) similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase P9.1.f7. 1, start by
           similarity
          Length = 504

 Score =  246 bits (628), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 139/433 (32%), Positives = 237/433 (54%), Gaps = 15/433 (3%)

Query: 69  FPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYY 128
           F  +R T   E+  +L  + +L+ E K+ LA + +L++GKP   +++ ++   A   K++
Sbjct: 77  FGTFRQTNVRERAQILDNIYNLMLENKQDLAKILTLENGKPY-KDSLGEIVYSAMFFKWF 135

Query: 129 AGWVDKAQGQ--SYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWTAV-ATGNTTV 185
           A    +  G     A S+ +  +T+ QPLGV+G + P+N+P  M+A K   V ATGNT V
Sbjct: 136 AEEAPRIYGDIIPSAVSSDQKIFTIRQPLGVIGILTPWNFPSAMIARKLAPVIATGNTCV 195

Query: 186 FKSAEQTPLSILYFAQLVVRAGFPPGVFNVL-SGRGATVGDAMARHTGIDKIAFTGSTSV 244
            K A +TPLS L    +  +AG P GV N+L +   + +G+ +  H  + KI FTGST +
Sbjct: 196 IKPAHETPLSALALGVIAEKAGLPAGVCNILPTNHTSEIGEYVCEHELVKKITFTGSTKI 255

Query: 245 GQQI--QRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRC 302
           GQ +  Q +   N+K  ++E GG +P +VF DAD ++A+       F   GQ C   +R 
Sbjct: 256 GQLLMGQSSKGKNIKKFSMELGGNAPYIVFKDADLDRALDGIIGCKFRQSGQTCICANRI 315

Query: 303 YVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARL 362
           +V + +YD+F   L   +  T+ +G   Q     GP +     ++V + ++    +GA +
Sbjct: 316 FVHEDLYDEFSKRLVDKIDKTFKLGDGFQDGVTHGPLIHDKSIDKVASLVQDAKTKGADV 375

Query: 363 VLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALR 422
           ++GG        +        + +PT+L +V +S  +  EEIFGPV  + KF D DE ++
Sbjct: 376 LIGG--------SRASSLGPLFYQPTVLGNVTESMDIFYEEIFGPVAPLIKFKDVDEVIK 427

Query: 423 LANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELG 482
            AND++ GL    ++ +++     A ++  G+  +N+    +PA PFGG+K SG G+E  
Sbjct: 428 RANDTDVGLAGYFYSQNISTIFDAAEKLNVGMVGVNTGEISEPAVPFGGVKNSGLGKEGS 487

Query: 483 EYGLANFTNVKAV 495
           +YG+ ++T +KA+
Sbjct: 488 KYGIDDYTELKAI 500

>Scas_716.63
          Length = 494

 Score =  241 bits (616), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 149/431 (34%), Positives = 234/431 (54%), Gaps = 14/431 (3%)

Query: 69  FPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYY 128
           F  +++T   ++   L  + +L+ E  E LA + S ++GK L S +  +++  A   ++Y
Sbjct: 65  FKTYKNTTPRQRAQWLRNMFNLMMENLEDLAKLISWENGKAL-SESRGEIKYAASFFEWY 123

Query: 129 AGWVDKAQGQSYAPST-QRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWTAVAT-GNTTVF 186
           A    +  G +   +T     +TL QP+GV G I P+N+P  M+  K  A  T G T + 
Sbjct: 124 AEEAPRIYGTTIQTATASNRVFTLRQPVGVCGIICPWNFPSAMITRKVAAALTAGCTVIV 183

Query: 187 KSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGAT--VGDAMARHTGIDKIAFTGSTSV 244
           K   QTPLS L    L+  AGFP GV NV+     T   G  +     + KI+FTGSTSV
Sbjct: 184 KPDSQTPLSGLALGYLLEEAGFPEGVCNVILSHKNTPACGLTLCESPVVKKISFTGSTSV 243

Query: 245 GQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRCYV 304
           G+ + + +A  LK L+ E GG +P +VF DAD E AV  T A  F  +GQ C  ++R YV
Sbjct: 244 GKILMKQSASTLKKLSFELGGNAPVIVFEDADLEVAVEQTIASKFRGLGQTCVCSNRIYV 303

Query: 305 EDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARLVL 364
             SI DKF + +AA V   + +GP        G  ++    E+V++++   + +GA+++ 
Sbjct: 304 HSSIIDKFAELVAAKVRK-FTIGPGLSDGVTHGCIINGKAIEKVESHVNDAITKGAQIIE 362

Query: 365 GGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALRLA 424
            G  +P    N       FY  P +L+ V +   VA+EE FGP+  +  F   +E +  A
Sbjct: 363 KGGLIPSLGPN-------FYA-PVVLSHVTKDALVAKEETFGPLCPIFSFDTLEEVIGYA 414

Query: 425 NDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELGEY 484
           ND+E+GL + IF+ D++  +  A  +E+G+   N+    D A PFGG+K SG+GRE   +
Sbjct: 415 NDTEFGLAAYIFSKDIDTVYTAAEALEAGMVSCNTGIFSDCAMPFGGVKESGFGREGSLH 474

Query: 485 GLANFTNVKAV 495
           G+ ++T +K+V
Sbjct: 475 GIEDYTVLKSV 485

>Sklu_2087.3 , Contig c2087 4336-5856
          Length = 506

 Score =  239 bits (609), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 141/435 (32%), Positives = 235/435 (54%), Gaps = 18/435 (4%)

Query: 69  FPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYY 128
           F   R+T   E+  +L  +  L++E K+ LA + +L++GKP+  +++ ++E  A   +++
Sbjct: 78  FKTHRETSLRERSQILYNIYDLIQEHKKDLARLITLENGKPI-KDSLGEIEYSASYFRWF 136

Query: 129 AGWVDKAQGQ--SYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATGNTTV 185
           A    +  G     + S+++  +T+ QPLGVVG + P+N+P  M+A K    +ATGN+ V
Sbjct: 137 AEEAPRIYGNIIPSSGSSKKQIFTIRQPLGVVGILTPWNFPSAMIARKLAPCIATGNSCV 196

Query: 186 FKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATV-GDAMARHTGIDKIAFTGSTSV 244
            K A +TPLS L F  LV +AG   G+ N+L     +V G+ +  H  I K+ FTGST+V
Sbjct: 197 IKPAHETPLSALAFGWLVEQAGLAAGLCNILPTTYTSVTGEYICSHDLIRKVTFTGSTAV 256

Query: 245 GQ----QIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300
           G+    Q  + + V +K +++E GG +P +VF DAD  +++       F   GQ C   +
Sbjct: 257 GKALMGQCLKDSKV-IKKISMELGGNAPFIVFKDADLMRSIDGLIGCKFRQSGQTCICAN 315

Query: 301 RCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGA 360
           R +V + IYD+F   L   +  ++ +G         GP +  +  ++V   +     +GA
Sbjct: 316 RIFVHEDIYDEFAKKLVERIETSFTLGDGFDPKVTHGPLIHESAVDKVVKLVHDAKTKGA 375

Query: 361 RLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEA 420
           +++ GG                 + RPT+L+ V +S  +   EIFGPV ++ KF   DE 
Sbjct: 376 QVLTGG--------TRASSLGPLFYRPTVLSGVNESMDIFHTEIFGPVASLVKFKSVDEV 427

Query: 421 LRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRE 480
           +  AN ++ GL    ++S+L      A+ +E G+  +NSS   D A PFGGIK SG GRE
Sbjct: 428 IERANATDVGLAGYFYSSNLQTVFDVATRLEVGMVGVNSSAISDAAMPFGGIKNSGIGRE 487

Query: 481 LGEYGLANFTNVKAV 495
              +G+ ++T +K+V
Sbjct: 488 GSMFGIEDYTELKSV 502

>KLLA0E17545g 1553982..1555475 highly similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase, start by similarity
          Length = 497

 Score =  237 bits (605), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 151/427 (35%), Positives = 238/427 (55%), Gaps = 15/427 (3%)

Query: 73  RDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYYAGWV 132
           + TP T +   L  L +L+ E  + LA + + ++GK L S A  +V+  A   ++YA   
Sbjct: 73  KTTPKT-RSTWLRNLYNLMMENVDDLAKIITWENGKAL-SEAQGEVKYAASYFEWYAEEA 130

Query: 133 DKAQGQSYAPST-QRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATGNTTVFKSAE 190
            +  G +  P+      +T+ QP+GV G I P+N+P  M+  K   A+A G T V K   
Sbjct: 131 VRMYGTTIQPNNGSNRAFTVRQPVGVCGIICPWNFPSAMITRKAGAALAAGCTVVVKPDS 190

Query: 191 QTPLSILYFAQLVVRAGFPPGVFNVL--SGRGATVGDAMARHTGIDKIAFTGSTSVGQQI 248
           QTPLS L  A L  +AGFP GVFNV+  + R    G A+     + KI+FTGST+VG+ +
Sbjct: 191 QTPLSALALAHLAEKAGFPKGVFNVVLTATRTPEFGLALCESPKVKKISFTGSTNVGKIL 250

Query: 249 QRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRCYVEDSI 308
            + +A  +K L+ E GG +P +VF DAD EQAV  T    F  +GQ C   +R YV+ +I
Sbjct: 251 MKQSASTMKKLSFELGGNAPVIVFDDADLEQAVTQTILSKFRGLGQTCVCANRIYVQRTI 310

Query: 309 YDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARLVLGGEG 368
            D F + LA  V + +V+G    S T  G  ++    ++V+ +++  +E+GA+ V+ G  
Sbjct: 311 IDSFAEKLAKQV-NEFVIGHGLDSKTTHGCLINENAIKKVEAHVKDALEKGAKTVVAGGR 369

Query: 369 LPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALRLANDSE 428
           LPE   N       FY  PT+L+ V  +  V ++E FGP+ A+  F   +E +  AND+E
Sbjct: 370 LPELGPN-------FYA-PTVLSHVPSTAVVNKDETFGPLCALIPFDTMEEVVGYANDTE 421

Query: 429 YGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELGEYGLAN 488
            GL S +F+ +++  +  A  +E+G+   N+    +   PFGG+K SG+GRE   +G+ +
Sbjct: 422 LGLASYVFSKNIDTVYTVAEALETGMVSCNTGLFSECTIPFGGVKESGFGREGSLHGIED 481

Query: 489 FTNVKAV 495
           +T +K +
Sbjct: 482 YTVIKTI 488

>CAGL0C04191g complement(409544..411019) highly similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase, hypothetical start
          Length = 491

 Score =  236 bits (602), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 160/479 (33%), Positives = 247/479 (51%), Gaps = 16/479 (3%)

Query: 21  FINNEYVDSHSSEKIESFDAATGEXXXXXXXXXXXXXXXXXXXXXXXXFPGWRDTPTTEK 80
           +IN E+V   S+E  E  D +TGE                        F  +++T   ++
Sbjct: 16  YINGEWV-KDSNEFFEVDDPSTGEIIAKLPEHDIAVVDRAVDAAYDA-FQKYKNTLPRQR 73

Query: 81  RDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYYAGWVDKAQGQSY 140
              L  L +L+ E  E LA + + ++GK L  ++  +++  A   ++YA    +  G + 
Sbjct: 74  ATWLRNLFNLMTENAEDLAKIITWENGKSL-PDSRAEIKYAASYYEWYAEEAPRIYGATI 132

Query: 141 APST-QRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATGNTTVFKSAEQTPLSILY 198
            PS       T  QP+GV G I P+N+P  M+  K   A+A G T V K    TPLS L 
Sbjct: 133 QPSIPNNRVITKRQPVGVCGIICPWNFPSAMITRKVGAALAAGCTVVVKPDSHTPLSALA 192

Query: 199 FAQLVVRAGFPPGVFNVLSGRGAT--VGDAMARHTGIDKIAFTGSTSVGQQIQRTAAVNL 256
              LV +AGFP GVFNV+  +  T  +G  +  H  + K+ FTGST +G+ +   A+  L
Sbjct: 193 MTVLVEKAGFPKGVFNVVLSQHNTPKLGKRLCEHPKVKKVTFTGSTRIGKTLMEQASSTL 252

Query: 257 KALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRCYVEDSIYDKFVDAL 316
           K  + E GG +P +VF DAD + AV    A  F  MGQ C  T+R YV+D+I D+F + L
Sbjct: 253 KKCSFELGGNAPFIVFDDADLDLAVDQAIASKFRGMGQTCVCTNRFYVQDTIADEFAEKL 312

Query: 317 AAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARLVLGGEGLPETIAND 376
              V   + +G   +     G   +  Q ++V  + +  +E+GA+++L G  +P+   N 
Sbjct: 313 VTKVKQ-FKIGDGMKEGVTHGCLTNAKQADKVDEHKKDAIEKGAKVLLEGGRMPDLGKN- 370

Query: 377 ERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALRLANDSEYGLGSAIF 436
                 FY  P +L +V QS  VA+EE FGP+  +  F   +E L  AND+E GL S +F
Sbjct: 371 ------FYA-PVVLKNVPQSAMVAKEETFGPLCPIFTFKTVEEVLGYANDTELGLASYVF 423

Query: 437 TSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELGEYGLANFTNVKAV 495
           T ++N     +  +E+G+   N+    D + PFGG+K SG+GRE   YG+ ++T VK++
Sbjct: 424 TKNVNTLFTVSEALEAGMVSCNTGLFSDSSVPFGGVKESGFGREGSLYGIDDYTTVKSI 482

>AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH]
           complement(644674..646161) [1488 bp, 495 aa]
          Length = 495

 Score =  236 bits (601), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 145/431 (33%), Positives = 229/431 (53%), Gaps = 14/431 (3%)

Query: 69  FPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYY 128
           F  ++ T  T++ + L  L  L+ E  E LAA+ + ++GK L   A+ ++   A   K++
Sbjct: 67  FQSYKKTSPTQRSEWLRNLYDLIMENAEDLAAIVTWENGKSL-REALVEIRYGATFFKWF 125

Query: 129 AGWVDKAQGQSYAPSTQ-RLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATGNTTVF 186
           +    +  G +  PS      +T+ QP+GV   I P+N+P  M++ K   A+A G T + 
Sbjct: 126 SEEALRLYGTTIQPSNPGNRAFTIRQPVGVCALICPWNFPNAMISRKAAPALAAGCTVII 185

Query: 187 KSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGAT--VGDAMARHTGIDKIAFTGSTSV 244
           K   QTPLS L  A L  +AGFPPGV NV+     T  +G  +   + + K++FTGST+V
Sbjct: 186 KPDPQTPLSSLALAHLAEKAGFPPGVINVVPTSKYTKDIGVLLCESSLVRKVSFTGSTAV 245

Query: 245 GQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRCYV 304
           G+ + + AA  +K ++ E GG +P ++  DAD E+ V    A  F  MGQ C   +R YV
Sbjct: 246 GKILMQQAASTVKKVSFELGGNAPVIIMGDADMEKTVEEVLATKFRGMGQTCICANRLYV 305

Query: 305 EDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARLVL 364
             SI D F   L   V +   +G   Q     G  ++    E+V+ + +  +E GA+++L
Sbjct: 306 HRSIIDDFSSRLVKKV-EGLKLGNGFQEGVTHGSLINNAAIEKVERHAKDAIERGAKVLL 364

Query: 365 GGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALRLA 424
            G   PE   +       FY  PT+L+DVK    + REE FGP+ A+  F   +E +  A
Sbjct: 365 PGGRAPELGPH-------FY-SPTVLSDVKPDSVLTREETFGPLCAMIPFDTVEEVVGYA 416

Query: 425 NDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELGEY 484
           ND++YGL S +F+ ++   +  A  ++ G+   N+    D   PFGGIK SG+G E   +
Sbjct: 417 NDTQYGLASYVFSENIKTVYSIAEALDFGMVACNTGLFSDSMVPFGGIKESGFGIEGSLH 476

Query: 485 GLANFTNVKAV 495
           G+ ++T +K V
Sbjct: 477 GINDYTVLKTV 487

>Kwal_56.23106
          Length = 495

 Score =  234 bits (598), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 150/432 (34%), Positives = 241/432 (55%), Gaps = 16/432 (3%)

Query: 69  FPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYY 128
           F  ++ T   E+  LL K+ SL+ E  E L  + S ++GKPL +  I +++  A   ++Y
Sbjct: 66  FQSFKKTTGRERATLLRKMHSLMLENVEDLGKILSWENGKPL-AEGIGEIKYAASFYEWY 124

Query: 129 AGWVDKAQGQSY--APSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATGNTTV 185
           A    +  G +   A ST R+ +T  QP+GV G I P+N+P  M+  K   A+A G T V
Sbjct: 125 AEEAPRINGTTINSAISTNRV-FTERQPVGVCGIICPWNFPSAMITRKVGAALAAGCTVV 183

Query: 186 FKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGAT--VGDAMARHTGIDKIAFTGSTS 243
            K   QTPLS L  A L  +AG P GVFNV+     T   G  +     + K++FTGST+
Sbjct: 184 IKPDSQTPLSALALAHLAEKAGVPAGVFNVVLSHTKTPEFGLKLCESPKVKKVSFTGSTN 243

Query: 244 VGQQIQRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRCY 303
           VG+ + + +A  +K L+ E GG +P +VF DAD ++AV    A  F  +GQ C   +R Y
Sbjct: 244 VGKILMKQSASTMKKLSFELGGNAPFIVFEDADLDKAVEQAIACKFRGLGQTCVCANRLY 303

Query: 304 VEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARLV 363
           V+ SI D+F    A  V + +V+G   +     G  ++    E+V+ + +  +E+GA++V
Sbjct: 304 VQKSILDEFETRFAEKV-NQFVIGHAFKEGVTHGCLINPKAIEKVEAHTKDAIEKGAKVV 362

Query: 364 LGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALRL 423
           + G  LP+   +       FY  PT+++ V Q   VA +E FGP+ A+  F   +E +R 
Sbjct: 363 VEGGRLPDLGPS-------FYA-PTVVSQVPQDAIVASQETFGPLCAIIPFETTEEVVRW 414

Query: 424 ANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELGE 483
           AND+E GL + +F+ +++  +  +  +E+G+   N+    + A PFGG+K SG+GRE   
Sbjct: 415 ANDTEVGLAAYVFSKNIDTIYTVSEALETGMVSCNTGVFSECAVPFGGVKESGFGREGSL 474

Query: 484 YGLANFTNVKAV 495
           +G+ ++T +K+V
Sbjct: 475 HGIEDYTVIKSV 486

>Kwal_23.5699
          Length = 641

 Score =  171 bits (432), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 127/452 (28%), Positives = 207/452 (45%), Gaps = 42/452 (9%)

Query: 72  WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYYAGW 131
           W  T   E+  +L+ L   + E ++ +A V   DSGK +   ++ ++      L+    W
Sbjct: 147 WAKTTLEERTRVLVSLQDYILENQDSIARVACRDSGKTMLDASMGEILVTLEKLQ----W 202

Query: 132 VDKAQGQSYAPSTQ-----------RLTYTLHQPLGVVGCIIPFNYPL-GMMAWKWTAVA 179
           + K   ++  PS +           +     ++PLGVVG ++ +NYP   ++     A+ 
Sbjct: 203 IIKNGEKALQPSKRSGPTNFFMKWYKGAEVRYEPLGVVGALVSWNYPFHNLLGPIMAAIF 262

Query: 180 TGNTTVFKSAEQTPLSILYFAQLVVRA----GFPPGVFNVLSGRGATVGDAMARH----T 231
           TGN  V K +EQ   S  +FA +  +     GF P +  +   R  +  D  A H     
Sbjct: 263 TGNAIVIKCSEQVVWSSEFFASMCKKCLESNGFDPNLIQLCYCRPPSATDNAANHYSSHP 322

Query: 232 GIDKIAFTGSTSVGQQIQRTAAVNLKALTLECGGKSPALVFADA--DFEQAVRWTAAGIF 289
           G+  + F GS  V   +   A+ +L  + +E GGK  AL+  D+  D          G F
Sbjct: 323 GLKHLTFIGSKPVAHHVLAAASKSLTPVVVELGGKD-ALIALDSVKDLPALSSIIMRGTF 381

Query: 290 YNMGQICSGTSRCYVEDSIYDKFVDALAAHVADTYVVGP-PSQSTTRVGPQVSRTQQERV 348
            + GQ C G  R  V    YD+ V  L   V    +     +     +G  +S  + E +
Sbjct: 382 QSSGQNCIGIERVIVSAKNYDELVSILEKRVGQLRLGSDIDNLEDVDMGAMISDNRFEEL 441

Query: 349 QNYIRKGVEEGARLVLGGEGLPETIANDERHRN---GFYVRPTILADVKQSHTVAREEIF 405
           +  ++  +++GARL+ GG        +  +H N   G Y +PT+L DV     +A+ E+F
Sbjct: 442 ERMVQDAIKQGARLLHGG--------SRYKHPNYPQGHYFQPTLLVDVTPLMEIAQNEVF 493

Query: 406 GPVIAVSKFSDYDEALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDP 465
           GP++ V +  D  + +RLAN + +GLG ++F SD    +  A+ + +G   IN       
Sbjct: 494 GPIMTVMRAEDTQDCIRLANSAPFGLGGSVFGSDYAECNYVANHLTTGNVAINDFATFY- 552

Query: 466 AC--PFGGIKMSGYGRELGEYGLANFTNVKAV 495
            C  PFGGI  SGYG+  GE GL    N K++
Sbjct: 553 VCQLPFGGINGSGYGKFGGEEGLTGLCNAKSI 584

>CAGL0F08965g complement(880296..882215) highly similar to sp|P38694
           Saccharomyces cerevisiae YHR039c, hypothetical start
          Length = 639

 Score =  169 bits (427), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/452 (27%), Positives = 211/452 (46%), Gaps = 40/452 (8%)

Query: 72  WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDV----EALAGILKY 127
           W ++   ++ ++L  L   + E ++++A V   DSGK +   ++ ++    E +  ILK+
Sbjct: 143 WAESSIAKRLEVLATLQKFILENQDLIAKVACRDSGKTMLDASMGEILVTLEKIQWILKH 202

Query: 128 YAGWVDKAQGQSYAPSTQRLTY-----TLHQPLGVVGCIIPFNYPL-GMMAWKWTAVATG 181
               ++ ++     P+   + +       ++PLGV+  I+ +NYP   +M     ++ TG
Sbjct: 203 GPSTLEPSRRP--GPTNFFMKFYKGAEVRYEPLGVISSIVSWNYPFHNLMGPIIASIFTG 260

Query: 182 NTTVFKSAEQTPLSILYFAQLV--------VRAGFPPGVFNVLSGRGATVGDAMARHTGI 233
           N  + K +EQ   S  +F ++V        V +      + +   +     +    H GI
Sbjct: 261 NAIIVKCSEQVVWSSEFFIEMVRKCLDVCDVDSNIVQLCYCLPPTKDDDAANHFTSHPGI 320

Query: 234 DKIAFTGSTSVGQQIQRTAAVNLKALTLECGGKSPALVFADA-DFEQAVRWTAAGIFYNM 292
             I F GS SV   I   A+ +L  + +E GGK   +V     D +        G F + 
Sbjct: 321 KHITFIGSQSVASHILNCASKSLTPVVVELGGKDAFIVLDSVKDLDALSSIILRGTFQSS 380

Query: 293 GQICSGTSRCYVEDSIYDKFVDALAAHVADTYVVGPPSQST-------TRVGPQVSRTQQ 345
           GQ C G  R  V +  YD+ V+ L   + +T    P  Q +         +G  +S  + 
Sbjct: 381 GQNCIGIERVIVSEKNYDQLVNILEKRMKET----PLRQGSDIDHLEVVDMGAMISDNRF 436

Query: 346 ERVQNYIRKGVEEGARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIF 405
           + ++  I+  V +GARL+ GG        N  ++  G Y +PT+L DV     +A+ E+F
Sbjct: 437 KTLEALIQDAVSKGARLLYGGSQY-----NHPKYPQGHYFQPTLLVDVTPDMDIAQNEVF 491

Query: 406 GPVIAVSKFSDYDEALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDP 465
           GPV+ + K  D    + LAN + +GLG ++F SD +  +  A+++++G   IN       
Sbjct: 492 GPVLVMMKAKDTSNCIELANAAPFGLGGSVFGSDYSECNFVANKLKTGNVAINDFATF-Y 550

Query: 466 AC--PFGGIKMSGYGRELGEYGLANFTNVKAV 495
            C  PFGGI  SGYG+  GE GL    N K+V
Sbjct: 551 VCQLPFGGINGSGYGKFGGEEGLLGLCNAKSV 582

>KLLA0C10615g complement(912077..913999) similar to sp|P38694
           Saccharomyces cerevisiae YHR039c, start by similarity
          Length = 640

 Score =  164 bits (416), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 123/447 (27%), Positives = 198/447 (44%), Gaps = 32/447 (7%)

Query: 72  WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYYAGW 131
           W  T   E+  +LL L + + E +E +A V   DSGK +   ++ ++      ++    W
Sbjct: 146 WAKTSLKERLQVLLSLKNFILENQEAIARVACRDSGKTMLDASMGEILVTLEKIQ----W 201

Query: 132 VDKAQGQSYAPSTQ-----------RLTYTLHQPLGVVGCIIPFNYPL-GMMAWKWTAVA 179
           + +       PS +           +     ++PLGVVG I+ +NYP   ++     ++ 
Sbjct: 202 IIEHGEDVLKPSARPGPTNFFMKWYKGAEVRYEPLGVVGAIVSWNYPFHNLLGPIVASIF 261

Query: 180 TGNTTVFKSAEQTPLSILYFAQLVVRA----GFPPGVFNVLSGRGATVGDAMAR----HT 231
           TGN  V K +EQ   S  +F  LV  A    G  P +  +      T  D  A     H 
Sbjct: 262 TGNAVVVKCSEQVVWSSKFFTLLVQEALKACGHDPNLVQLCYCLPPTGNDDAANYFTSHP 321

Query: 232 GIDKIAFTGSTSVGQQIQRTAAVNLKALTLECGGKSPALVFADA-DFEQAVRWTAAGIFY 290
               + F GS  V   + + AA +L  + +E GGK   +V     D +        G F 
Sbjct: 322 VFKHLTFIGSKPVAHHVLKAAADSLTPVVVELGGKDAFIVLDSVKDLQALSSIIMRGTFQ 381

Query: 291 NMGQICSGTSRCYVEDSIYDKFVDALAAHVADTYV-VGPPSQSTTRVGPQVSRTQQERVQ 349
           + GQ C G  R  V    YD  V  L   V    +     +     +G  +S  +  +++
Sbjct: 382 SAGQNCIGIERVIVSAKNYDALVSILNDRVGQLRLGSDIDNLEDVDMGAMISDNRFGQLE 441

Query: 350 NYIRKGVEEGARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVI 409
           N I   + +GA+L+ GG        N   +  G + +PT+L DV +   ++  E+FGP++
Sbjct: 442 NLISDALSKGAKLLHGGSRY-----NHPNYPQGHFFQPTLLVDVTEDMQISHNEVFGPIL 496

Query: 410 AVSKFSDYDEALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPA-CP 468
            V +  D D+ +RLAN + +GLG +IF +D    ++ A+ + +G   IN          P
Sbjct: 497 TVMRAKDTDDCIRLANAAPFGLGGSIFGADFGECNRVANSLTTGNVAINDFATFYVCQLP 556

Query: 469 FGGIKMSGYGRELGEYGLANFTNVKAV 495
           FGG+  SGYG+  GE GL    N K+V
Sbjct: 557 FGGLNGSGYGKFGGEEGLLGLCNAKSV 583

>AAL075W [112] [Homologous to ScYHR039C (MSC7) - SH]
           complement(213684..215597) [1914 bp, 637 aa]
          Length = 637

 Score =  161 bits (408), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 124/447 (27%), Positives = 199/447 (44%), Gaps = 32/447 (7%)

Query: 72  WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYYAGW 131
           W  T   ++R +L  +   V E +EMLA V   DSGK +   ++ ++      L+    W
Sbjct: 143 WAKTSFAQRRQVLKTMQKFVLENQEMLARVACRDSGKTMLDASLGEIMVTMEKLQ----W 198

Query: 132 VDKAQGQSYAPSTQ-----------RLTYTLHQPLGVVGCIIPFNYPL-GMMAWKWTAVA 179
           + K   ++  PS +           +     ++PLGVVG ++ +NY     +     +  
Sbjct: 199 MIKHGERTLRPSKRAGPANFFMKLYKGGEVRYEPLGVVGAVVSWNYSFHNTLGPIIASTF 258

Query: 180 TGNTTVFKSAEQTPLSILYFAQLVVRA----GFPPGVFNVLSGRGATVGDAMAR----HT 231
            GN  V K +EQ   S  +F +L   +    G  P +  +      +  D  A     H 
Sbjct: 259 AGNGVVIKCSEQVVWSSEFFVKLARESLKVCGHDPELVQLCYCFPPSETDDTANYFTSHP 318

Query: 232 GIDKIAFTGSTSVGQQIQRTAAVNLKALTLECGGKSPALVFADA-DFEQAVRWTAAGIFY 290
            +  + F GS  V   +   AA +L  + +E GGK   +V   A D E        G F 
Sbjct: 319 SLRHLTFIGSKPVAHHVLACAAKSLTPVVVELGGKDALVVLDSAKDLESLSSIIMRGTFQ 378

Query: 291 NMGQICSGTSRCYVEDSIYDKFVDALAAHVADTYV-VGPPSQSTTRVGPQVSRTQQERVQ 349
           + GQ C G  R  V    YD  V  L   +++  V     +     VG  +S  + + ++
Sbjct: 379 SAGQNCIGIERVIVCQKNYDALVKILEHRISELRVGADIDNLEDVDVGAMISDNRFDYME 438

Query: 350 NYIRKGVEEGARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVI 409
             I+  V +GARL+ GG     +     ++  G Y +PT+L DV     +++ E+FGPV+
Sbjct: 439 ELIQDAVSQGARLLHGG-----SRYTHPKYPQGHYFQPTLLVDVTTDMRISQNEVFGPVL 493

Query: 410 AVSKFSDYDEALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINS-SNELDPACP 468
            V K  D ++ +R+AND+ +GLG ++F  +    +  A+ +  G   IN  +       P
Sbjct: 494 TVMKAKDIEDCIRIANDTPFGLGGSVFGKNRKDCNYVANHMNVGNVAINDFATYYVCQLP 553

Query: 469 FGGIKMSGYGRELGEYGLANFTNVKAV 495
           FGGI  SGYGR  GE GL    N K++
Sbjct: 554 FGGIGSSGYGRFGGEEGLLGLCNSKSI 580

>YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein with
           strong similarity to aldehyde dehydrogenases [1935 bp,
           644 aa]
          Length = 644

 Score =  155 bits (393), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 119/450 (26%), Positives = 198/450 (44%), Gaps = 36/450 (8%)

Query: 72  WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYYAGW 131
           W ++  + +  +L  L   +   ++++A V   DSGK +   ++ ++      +++    
Sbjct: 148 WGNSDFSRRLRVLASLHDYILNNQDLIARVACRDSGKTMLDASMGEILVTLEKIQWTIKH 207

Query: 132 VDKAQGQSYAPSTQRLTYTLH-------QPLGVVGCIIPFNYPL-GMMAWKWTAVATGNT 183
             +A   S  P         +       +PLGV+  I+ +NYP   ++     A+ TGN 
Sbjct: 208 GQRALQPSRRPGPTNFFMKWYKGAEIRYEPLGVISSIVSWNYPFHNLLGPIIAALFTGNA 267

Query: 184 TVFKSAEQTPLSILYFAQLVVRA----GFPPGVFNVLSGRGATVGDAMAR----HTGIDK 235
            V K +EQ   S  +F +L+ +        P +  +      T  D  A     H G   
Sbjct: 268 IVVKCSEQVVWSSEFFVELIRKCLEACDEDPDLVQLCYCLPPTENDDSANYFTSHPGFKH 327

Query: 236 IAFTGSTSVGQQIQRTAAVNLKALTLECGGKSPALVFADA-DFEQAVRWTAAGIFYNMGQ 294
           I F GS  V   I + AA +L  + +E GGK   +V   A + +        G F + GQ
Sbjct: 328 ITFIGSQPVAHYILKCAAKSLTPVVVELGGKDAFIVLDSAKNLDALSSIIMRGTFQSSGQ 387

Query: 295 ICSGTSRCYVEDSIYDKFVDALAAHVADTYVVGPPSQST-------TRVGPQVSRTQQER 347
            C G  R  V    YD  V  L     D     P  Q +         +G  +S  + + 
Sbjct: 388 NCIGIERVIVSKENYDDLVKILN----DRMTANPLRQGSDIDHLENVDMGAMISDNRFDE 443

Query: 348 VQNYIRKGVEEGARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGP 407
           ++  ++  V +GARL+ GG           ++  G Y +PT+L DV     +A+ E+FGP
Sbjct: 444 LEALVKDAVAKGARLLQGGSRFKH-----PKYPQGHYFQPTLLVDVTPEMKIAQNEVFGP 498

Query: 408 VIAVSKFSDYDEALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPAC 467
           ++ + K  + D  ++LAN + +GLG ++F +D+   +  A+ +++G   IN        C
Sbjct: 499 ILVMMKAKNTDHCVQLANSAPFGLGGSVFGADIKECNYVANSLQTGNVAINDFATFY-VC 557

Query: 468 --PFGGIKMSGYGRELGEYGLANFTNVKAV 495
             PFGGI  SGYG+  GE GL    N K+V
Sbjct: 558 QLPFGGINGSGYGKFGGEEGLLGLCNAKSV 587

>Scas_690.26
          Length = 651

 Score =  154 bits (390), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 120/457 (26%), Positives = 195/457 (42%), Gaps = 46/457 (10%)

Query: 72  WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYYAGW 131
           W  +    +  +L  L   +   +EM+A++   DSGK     ++ ++      L++    
Sbjct: 151 WSTSSMERRLRVLTSLREYILSNQEMIASIACRDSGKTKLDASMGEILVTLEKLQWLITH 210

Query: 132 VDKAQGQSYAPSTQRLTYTL-------HQPLGVVGCIIPFNYPLGMMAWKW----TAVAT 180
                  S  P                ++PLGVV  I+ +NYP   +   W     ++ T
Sbjct: 211 GPSVLKPSRRPGPTNFFMKWYKGAEIRYEPLGVVSAIVSWNYPFHNL---WGPIIDSLFT 267

Query: 181 GNTTVFKSAEQTPLSILYFAQL----VVRAGFPPGVF--------NVLSGRGATVGDAMA 228
           GN  V K +EQ   S   F QL    +++ G  P +         N+         +   
Sbjct: 268 GNAIVMKCSEQVVWSSEIFVQLLRECLIQCGEDPELIQLFYCLPPNLEEDSNEETANYFT 327

Query: 229 RHTGIDKIAFTGSTSVGQQIQRTAAVNLKALTLECGGKSPALVFADA-DFEQAVRWTAAG 287
            H     I F GS  V  QI R AA  +  + +E GGK   +V     D +        G
Sbjct: 328 SHKAFKSITFIGSQQVSHQILRCAAEAITPVVVELGGKDAFIVLDSVKDLQSISSIILRG 387

Query: 288 IFYNMGQICSGTSRCYVEDSIYDKFVDALAAHVADTYVVGPPSQ-------STTRVGPQV 340
            F + GQ C G  R  V +  Y   V+ L+  +       P  Q           VG  +
Sbjct: 388 TFQSSGQNCIGIERVIVSEKNYATLVEILSNRMN----ASPMRQGSDIDSIDDIDVGAMI 443

Query: 341 SRTQQERVQNYIRKGVEEGARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVA 400
           S  + + ++  ++  V +GARL+ GG           ++  G Y +PT+L DV     +A
Sbjct: 444 SDNRFDELELLVKDAVSKGARLLCGGSRF-----QHPKYPQGNYFQPTLLVDVTPDMKIA 498

Query: 401 REEIFGPVIAVSKFSDYDEALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSS 460
           + E+FGP++ + + +D +  ++LAN + +GLG ++F S++   +  A+E+++G   IN  
Sbjct: 499 QNEVFGPILVMMRANDTEHCIKLANSAPFGLGGSVFGSNMQECNYVANELKTGNVAINDF 558

Query: 461 NELDPAC--PFGGIKMSGYGRELGEYGLANFTNVKAV 495
                 C  PFGGI  SGYG+  GE GL    N K+V
Sbjct: 559 ATFY-VCQLPFGGIHGSGYGKFGGEEGLLRLCNAKSV 594

>KLLA0B12540g 1094239..1095804 similar to sp|Q04458 Saccharomyces
           cerevisiae YMR110c, start by similarity
          Length = 521

 Score =  136 bits (343), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 107/349 (30%), Positives = 158/349 (45%), Gaps = 24/349 (6%)

Query: 155 LGVVGCIIPFNYPLGMMAWKWT-AVATGNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVF 213
           LG V  I PFN+P+ +       A+A GN+ VFK +E TP       ++   A F  G  
Sbjct: 124 LGTVLVISPFNFPILLALDPLAGAIAGGNSVVFKPSELTPACAEVMEEICNEA-FEKGQV 182

Query: 214 NVLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQIQRTAAVNLKALTLECGGKSPALV-- 271
             + G GA    A+      DKI +TGST+VG  I   AA +L    LE GGKSP  +  
Sbjct: 183 ETVQG-GAEETSALVESGKFDKIFYTGSTTVGTIIAEKAAKSLTPCVLELGGKSPVFISP 241

Query: 272 -FADADFEQAVRWTAAGIFYNMGQICSGTSRCYVEDSIYDKFVDALAAHVADTYVVGPPS 330
               + +E A+R        N GQIC         DSIYD+FVD+    + + Y   P  
Sbjct: 242 NLPKSQWETAIRRIYYSSMGNAGQICVAADYVLCPDSIYDEFVDSCKKVLNEFY---PSV 298

Query: 331 QSTTRVGPQVSRTQQERVQNYIRKGVEEGARLVLGGEGLPETIANDERHRNGFYVRPTIL 390
            S T    + +    ER  N I+  +E        G+   +T+A    +     + PTI+
Sbjct: 299 TSDT----EYTHMIHERAYNRIQTVIE-----TTKGQ---KTVAQHSDNLPPLCIPPTII 346

Query: 391 ADVKQSHTVAREEIFGPVIAVSKFSDYDEAL-RLANDSEYGLGSAIFTSDLNRAHKFASE 449
           +DV         E FGP++ + +++D DE +  L    +  L   IFT+  +      + 
Sbjct: 347 SDVSWDDPSMTGENFGPILPIMRYTDLDETIDTLIKRFDTPLVQYIFTNSKDEIDHILTR 406

Query: 450 VESGICYINSS--NELDPACPFGGIKMSGYGRELGEYGLANFTNVKAVY 496
           + SG C +N +  +      PFGGI  SGYG   G Y    FT+ + ++
Sbjct: 407 IRSGACVVNDTLLHVGIEEAPFGGIGTSGYGNYHGPYTFKTFTHERTIF 455

>CAGL0D03982g 397039..398763 highly similar to sp|P07275
           Saccharomyces cerevisiae YHR037w PUT2
           1-pyrroline-5-carboxylate dehydrogenase, start by
           similarity
          Length = 574

 Score =  116 bits (291), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 121/459 (26%), Positives = 201/459 (43%), Gaps = 51/459 (11%)

Query: 72  WRDTPTTEKRDLLLKLASLVEEEK--EMLAAVESLDSGKPLGSNAIHDVEALAGILKYYA 129
           W + P  ++  + +K A L+  +   +MLAA   L  GK +    I  +  L+   ++  
Sbjct: 115 WYNMPFYDRAAIFMKAADLISTKYRYDMLAAT-MLGQGKNVYQAEIDCITELSDFFRFNV 173

Query: 130 GWVDKAQGQSYAPSTQRL-TYTLHQPL-GVVGCIIPFNYPLGMMAWKWTAVATGNTTVFK 187
            + D+        S   +     ++PL G V  + PFN+              GNT V+K
Sbjct: 174 KYADELYATQPIESVPGIWNRAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWK 233

Query: 188 SAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQ 247
            ++   LS      ++  AG P GV N + G    + D +        + FTGST+V +Q
Sbjct: 234 PSQTAALSNYLLLTVLEEAGLPKGVINFVPGDPVEITDEVLASRDFSALHFTGSTAVFKQ 293

Query: 248 ----IQRTAAVN----LKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGT 299
               IQ   A N       +  E GGK+  LV   A+   AV  T  G F   GQ CS T
Sbjct: 294 LYGKIQSGVAENKYRDYPRIVGETGGKNYHLVHPSANVPHAVFNTIRGAFEFQGQKCSAT 353

Query: 300 SRCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRV---------GPQVSRTQQERVQN 350
           SR Y+  S+ ++F   +   +++  VV P + S + +         GP +     E+  N
Sbjct: 354 SRLYLPKSMSEEFFRDMFGTLSNNKVV-PVNTSASAISGGNLHGFMGPVI----HEQSFN 408

Query: 351 YIRKGVEEGAR-----LVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIF 405
            +   +EE  +     ++ GG+              G+Y+ PTI+     +H     E F
Sbjct: 409 KLSAAIEEAKKDPELEILYGGQ---------YDKSQGWYIGPTIIRTTNPNHKFLTTEFF 459

Query: 406 GPVIAVSKFSD--YDEALRLANDS-EYGLGSAIFTSDLNRAHKFASE---VESGICYINS 459
           GP++ V ++ D  + +   L N++ EYGL  +IF+ D + A  +ASE     +G  YIN 
Sbjct: 460 GPILTVYEYQDSQFKDICELINETGEYGLTGSIFSRDRD-AIIYASEKLRFSAGNFYIND 518

Query: 460 --SNELDPACPFGGIKMSGYGRELGEYG-LANFTNVKAV 495
             +  +     FGG +MSG   + G    L+ F +++++
Sbjct: 519 KCTGAVVAQQWFGGARMSGTNDKAGGPSILSRFVSIRSI 557

>KLLA0C10549g 903888..905618 gi|31043861|emb|CAD91310.1
           Kluyveromyces lactis delta 1-pyrroline-5-carboxylate
           dehydrogenase, start by similarity
          Length = 576

 Score =  116 bits (291), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 120/453 (26%), Positives = 195/453 (43%), Gaps = 41/453 (9%)

Query: 72  WRDTPTTEKRDLLLKLASLV--EEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYYA 129
           W   P  E+  + +K A L+  +   +MLAA   L  GK +    I  +  LA   ++  
Sbjct: 119 WYKLPYYERASVFMKAADLICTKYRYDMLAAT-MLGQGKNVYQAEIDCITELADFFRFNV 177

Query: 130 GWVDKAQGQSYAPSTQRL-TYTLHQPL-GVVGCIIPFNYPLGMMAWKWTAVATGNTTVFK 187
            + ++   Q    S+  +     ++PL G V  + PFN+              GNT V+K
Sbjct: 178 KYANELYAQQPIESSPGVWNRAEYRPLEGFVYAVTPFNFTAIAGNLIGAPALMGNTVVWK 237

Query: 188 SAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQ 247
            ++   LS      ++  AG P GV N + G    V   +   +    + FTGST+V +Q
Sbjct: 238 PSQNANLSNYLLLTVLEEAGLPNGVVNFVPGNAVEVTKEVLSDSEFAALHFTGSTAVFKQ 297

Query: 248 ----IQRTAAVNL----KALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGT 299
               IQ+     L      +  E GGK+  L+   A+   +V  T  G F   GQ CS T
Sbjct: 298 LYGDIQKGVVNGLYRDYPRIVGETGGKNFHLIHPSANIPHSVLSTLRGAFEFQGQKCSAT 357

Query: 300 SRCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEG 359
           SR Y+ +S  ++F   L   +++   V P       V    S+     +  +I   + EG
Sbjct: 358 SRVYLPESKSEEFFRDLGGVLSE---VQP-------VNTSASKINGGDLHGFIGPVIHEG 407

Query: 360 -----ARLVLGGEGLPE---TIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAV 411
                A+++   +  PE             G+Y++PTI+      H    +E FGP++ V
Sbjct: 408 SFDKLAKVIDDAKNDPELEIVFGGFHDKSKGYYIQPTIIKTTNPRHPYLSQEFFGPILTV 467

Query: 412 SKFSD--YDEALRLAND-SEYGLGSAIFTSDLNRAHKFASE---VESGICYIN--SSNEL 463
            ++ D  +++   L +  S+YGL  +IF  D   A K A E     +G  YIN  S+  +
Sbjct: 468 YEYPDAKFEDVCELVDSTSQYGLTGSIFARD-REAIKIADEKLKYSAGNFYINDKSTGAV 526

Query: 464 DPACPFGGIKMSGYGRELGEYGLAN-FTNVKAV 495
                FGG +MSG   + G   + N F +V+ +
Sbjct: 527 VAQQWFGGARMSGTNDKAGSGNILNRFVSVRNI 559

>AAL071C [116] [Homologous to ScYHR037W (PUT2) - SH]
           (223170..224891) [1722 bp, 573 aa]
          Length = 573

 Score =  116 bits (290), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 121/453 (26%), Positives = 196/453 (43%), Gaps = 41/453 (9%)

Query: 72  WRDTPTTEKRDLLLKLASLV--EEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYYA 129
           W +TP  ++  + LK A LV  +   +MLAA   L  GK +    I  +  LA   ++  
Sbjct: 116 WYETPFYDRAAVFLKAADLVATKYRYDMLAAT-MLGQGKNVQQAEIDCITELADFFRFNV 174

Query: 130 GWVDKAQGQSYAPSTQRL-TYTLHQPL-GVVGCIIPFNYPLGMMAWKWTAVATGNTTVFK 187
            + ++   Q  A S+  +   + ++PL G V  + PFN+              GNT V+K
Sbjct: 175 KYAEELYQQQPAESSPGVWNRSEYRPLEGFVYAVSPFNFTAIAGNLVGAPALMGNTVVWK 234

Query: 188 SAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQ 247
            ++   LS      ++  AG P GV N + G    V + +     +  + FTGST+V +Q
Sbjct: 235 PSQNAALSNYLLLTVLEEAGLPRGVINFVPGNPVDVTEEVLADKALGGLHFTGSTAVFKQ 294

Query: 248 ----IQRTAAVNL----KALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGT 299
               IQ+     L      +  E GGK+  LV   A+   AV  T  G F   GQ CS  
Sbjct: 295 LYGKIQQGVVSGLYRDYPRIVGETGGKNFHLVHPSANLPHAVLSTLRGAFEFQGQKCSAA 354

Query: 300 SRCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRV---------GPQVSRTQQERVQN 350
           SR Y+  S  D F+  LA  +A    + P + S + +         GP +     +++  
Sbjct: 355 SRLYLPQSKADAFLADLAGTLA---AIKPANTSASSINGGDLHAFMGPVIHEQSFDKLAA 411

Query: 351 YIRKGVEEGARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIA 410
            I +   +    +L G         D     G++V PT++      H     E FGP++ 
Sbjct: 412 AIERARTDPELEILYG--------GDHSKSQGYFVGPTVVRTSNPRHDFMTAEFFGPILT 463

Query: 411 VSKFSD--YDEALRLAND-SEYGLGSAIFTSDLNRAHKFASEVE--SGICYIN--SSNEL 463
           V ++ D  +D+   L +  S YGL  A+F  D +        ++  +G  YIN  ++  +
Sbjct: 464 VYEYPDAQFDQVCDLIDSTSAYGLTGAVFARDRDAIAAADRRLKYAAGNFYINDKATGAV 523

Query: 464 DPACPFGGIKMSGYGRELGEYG-LANFTNVKAV 495
                FGG +MSG   + G    L+ F +V++V
Sbjct: 524 VAQQWFGGARMSGTNDKAGSPNVLSRFVSVRSV 556

>Kwal_26.7595
          Length = 524

 Score =  111 bits (278), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 98/353 (27%), Positives = 157/353 (44%), Gaps = 34/353 (9%)

Query: 155 LGVVGCIIPFNYPLGM-MAWKWTAVATGNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVF 213
           LG V  I PFNYP+ + +     A+A GN+ V+K +E  P + +   Q +++        
Sbjct: 123 LGAVLVISPFNYPVLLSLDPIAGAIAGGNSVVWKPSELVPATSIILEQ-ILKDSLGSDWI 181

Query: 214 NVLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQIQRTAAVNLKALTLECGGKSPALV-- 271
           +V+ G        + ++   DKI +TGST+VG  +   A  NL   TLE GGKSP  +  
Sbjct: 182 SVVQG-AIPETTKLIKNAQFDKIFYTGSTAVGSIVALEAGKNLVPYTLELGGKSPVFITE 240

Query: 272 -FADADFEQAVRWTAAGIFYNMGQICSGTSRCYVEDSIYDKFVDALAAHVADTYVVGPPS 330
            F+ +    A+     G F N GQ C  +    V  S  ++ V  L   + D +   P  
Sbjct: 241 HFSKSKIRAALSRVYFGAFSNSGQTCVASDYVLVHSS-QEELVKQLTREILDEF--WPQL 297

Query: 331 QSTTRVGPQVSRTQQERVQNYIRKGVE--EGARLVLGGEG-LPETIANDERHRNGFYVRP 387
              T     +     ER  N   K +E   G +++    G LPE             + P
Sbjct: 298 DENTEYTSMI----HERAYNNTVKKLENTNGIKILPSNVGSLPERC-----------IPP 342

Query: 388 TILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL-RLANDSEYGLGSAIFTSDLNRAHKF 446
           T++ DV     + +EE F PV+    +S+ D A+ ++     Y L   IF+ +     + 
Sbjct: 343 TVVFDVDWDDALMKEENFAPVLPFVTYSNLDSAISKVVELHNYPLALYIFSDNRREIDQI 402

Query: 447 ASEVESGICYINSS----NELDPACPFGGIKMSGYGRELGEYGLANFTNVKAV 495
             +++SG C I  +      +D   PFGGI+ SG G   G++  + FT+ + V
Sbjct: 403 MFQIKSGGCVIGDTVIHVAAMD--APFGGIRSSGSGNYHGKWSFSTFTHERTV 453

>YHR037W (PUT2) [2324] chr8 (181969..183696)
           Delta-1-pyrroline-5-carboxylate dehydrogenase (P5C
           dehydrogenase), carries out the second step in proline
           degradation, allows proline to be used as a nitrogen
           source [1728 bp, 575 aa]
          Length = 575

 Score =  110 bits (276), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 115/439 (26%), Positives = 185/439 (42%), Gaps = 38/439 (8%)

Query: 72  WRDTPTTEKRDLLLKLASLVEEEK--EMLAAVESLDSGKPLGSNAIHDVEALAGILKYYA 129
           W + P  ++  + LK A L+  +   +MLAA   L  GK +    I  +  L+   +YY 
Sbjct: 116 WYNLPFYDRSAIFLKAADLISTKYRYDMLAAT-MLGQGKNVYQAEIDCITELSDFFRYYV 174

Query: 130 GWVDKAQGQSYAPSTQ-RLTYTLHQPL-GVVGCIIPFNYPLGMMAWKWTAVATGNTTVFK 187
            +      Q    S         ++PL G V  + PFN+              GNT V+K
Sbjct: 175 KYASDLYAQQPVESADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWK 234

Query: 188 SAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQ 247
            ++   LS      ++  AG P GV N + G    V D +        + FTGST+V + 
Sbjct: 235 PSQTAALSNYLLMTVLEEAGLPKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKS 294

Query: 248 IQ---RTAAVNLK-----ALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGT 299
           +    ++  V  K      +  E GGK+  LV   A+   AV  T  G F   GQ CS  
Sbjct: 295 LYGKIQSGVVEGKYRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFEFQGQKCSAA 354

Query: 300 SRCYVEDSIYDKFVDALAAHVADTYVV------GPPSQSTTR--VGPQVSRTQQERVQNY 351
           SR Y+ +S  ++F+  +   +    VV       P S    R  +GP +     +++   
Sbjct: 355 SRLYLPESKSEEFLSDMFGILQSQNVVPMNTSASPISGGNLRGFMGPVIHEQSFDKLVKV 414

Query: 352 IRKGVEEGARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAV 411
           I    ++    +L G    ++         G++V PT++   +  H     E FGP++ V
Sbjct: 415 IEDAKKDPELEILYGGQYDKS--------QGWFVGPTVIKAKRPDHPYMSTEFFGPILTV 466

Query: 412 SKFSD--YDEALRLA-NDSEYGLGSAIFTSDLNRAHKFASE---VESGICYINS--SNEL 463
            ++ D  ++E   +  N S+Y L  AIF  D  +A ++A E     +G  YIN   +  +
Sbjct: 467 YEYPDTEFNEICDIIDNTSQYALTGAIFAKD-RKAIEYADEKLKFSAGNFYINDKCTGAV 525

Query: 464 DPACPFGGIKMSGYGRELG 482
                FGG +MSG   + G
Sbjct: 526 VSQQWFGGARMSGTDDKAG 544

>CAGL0K03509g complement(326043..327626) similar to sp|Q04458
           Saccharomyces cerevisiae YMR110c aldehyde-dehydrogenase
           like protein, hypothetical start
          Length = 527

 Score =  108 bits (269), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 88/327 (26%), Positives = 136/327 (41%), Gaps = 20/327 (6%)

Query: 156 GVVGCIIPFNYPLGM-MAWKWTAVATGNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFN 214
           G V  I PFN+P+ + +A    A++ GNT + K +E TP   L    +V     P GV  
Sbjct: 126 GNVLVISPFNFPVLLALAPVACALSAGNTVILKPSEMTPHCALVLEDIVKSCQLPEGVLQ 185

Query: 215 VLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQIQRTAAVNLKALTLECGGKSPALV--- 271
           ++ G G      +     +D I +TGS  VG  + + AA NL    LE GGKSP  +   
Sbjct: 186 IVQG-GVEQTTKLINSESLDMIFYTGSPRVGSIVAQAAAKNLVPCVLELGGKSPTFITGS 244

Query: 272 FADADFEQAVRWTAAGIFYNMGQICSGTSRCYVEDSIYDKFVDALAAHVADTYVVGPPSQ 331
               + E A++    G F N GQIC       V +SIYD  V      + + Y   P   
Sbjct: 245 LQKKNLETALKRIFFGAFGNAGQICVSPDYLLVHESIYDDVVKESGKVMKELY---PDLN 301

Query: 332 STTRVGPQVSRTQQERVQNYIRKGVEEGARLVLGGEGLPETIANDERHRNGFYVRPTILA 391
             T     + +   ++    ++K   +G ++      +  T            + PTI+ 
Sbjct: 302 EHTEYTHMIHKASYDKTLEKLQKT--KGRKVSAADVKIDNT-------SGKLMIPPTIVF 352

Query: 392 DVKQSHTVAREEIFGPVIAVSKFSDYDEAL-RLANDSEYGLGSAIFTSDLNRAHKFASEV 450
           D      +  EE F PV+ V K++D D  + ++ +  +  L   IF+          + +
Sbjct: 353 DSDWDDALMEEENFAPVLPVIKYTDIDATIDKILSKHDTPLVQYIFSEKQKEIDHILARL 412

Query: 451 ESGICYINSSNEL--DPACPFGGIKMS 475
            SG C I  +         PFGGI  S
Sbjct: 413 RSGDCIICDTTIHVGIKDAPFGGIGQS 439

>Kwal_23.5714
          Length = 576

 Score =  108 bits (270), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 118/458 (25%), Positives = 188/458 (41%), Gaps = 51/458 (11%)

Query: 72  WRDTPTTEKRDLLLKLASLVEEEK--EMLAAVESLDSGKPLGSNAIHDVEALAGILKYYA 129
           W   P  ++  + LK A L+  +   +MLAA   L  GK +    I  +  LA   ++  
Sbjct: 116 WYKMPFYDRAAVFLKAADLISTKYRYDMLAAT-MLGQGKNVYQAEIDCITELADFFRFNV 174

Query: 130 GWVDKAQGQSYAPSTQRL-TYTLHQPL-GVVGCIIPFNYPLGMMAWKWTAVATGNTTVFK 187
            +  +   Q    S+  +     ++PL G V  + PFN+              GNT V+K
Sbjct: 175 KYASELYNQQPCESSPGVWNKAEYRPLEGFVYAVTPFNFTAISGNLIGAPALMGNTVVWK 234

Query: 188 SAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQ 247
            ++   LS      ++  AG P GV N + G    V DA+        + FTGST+V +Q
Sbjct: 235 PSQAACLSNYLLLTVLEEAGLPHGVVNFIPGNPVEVTDAVLADKEFAALHFTGSTAVFKQ 294

Query: 248 ----IQRTAAVNL----KALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGT 299
               IQ+    +L      +  E GGK+  LV   A    AV  T  G F   GQ CS  
Sbjct: 295 LYGKIQQGVVNDLYRDYPRIVGETGGKNFHLVHPSASIPHAVLSTLRGAFEYQGQKCSAA 354

Query: 300 SRCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTT------RVGPQVSRTQQERVQNYIR 353
           SR Y+  S   +F++ LA  + +   V   +           +GP + +   E++ N + 
Sbjct: 355 SRLYLPASRSAEFLEDLAGTLKEVRTVNTSASKLNGGDLHGFMGPVIHQQSFEKLANALE 414

Query: 354 KGVEEGA-RLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVS 412
           +   +    ++ GGE             NG+++ PT++      H     E FGP++ V 
Sbjct: 415 EAKNDPELEIICGGEC---------DKSNGWFIEPTVVKTTNPLHKFMSTEFFGPLLTVC 465

Query: 413 KFSDYD---EALRLANDSEYGLGSAIFTSDLNRAHKFASE---VESGICYINSSNELDPA 466
           ++ D +       +   + YGL  A+F  D + A   A E     +G  YIN        
Sbjct: 466 EYPDAEFTQVCETIDKTTSYGLTGAVFARDRD-AIAIADEKLKYSAGNFYINDK------ 518

Query: 467 CP--------FGGIKMSGYGRELGEYG-LANFTNVKAV 495
           C         FGG +MSG   + G    L+ F +++ V
Sbjct: 519 CTGAVVGQQWFGGARMSGTDDKAGSGNILSRFVSIRNV 556

>Scas_717.74
          Length = 522

 Score =  106 bits (265), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 93/324 (28%), Positives = 145/324 (44%), Gaps = 23/324 (7%)

Query: 156 GVVGCIIPFNYPLGM-MAWKWTAVATGNTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFN 214
           G V  I PFN+P+ + +     A+  GN+ + K +E+T  + L   +++  AGFP G+  
Sbjct: 125 GNVLVISPFNFPVLLALVPVAHAIGAGNSVILKPSERTAHTALVMQRIIEEAGFPDGLVQ 184

Query: 215 VLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQIQRTAAVNLKALTLECGGKSPALV--- 271
           V+ G        +     +D I +TGS +VG  I + AA NL    LE GGKSP  +   
Sbjct: 185 VVQG-AIDETQRLITSKDLDMIFYTGSPTVGSIIAQEAAKNLTPCVLELGGKSPTFITEN 243

Query: 272 FADADFEQAVRWTAAGIFYNMGQICSGTSRCYVEDSIYDKFVDALAAHVADTYVVGPPSQ 331
           F D + + A++    G F N GQIC       V +S Y+K V ALA  V     + P   
Sbjct: 244 FNDKNLKTALKRIFFGAFGNSGQICVSPDYLLVHESKYNK-VAALAKEVL--IEMFPEVN 300

Query: 332 STTRVGPQVSRTQQERVQNYIRKGVEEGARLVLGGEGLPETIANDERHRNGFYVRPTILA 391
            +T     +S T      N   K +E  +     GE      A  +       V PT++ 
Sbjct: 301 DSTEFTHLISET----AYNTTLKKLEATS-----GEKFQ---AKSDLSDTNICVPPTLIF 348

Query: 392 DVKQSHTVAREEIFGPVIAVSKFSDYDEAL-RLANDSEYGLGSAIFTSDLNRAHKFASEV 450
           + +   +  ++E F P++ V K+S+ D+ L ++       L   IF+            +
Sbjct: 349 NCQWEDSTMQQENFAPILPVLKYSNLDDTLDKIIATHNNPLVQYIFSDSNEEISHILLRL 408

Query: 451 ESGICYINSS--NELDPACPFGGI 472
           +SG C IN +  +      PFGGI
Sbjct: 409 KSGDCVINDTILHVGIQDAPFGGI 432

>Scas_690.41
          Length = 581

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 114/439 (25%), Positives = 178/439 (40%), Gaps = 50/439 (11%)

Query: 72  WRDTPTTEKRDLLLKLASLVEEEK--EMLAAVESLDSGKPLGSNAIHDVEALAGILKYYA 129
           W   P  ++  + LK A L+  +   +MLAA   L  GK +    I  +  L+   ++  
Sbjct: 123 WYQLPFYDRAAVFLKAADLISTKYRYDMLAAT-MLGQGKNVYQAEIDCITELSDFFRFNV 181

Query: 130 GWVDKAQGQSYAPSTQRL-TYTLHQPL-GVVGCIIPFNYPLGMMAWKWTAVATGNTTVFK 187
            +           S Q +     ++PL G +  + PFN+              GNT ++K
Sbjct: 182 KYAHDLYNLQPVQSAQGVWNKAEYRPLEGFIYAVSPFNFTAIAANLIGAPALMGNTVIWK 241

Query: 188 SAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQ 247
            ++   LS      ++  AG P GV N + G    V D +        + FTGST V +Q
Sbjct: 242 PSQSAALSNYLLLTVLEEAGLPKGVINFVPGDPILVTDQLLASKEFGGLHFTGSTQVFKQ 301

Query: 248 IQ---RTAAVN-----LKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGT 299
           +    +T  VN        +  E GGK+  L+   A+   AV  T  G F   GQ CS T
Sbjct: 302 LYGKIQTGVVNGLYRDYPRIVGETGGKNFHLIHKSANIPNAVFSTIRGAFEFQGQKCSAT 361

Query: 300 SRCYVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRV---------GPQVSRTQQERVQN 350
           SR Y+  S  ++F   L   +    V  P + + + +         GP +     E+  N
Sbjct: 362 SRLYIPQSKSEEFFRDLIGTLQQQKVT-PVNTAASPISGGDLHGFMGPVI----HEQSYN 416

Query: 351 YIRKGVEEGA-----RLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIF 405
            + K +EE        ++ GG+              G++V PTI+      H     E F
Sbjct: 417 KLIKVIEEAKTDPELEIIYGGQ---------YDKGEGWFVGPTIIKCKDPKHKFMTTEFF 467

Query: 406 GPVIAVSKFSD--YDEALRLAND-SEYGLGSAIFTSDLNRAHKFASEVESGIC---YINS 459
           GP+++V ++ D  + E   L +  S YGL  ++F  D   A   A E     C   YIN 
Sbjct: 468 GPILSVYEYPDNKFSETCDLIDQTSMYGLTGSVFAKD-REAINLADEKLKFSCGNFYIND 526

Query: 460 --SNELDPACPFGGIKMSG 476
             +  +     FGG +MSG
Sbjct: 527 KCTGAVVAQQWFGGARMSG 545

>YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protein
           with similarity to aldehyde dehydrogenases [1599 bp, 532
           aa]
          Length = 532

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 113/437 (25%), Positives = 187/437 (42%), Gaps = 37/437 (8%)

Query: 79  EKRDLLLK--LASLVEEEKEMLAA---------VES-LDSGKPLGSNAIHDVEALAGILK 126
           E R L LK    ++ + E+E++ A         +ES L+    L ++ +H +E L  ++K
Sbjct: 47  EFRQLQLKKLYYAVKDHEEELIDAMYKDFHRNKIESVLNETTKLMNDILHLIEILPKLIK 106

Query: 127 YYAGWVDKAQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWTAVAT-GNTTV 185
                  +    S  P     T       G V  I PFN+PL +      A    GNT V
Sbjct: 107 ------PRRVSDSSPPFMFGKTIVEKISRGSVLIIAPFNFPLLLAFAPLAAALAAGNTIV 160

Query: 186 FKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGSTSVG 245
            K +E TP + +    L+  AGFP G+  V+ G        +      D I +TGS  VG
Sbjct: 161 LKPSELTPHTAVVMENLLTTAGFPDGLIQVVQG-AIDETTRLLDCGKFDLIFYTGSPRVG 219

Query: 246 QQIQRTAAVNLKALTLECGGKSPALV---FADADFEQAVRWTAAGIFYNMGQICSGTSRC 302
             +   AA +L    LE GGKSP  +   F  ++ + A++    G F N GQIC      
Sbjct: 220 SIVAEKAAKSLTPCVLELGGKSPTFITENFKASNIKIALKRIFFGAFGNSGQICVSPDYL 279

Query: 303 YVEDSIYDKFVDALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARL 362
            V  SIY K +    + + + Y   P     T     +     ++    I      G+++
Sbjct: 280 LVHKSIYPKVIKECESVLNEFY---PSFDEQTDFTRMIHEPAYKKAVASINST--NGSKI 334

Query: 363 VLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEAL- 421
           V      P  I+ +    +   V PTI+ ++     + ++E F PV+ + ++ D DE + 
Sbjct: 335 V------PSKISINSDTEDLCLVPPTIVYNIGWDDPLMKQENFAPVLPIIEYEDLDETIN 388

Query: 422 RLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSS--NELDPACPFGGIKMSGYGR 479
           ++  + +  L   IF+      ++  + + SG C +  +  +      PFGGI  SGYG 
Sbjct: 389 KIIEEHDTPLVQYIFSDSQTEINRILTRLRSGDCVVGDTVIHVGITDAPFGGIGTSGYGN 448

Query: 480 ELGEYGLANFTNVKAVY 496
             G YG   F++ + ++
Sbjct: 449 YGGYYGFNTFSHERTIF 465

>YOL157C (YOL157C) [4668] chr15 complement(22524..24293) Protein
           with high similarity to maltase (alpha-glucosidase, S.
           cerevisiae Mal32p), which is involved in starch
           catabolism, contains an alpha amylase N-terminal
           catalytic domain, which degrade branched and unbranched
           starches [1770 bp, 589 aa]
          Length = 589

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 49/113 (43%), Gaps = 14/113 (12%)

Query: 259 LTLECGGKSPALVFADADFEQAVRWTAAGIFYNMG----QICSGTSRCYVEDSIYDKFVD 314
           L L C  + P L + + D  +A+  +A G + + G    +I  G        S+Y K   
Sbjct: 175 LRLFCSTQ-PDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVG--------SLYSKVAG 225

Query: 315 ALAAHVADTYVVGPPSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARLVLGGE 367
              A V D      PS   T  GP++    QE +  +IR  V++G  ++  GE
Sbjct: 226 LPDAPVIDENSKWQPSDPFTMNGPRIHEFHQE-MNKFIRNRVKDGREIMTVGE 277

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,945,747
Number of extensions: 601503
Number of successful extensions: 1732
Number of sequences better than 10.0: 61
Number of HSP's gapped: 1511
Number of HSP's successfully gapped: 63
Length of query: 496
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 390
Effective length of database: 12,926,601
Effective search space: 5041374390
Effective search space used: 5041374390
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)