Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.348850249526410.0
Sklu_2101.356847916900.0
CAGL0F07799g58043713960.0
ADL279W49342313740.0
KLLA0D10065g46644713690.0
YMR171C55046113001e-175
Scas_669.1058550912371e-165
Sklu_2430.75393653386e-34
YKL124W (SSH4)5793543281e-32
Kwal_26.76655513593253e-32
KLLA0B12760g5422303202e-31
ABL026W4803383137e-31
CAGL0M06545g5873622954e-28
Scas_721.1265732132751e-25
CAGL0I04114g910125820.071
AFR242C82361740.60
Scas_712.2397371730.85
Kwal_47.1917383671730.88
AER037C246129701.2
YGL227W (VID30)95842692.5
AAR073W120861683.1
CAGL0L10736g342102673.2
Kwal_23.573162159674.2
YDL147W (RPN5)44530639.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3488
         (495 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3488                                                         1021   0.0  
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                           655   0.0  
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...   542   0.0  
ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....   533   0.0  
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...   531   0.0  
YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...   505   e-175
Scas_669.10                                                           481   e-165
Sklu_2430.7 YKL124W, Contig c2430 12905-14524                         134   6e-34
YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confer...   130   1e-32
Kwal_26.7665                                                          129   3e-32
KLLA0B12760g 1114942..1116570 some similarities with sp|P32343 S...   127   2e-31
ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH] complement(3...   125   7e-31
CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces c...   118   4e-28
Scas_721.126                                                          110   1e-25
CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces c...    36   0.071
AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH] (873480..8...    33   0.60 
Scas_712.23                                                            33   0.85 
Kwal_47.19173                                                          33   0.88 
AER037C [2542] [Homologous to ScYBR153W (RIB7) - SH] (703668..70...    32   1.2  
YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulate...    31   2.5  
AAR073W [259] [Homologous to NOHBY] complement(475533..479159) [...    31   3.1  
CAGL0L10736g complement(1143245..1144273) some similarities with...    30   3.2  
Kwal_23.5731                                                           30   4.2  
YDL147W (RPN5) [721] chr4 (190925..192262) Non-ATPase subunit of...    29   9.6  

>Kwal_23.3488
          Length = 502

 Score = 1021 bits (2641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/495 (100%), Positives = 495/495 (100%)

Query: 1   MFLVKSSRGYLGAVLLSVLWIKKASCGYVPSQSDGQHFVGSGPYDGDYEDDLDIGLMMFS 60
           MFLVKSSRGYLGAVLLSVLWIKKASCGYVPSQSDGQHFVGSGPYDGDYEDDLDIGLMMFS
Sbjct: 1   MFLVKSSRGYLGAVLLSVLWIKKASCGYVPSQSDGQHFVGSGPYDGDYEDDLDIGLMMFS 60

Query: 61  LAFMVFSYFALTLVYLVVKFLLRRYFRTGISLSEGESRVIGPAVNARWPSALDDADAVRD 120
           LAFMVFSYFALTLVYLVVKFLLRRYFRTGISLSEGESRVIGPAVNARWPSALDDADAVRD
Sbjct: 61  LAFMVFSYFALTLVYLVVKFLLRRYFRTGISLSEGESRVIGPAVNARWPSALDDADAVRD 120

Query: 121 KLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIINEQTLQFIDEEGAHAWE 180
           KLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIINEQTLQFIDEEGAHAWE
Sbjct: 121 KLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIINEQTLQFIDEEGAHAWE 180

Query: 181 FQPDPKLPNDSVLVENKSEITFLNYNYDVSVMTNLPIPRLNRVYYCEFKIFELNTAGSNN 240
           FQPDPKLPNDSVLVENKSEITFLNYNYDVSVMTNLPIPRLNRVYYCEFKIFELNTAGSNN
Sbjct: 181 FQPDPKLPNDSVLVENKSEITFLNYNYDVSVMTNLPIPRLNRVYYCEFKIFELNTAGSNN 240

Query: 241 NSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSPELASIFPRCEKG 300
           NSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSPELASIFPRCEKG
Sbjct: 241 NSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSPELASIFPRCEKG 300

Query: 301 DVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGTYG 360
           DVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGTYG
Sbjct: 301 DVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGTYG 360

Query: 361 FVFIEANVKKWGYAKSNGMKLPPPSYEDYSQDVLLESSYEDDATDNESTSTIDGDIIDSE 420
           FVFIEANVKKWGYAKSNGMKLPPPSYEDYSQDVLLESSYEDDATDNESTSTIDGDIIDSE
Sbjct: 361 FVFIEANVKKWGYAKSNGMKLPPPSYEDYSQDVLLESSYEDDATDNESTSTIDGDIIDSE 420

Query: 421 GHLLPPPPGFEYSVSPQPSAAGQFTLNSLPPEPPRYASDTPEDAEEAETGQQLEQLAHDV 480
           GHLLPPPPGFEYSVSPQPSAAGQFTLNSLPPEPPRYASDTPEDAEEAETGQQLEQLAHDV
Sbjct: 421 GHLLPPPPGFEYSVSPQPSAAGQFTLNSLPPEPPRYASDTPEDAEEAETGQQLEQLAHDV 480

Query: 481 EEGNEIYAGNELGKN 495
           EEGNEIYAGNELGKN
Sbjct: 481 EEGNEIYAGNELGKN 495

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/479 (66%), Positives = 386/479 (80%), Gaps = 12/479 (2%)

Query: 16  LSVLWIKKASCGYVPSQSDGQHFVGSGPYDGDYEDDLDIGLMMFSLAFMVFSYFALTLVY 75
           + + +I K + G   S+        +  +  DYEDD+D+ ++ FS+AFM+ SY  LTL+Y
Sbjct: 64  IVLAFIPKLTIGAPISEGTYSEHPSAPGFQDDYEDDMDMAMLFFSMAFMLLSYILLTLIY 123

Query: 76  LVVKFLLRRYFRTGISLSEGESRVIGPAVNARWPSALDDADAVRDKLARMSAEEQFYYKQ 135
             V+F++++YF T ISL+   S  I    +  WPS+LDD +AV+DKL ++S EEQFYYKQ
Sbjct: 124 FSVRFVIKKYFSTRISLNNNNSPNIRTTTSNSWPSSLDDEEAVKDKLVKLSPEEQFYYKQ 183

Query: 136 GEEFIKQNPPLLLPDRSPVGAETVDPIINEQTLQFIDEEGAHAWEFQPDPKLPNDSVLVE 195
           GEE+IKQNPPLL+P RS      +DPIIN+QT++FI+EEG HAWEFQPDP LPND++L+E
Sbjct: 184 GEEYIKQNPPLLIPHRSEDSQGMLDPIINDQTIRFIEEEGVHAWEFQPDPNLPNDTILIE 243

Query: 196 NKSEITFLNYNYDVSVMTNLPIPRLNRVYYCEFKIFELNTAGSNNNS-SQNEMLSFGLST 254
           NK+EITFLNYNYD SVMTNLP+PR+NRVYY E KIFELNT+ S+NN  S NEM+SFGLS+
Sbjct: 244 NKTEITFLNYNYDASVMTNLPVPRVNRVYYFECKIFELNTSRSDNNYLSDNEMISFGLSS 303

Query: 255 SPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTV 314
           SPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELS ELASIFPR +KGD+IGIGYRTNSGTV
Sbjct: 304 SPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTV 363

Query: 315 FFTRNGKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGTYGFVFIEANVKKWGYA 374
           FFTRNGKKLNEK IGGHIKGWK KY+YPIVG+N+PCKVHVNFG+YGFVFIEANVKKWGYA
Sbjct: 364 FFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNFGSYGFVFIEANVKKWGYA 423

Query: 375 KSNGMKLPPPSYEDYSQDVLLESSYEDDATDNESTSTIDGDIIDSEGHLLPPPPGFEYSV 434
           KS+G+KLPPPSY++Y QDVLLESSYEDD TDNES ST++GDI+DS+G LLPPPPGFE+S 
Sbjct: 424 KSHGVKLPPPSYDEYGQDVLLESSYEDDITDNESVSTVEGDIVDSDGELLPPPPGFEFST 483

Query: 435 SPQP--SAAGQFTLNSLPPEPPRYASD------TPEDAEEAETGQQLEQLAHDVEEGNE 485
           +PQ   +   Q TL+SLP +PP Y+SD        E+ +E ET QQL+Q+   VEE  E
Sbjct: 484 TPQSRGNIGDQITLDSLPAQPPSYSSDDDIRGEHEENVDEEETAQQLQQI---VEERGE 539

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/437 (60%), Positives = 320/437 (73%), Gaps = 26/437 (5%)

Query: 49  EDDLDIGLMMFSLAFMVFSYFALTLVY----LVVKFLLRRYFRTGISLSEG-------ES 97
           +D LDI +M      M+  Y  + ++Y    +VV  LL R+ R  +   EG        S
Sbjct: 63  DDQLDINVMFIYFGSMLVMYLCICIIYFTTKIVVTRLLTRHARISLLNEEGMATGLSARS 122

Query: 98  RVIGPAVNARWPSALDDADAVRDKLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAE 157
           R +  +  +RWPSALDD + V+ KL ++S EEQFYYKQGEE+IKQNPPL++   S  G +
Sbjct: 123 RRLAESAESRWPSALDDENEVKSKLQKLSPEEQFYYKQGEEYIKQNPPLIISTGSRSGDQ 182

Query: 158 TV--DPIINEQTLQFIDEEGAHAWEFQPDPKLPNDSVLVENKSEITFLNYNYDVSVMTNL 215
               DPIIN+QT QFI+EEGA AWEFQP+P LPND+++VENK+EI+FLNYNYD SV TNL
Sbjct: 183 NTVNDPIINDQTRQFIEEEGALAWEFQPNPNLPNDTIIVENKTEISFLNYNYDASVTTNL 242

Query: 216 PIPRLNRVYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDST 275
           PIP +NRVYYCEFKIFEL+          NE++SFGLSTSPYPYFRLPGRHHHSIAYDS 
Sbjct: 243 PIPCINRVYYCEFKIFELSITDDQTTLKDNEIISFGLSTSPYPYFRLPGRHHHSIAYDSN 302

Query: 276 GGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGW 335
           G RRFNDSF+L PELA +FP+C+KGD+IGIGYRT SGTVFFTRNGKK++EKS+GGHIKGW
Sbjct: 303 GARRFNDSFKLEPELADLFPKCQKGDIIGIGYRTRSGTVFFTRNGKKISEKSVGGHIKGW 362

Query: 336 KFKYVYPIVGSNIPCKVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSYEDYSQDVLL 395
           KFKY+YP+VG+N+PCK+HVNFG+YGFVFIEANVKKWGYAK NG+KLPPPSY+DY QD LL
Sbjct: 363 KFKYLYPVVGANVPCKIHVNFGSYGFVFIEANVKKWGYAKPNGIKLPPPSYDDYVQDTLL 422

Query: 396 ESSY------------EDDATDNESTSTIDGDIIDSEGHLLPPPPGFEYSVSPQPSAAG- 442
           ES Y            E D  +     +I   IID +G+LLPPPPGFE+S SP       
Sbjct: 423 ESGYEDNDNSDNDSDDESDTDNRRQHRSIKNTIIDIDGNLLPPPPGFEFSTSPHSHGTNE 482

Query: 443 QFTLNSLPPEPPRYASD 459
           +  L+SLP  PP Y+ +
Sbjct: 483 EINLDSLPMNPPSYSDE 499

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/423 (62%), Positives = 324/423 (76%), Gaps = 16/423 (3%)

Query: 47  DYEDDLDIGLMMFSLAFMVFSYFALTLVYLVVKFLLRRYFRTGISLSEGESRVIGPAVNA 106
           D E D+D  L  FSL FM+  Y  + L+YL +++++RR F   I+LS  +S     A + 
Sbjct: 34  DNELDMDFVLFTFSLVFMLLCYGMMVLIYLGLRYVVRRCFTRRIALSSSDSSR---ANSG 90

Query: 107 RWPSALDDADAVRDKLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVG-------AETV 159
             P+ LDD   VR KLA++S EEQFYYKQGEEFIKQNPP L+P ++  G       A+  
Sbjct: 91  DVPTVLDDELEVRHKLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPADVF 150

Query: 160 DPIINEQTLQFIDEEGAHAWEFQPDPKLPNDSVLVENKSEITFLNYNYDVSVMTNLPIPR 219
           DP+IN+QTL++I+EEGA AWEFQP P LP D V VEN++E+TF+N N DVSV TNLPIP 
Sbjct: 151 DPVINDQTLRYIEEEGAQAWEFQPSPSLPPDFVKVENRTELTFMNSNSDVSVATNLPIPL 210

Query: 220 LNRVYYCEFKIFEL--NTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDSTGG 277
            N+VYY E KIFEL        ++ S+N+++SFGL+TSPYPYFRLPGRHHHS+AYDS G 
Sbjct: 211 ANKVYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNGA 270

Query: 278 RRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKF 337
           RR N+SF+L  EL+S+FPRCEKGDVIGIGYRT SGTVFFTRNGKKLNEK IGGHIKGWK 
Sbjct: 271 RRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWKI 330

Query: 338 KYVYPIVGSNIPCKVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSYEDYSQDVLLES 397
           KY+YPIVG+N+PCK+HVNFGTYGFV+IEANVKKWGYAK NGMKLPPP+YEDY +DVLLES
Sbjct: 331 KYLYPIVGANVPCKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAYEDYDRDVLLES 390

Query: 398 SYEDDATDNESTSTIDGDIIDSEGHLLPPPPGFEYSVSPQPSAAGQFTLNSLPPEPPRYA 457
           SYED+ ++ E+ S ++      +GHLLPPPPGFE+S +P  S   QFTLN+LP EPP Y 
Sbjct: 391 SYEDEVSEGETNSFVEH---LHDGHLLPPPPGFEFSTTPT-SNCDQFTLNTLPTEPPGYM 446

Query: 458 SDT 460
           SD 
Sbjct: 447 SDV 449

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 329/447 (73%), Gaps = 10/447 (2%)

Query: 24  ASCGYVPSQSDGQHFVGSGPYDGDYEDDLDIGLMMFSLAFMVFSYFALTLVYLVVKFLLR 83
           A  G+    +   H   +   +G  + D+D+ L++F++ FM  SY    LVY V ++L++
Sbjct: 7   ARHGHKSKMAHKHHGDSAHVSEGPSDPDVDMDLIVFTMMFMFLSYLLSILVYFVTRWLVK 66

Query: 84  RYFRTGISLSEGESRVIGPAVNARWPSALDDADAVRDKLARMSAEEQFYYKQGEEFIKQN 143
           R F   ISL E E  + G   +      LDD   V++ L  +S +EQFYYKQGEE++KQN
Sbjct: 67  RLFTARISLHE-EGTMNGGQSDLSEDRYLDDESEVKEFLQNLSPKEQFYYKQGEEYVKQN 125

Query: 144 PPLLLP--DRSPVGAETV--DPIINEQTLQFIDEEGAHAWEFQPDPKLPNDSVLVENKSE 199
           PPLL+P     P   E V  DPI+NEQTLQFI+EEGA AWEFQ DP LPND+V+++ ++E
Sbjct: 126 PPLLVPYLPNDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMIQERTE 185

Query: 200 ITFLNYNYDVSVMTNLPIPRLNRVYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPY 259
           +TFLN++YD SVMT LPIPRLN+VYY E KIFELN     N+ S NEM+S GLSTSPYPY
Sbjct: 186 LTFLNFSYDASVMTTLPIPRLNKVYYYECKIFELNQG--KNHLSDNEMISIGLSTSPYPY 243

Query: 260 FRLPGRHHHSIAYDSTGGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRN 319
           FRLPGRHHHSI+YDS G RR N SF +S EL ++FPR EKGDVIGIGYRT SGT+FFT N
Sbjct: 244 FRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHN 303

Query: 320 GKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGTYGFVFIEANVKKWGYAKSNGM 379
           GKKLNEK +GGHIKGWK KY+YPIVGSNIPCK+HVNFGTYGFV+IEANVKKWGY+K+ G+
Sbjct: 304 GKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKNAGI 363

Query: 380 KLPPPSYEDYSQDVLLESSYEDDATDNESTS--TIDGDIIDSEGHLLPPPPGFEYSVSPQ 437
           KLPPPSYEDY QDVLLES++EDD +D+ES +  +I+  I D  G++LPPPPGFE+S S  
Sbjct: 364 KLPPPSYEDYDQDVLLESAFEDDVSDSESITSDSINEQITDQSGNILPPPPGFEFSTSVA 423

Query: 438 PSA-AGQFTLNSLPPEPPRYASDTPED 463
                   T++SLP EPP Y++D  E+
Sbjct: 424 SDIPVESITMHSLPAEPPNYSADEDEE 450

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score =  505 bits (1300), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 257/461 (55%), Positives = 330/461 (71%), Gaps = 43/461 (9%)

Query: 40  GSGPYDGDYEDDLDIGLMMFSLAFMVFSYFALTLVYLVVKFLLRR-----YFRTG----I 90
           G   Y GD  D+L++ +M+F+   ++  Y  + +VY   K +  R     Y   G    I
Sbjct: 30  GDVSYGGDDTDELNMDIMLFAFGTLIVVYIVICIVYFFTKQIATRLITAYYNEHGPGQRI 89

Query: 91  SL--------SEGESRVIGPAVNARWPSALDDADAVRDKLARMSAEEQFYYKQGEEFIKQ 142
           SL        +   SR +   ++ RWP+ LDDAD VRDKLA++S EEQFYYKQGEE+IKQ
Sbjct: 90  SLFSDYDENNAHVHSRRLMENMSLRWPNNLDDADEVRDKLAQLSPEEQFYYKQGEEYIKQ 149

Query: 143 NPPLLL--------PDRSPVGAETVDPIINEQTLQFIDEEGAHAWEFQPDPKLPNDSVLV 194
           NPP LL         D +P      DPI+NEQT Q+I EEGA+AWEF P+P +PN +V+V
Sbjct: 150 NPPFLLNQGLLQQSEDSNPDTTRE-DPIMNEQTRQYIQEEGAYAWEFSPNPDMPNHTVIV 208

Query: 195 ENKSEITFLNYNYDVSVMTNLPIPRLNRVYYCEFKIFELNTAGSNNNSSQNEMLSFGLST 254
           ENK+E++FLNYNYD S+ TNLPIP +N+VYYCEFKIFE +   +++ +    ++SFGLST
Sbjct: 209 ENKTEVSFLNYNYDASISTNLPIPCINKVYYCEFKIFETDGPLNSDENVSKGVISFGLST 268

Query: 255 SPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTV 314
            PYPYFRLPGRHHHSIAYDS G RRFNDSF+L+ +L ++FP+CEKGD++GIGYR+ SGTV
Sbjct: 269 QPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTV 328

Query: 315 FFTRNGKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGTYGFVFIEANVKKWGYA 374
           FFTRNGKKLNEKS+GGHI+GWKF+Y+YPI+GSN+PC++HVNFGTYGFV+IEANVKKWGYA
Sbjct: 329 FFTRNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGTYGFVYIEANVKKWGYA 388

Query: 375 KSNGMKLPPPSYEDYSQDVLLESSYEDDATDNE------------STSTIDGDIIDSEGH 422
           KSNG+KLPPPSYEDY +D LLES  ED+  D +            ST+ ++ DII   G 
Sbjct: 389 KSNGIKLPPPSYEDYGKDTLLESGGEDNDFDEDFSDGDSDNIAAGSTTNLNDDIIIRNGE 448

Query: 423 LLPPPPGFEYSVSPQPSAAG----QFTLNSLPPEPPRYASD 459
           +LPPPPGFE+++SP P+       +  L+SLP  PP Y+ D
Sbjct: 449 ILPPPPGFEFTMSP-PTGKKIINEEINLDSLPMLPPSYSDD 488

>Scas_669.10
          Length = 585

 Score =  481 bits (1237), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 275/509 (54%), Positives = 342/509 (67%), Gaps = 65/509 (12%)

Query: 13  AVLLSVL--WIKKASCGYVPSQS--DGQHFVGSG-PYDGDYEDDLDIGLMMFSLAFMVFS 67
           A LL +L  W+ +   GYV  +     +  +G+  PY+ D ++D+D  +M+FSL  M+  
Sbjct: 6   ATLLQLLTFWLCQRVNGYVIPRDLPHSEESIGTPYPYEDDKDEDVDFHVMLFSLITMIII 65

Query: 68  YFALTLVYLVVKFLLRRYFRTGIS----LSEGESRVIGPAVNAR---------------W 108
           Y  + LVY+VVKF++ R   + IS    L+  E        N                  
Sbjct: 66  YVLVILVYIVVKFVVTRMLTSNISRISLLNRTEVEESTRTNNEGTGRSRRSTRRDQRFDL 125

Query: 109 PSALDDADAVRDKLARMSAEEQFYYKQGEEFIKQNPPLLLPDR----------SPVGAET 158
            S LDD + V+ KL+ ++ EEQFYYKQGEEFIKQNPP+++P            +   AE 
Sbjct: 126 ESFLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQNPPIIIPPNNNNNSNDISTTDSNAED 185

Query: 159 VDPIINEQTLQFIDEEGAHAWEFQPDPKLPNDSVLVENKSEITFLNYNYDVSVMTNLPIP 218
            DPI+N QT QFI+EEGA AWEFQ DP LPND++L+ENK+EITFLNYNYD SVMTNLPIP
Sbjct: 186 -DPIMNHQTKQFIEEEGASAWEFQADPNLPNDTILIENKTEITFLNYNYDASVMTNLPIP 244

Query: 219 RLNRVYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDSTGGR 278
            +NRVYYCEFKIFELN +    N S NE++S GL+TSPYPYFRLPGRHHHSIAYDS G R
Sbjct: 245 CINRVYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDSNGAR 304

Query: 279 RFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFK 338
           RFNDSF L PELA++FP CE+GD+IG+GYRT SGT FFTRNGKK++EKSIGGHIKG K K
Sbjct: 305 RFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGCKIK 364

Query: 339 YVYPIVGSNIPCKVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSYEDYSQDVLLESS 398
           Y+YPIVG+N+PCKVHVNFGTYGFV+IEANVKKWGYAKS+G+K+PPPSYE+Y +D L+  S
Sbjct: 365 YLYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSYEEYGKDALV-GS 423

Query: 399 YED-----------------------DATDNESTSTIDGDIIDSEGHLLPPPPGFEYSVS 435
           Y+D                          ++++T+T    + D  G LLPPPPGFE+S S
Sbjct: 424 YQDLEDGINDEEEDYEDEEEEDEEEDYDEEDDNTTTETDPLRDEYGQLLPPPPGFEFSTS 483

Query: 436 PQPSAAGQ-----FTLNSLPPEPPRYASD 459
           P  S  GQ       LNSLP +PPRY+ D
Sbjct: 484 PL-SNFGQNEEEDINLNSLPYDPPRYSQD 511

>Sklu_2430.7 YKL124W, Contig c2430 12905-14524
          Length = 539

 Score =  134 bits (338), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 110/365 (30%), Positives = 164/365 (44%), Gaps = 99/365 (27%)

Query: 109 PSALDDADAV--------RDKLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVD 160
           P   DD  AV        +DK ++   E    Y++ +EF K NPP++          T  
Sbjct: 107 PGKFDDEQAVQEQEDECFKDKFSKFEIE---LYQRAKEFQKVNPPIV------KSFGTYT 157

Query: 161 PIINEQTLQFIDEEGAHAWEFQPDPK---------LPNDSVLVENKSEITFLNYNYDVSV 211
           P+ ++Q    I + G  ++ F P            LP  S L+++K +I F  YN   S 
Sbjct: 158 PLKDKQ---LIKDRGIQSYYFLPSINDNLDKAGNFLP--SFLIQDKLDIEFTKYNKSSSA 212

Query: 212 MTNLPIP--RLNRVYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHS 269
           + N P+P  R + VY+ E K+F+         S  N + + GL T PYPYFR+PG + HS
Sbjct: 213 IMNFPLPYNRKDAVYF-EVKVFKYP-------SKSNSIFTIGLITPPYPYFRMPGYNKHS 264

Query: 270 IAYDSTGGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKK------- 322
           IAY+STG  R ++ F  +    ++ P+ E+GDV+G GYR  SGT+F T NGKK       
Sbjct: 265 IAYESTGKLRISNPFYAN----TLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTEN 320

Query: 323 ---------------------------------LNEKSIGGHIK---------GWKFKYV 340
                                            L+E+ +   +            + + V
Sbjct: 321 IGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQLERV 380

Query: 341 YPIVGSNIP---CKVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSY--EDYSQDVLL 395
           +     +IP    ++ VN G  GFVFIEANVKK+ +    G    PPSY  ++  QD +L
Sbjct: 381 HDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTVL 440

Query: 396 ESSYE 400
           +   E
Sbjct: 441 QKGEE 445

>YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confers
           resistance to immunosuppressive drug leflunomide upon
           overproduction [1740 bp, 579 aa]
          Length = 579

 Score =  130 bits (328), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 104/354 (29%), Positives = 157/354 (44%), Gaps = 83/354 (23%)

Query: 109 PSALDDADAVRDK----LARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIIN 164
           P   DD   ++++    L +MSA E   Y + +EF   +PP++         +     ++
Sbjct: 113 PGGFDDEIVLQERELEELPKMSAYEVELYIRAKEFQMMSPPMV---------KDFGTYLD 163

Query: 165 EQTLQFIDEEGAHAWEFQPDPKLPND-------SVLVENKSEITFLNYNYDVSVMTNLPI 217
               QFI + G  ++   P      D       S +V++K +I F  +N   S + N P+
Sbjct: 164 SDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLPSFIVQDKLDIQFSKFNKSSSTVMNYPL 223

Query: 218 P--RLNRVYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDST 275
           P  R + VY+ E KIF        +    N + S GL+T PYPYFR+PG   +SIAY+ST
Sbjct: 224 PHNRKDAVYF-EVKIFR-------HIQKSNSIFSIGLTTVPYPYFRVPGMAKYSIAYEST 275

Query: 276 GGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKKLNEKS-------- 327
           G  R N+ F  S    ++ P+ E+GD +G GYR  +GT+F T NGKKL + +        
Sbjct: 276 GKLRINNPFTAS----TLLPKLEEGDTVGFGYRYKTGTIFITHNGKKLMDVTQNIGIDLF 331

Query: 328 --IGGHIKGWKFKYVYPIV---------------GSNIPC-------------------- 350
             IG     +   Y    +               G +I                      
Sbjct: 332 IGIGAFNAAYTRTYTRDGLLEDPDNVSFREALSEGKDIEVAKDLQRVHDPHDESDEMTSD 391

Query: 351 --KVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSYE--DYSQDVLLESSYE 400
             ++HVN G  GFVFIEANVKK+ +    G    PP+Y   +  +D +L+   E
Sbjct: 392 EVELHVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTEIKKDTILQKGEE 445

>Kwal_26.7665
          Length = 551

 Score =  129 bits (325), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 105/359 (29%), Positives = 158/359 (44%), Gaps = 90/359 (25%)

Query: 109 PSALDDADAVRDK----LARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIIN 164
           P   DD  A+ ++    L RMS  E   Y++  EF K  PP    + +  G  T     +
Sbjct: 138 PGQFDDEHALLEQEAVELPRMSRFEVELYQRCREFQKMCPP----NVTEFGTYT-----S 188

Query: 165 EQTLQFIDEEGAHAWEFQPDPKLPNDSV----------LVENKSEITFLNYNYDVSVMTN 214
               QFI + G  ++ F P     ND+V          +V++K ++ F  +N   S + N
Sbjct: 189 ASDKQFIKDRGVQSYYFLPSI---NDNVDHYGNFLPSFIVQDKLDVLFTKFNRSASTIMN 245

Query: 215 LPIPRLNR-VYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYD 273
            P+P+  +   Y E K+F+         +  N + S GL T PYPYFR+PG    SIAY+
Sbjct: 246 YPLPQNKKEAVYFEVKVFKFP-------AKSNSIFSCGLVTCPYPYFRIPGMAQFSIAYE 298

Query: 274 STGGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKKLNEKS------ 327
           STG  R N+ F  +    ++ P+ ++GDVIG GYR  +GT+  T NGKKL + +      
Sbjct: 299 STGKLRMNNPFYAN----TLLPKLQEGDVIGFGYRYKTGTILITHNGKKLMDLTHNVGID 354

Query: 328 ----IGGHIKGWKFKYVYP--------------IVGSNIPCK------------------ 351
               IG     +   Y                 I+ S+   K                  
Sbjct: 355 LFVGIGAMNAAYTRTYTREGLLEDCDNVSLRERILASDADQKAPRAINDQLETIHDPHND 414

Query: 352 --------VHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSY--EDYSQDVLLESSYE 400
                   +HVN G  GFV++EANVKK+ +    G    PP+Y  ++  +DV+L+   E
Sbjct: 415 DITSDEIELHVNLGQLGFVYVEANVKKYAFGSVYGDIGVPPAYNGDEIKKDVVLQKGEE 473

>KLLA0B12760g 1114942..1116570 some similarities with sp|P32343
           Saccharomyces cerevisiae YKL124w SSH4 suppressor of
           SHR3, hypothetical start
          Length = 542

 Score =  127 bits (320), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 123/230 (53%), Gaps = 38/230 (16%)

Query: 109 PSALDDADAVR----DKLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIIN 164
           P   DD ++++     +L +MS+ E   Y++ +EF K +PP++     P+G+      +N
Sbjct: 105 PGKFDDDESLKVREAKELPKMSSFEVELYERTKEFQKMSPPMV----KPLGS-----FLN 155

Query: 165 EQTLQFIDEEGAHAWEFQPDPKLPNDSV----------LVENKSEITFLNYNYDVSVMTN 214
            Q  Q I + G  ++ F P     ND+V           VE+K  ++F  +N   S + N
Sbjct: 156 SQDKQVIKDRGIQSYFFLPSI---NDNVDINGAFLPSFFVEDKLNVSFTKFNISSSAIMN 212

Query: 215 LPIPRLNR-VYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYD 273
            P+P   +   Y E K+++  T         N + S GL T PYPYFR+PG   +SIAY+
Sbjct: 213 YPLPMNKKDAVYFEVKVYKFKTC-------SNSIFSIGLMTCPYPYFRIPGTAAYSIAYE 265

Query: 274 STGGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKKL 323
           STG  R N++F       ++ P+ E+GDV+G GYR +SGT+F T NGKK+
Sbjct: 266 STGKLRINNAFGAD----TLLPKLEEGDVVGFGYRYSSGTIFITHNGKKM 311

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (57%), Gaps = 8/64 (12%)

Query: 350 CKVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSY--EDYSQDVLLES------SYED 401
            ++HVN G  GFVFIEANVKK+ +    G    PP+Y  +D  QD+LL+        Y D
Sbjct: 397 IELHVNLGQLGFVFIEANVKKYAFGSVYGDIGIPPAYNGDDIKQDMLLQKGDELPPEYPD 456

Query: 402 DATD 405
           DA D
Sbjct: 457 DAVD 460

>ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH]
           complement(350985..352427) [1443 bp, 480 aa]
          Length = 480

 Score =  125 bits (313), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 100/338 (29%), Positives = 147/338 (43%), Gaps = 86/338 (25%)

Query: 124 RMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIINEQTLQFIDEEGAHAWEFQP 183
           RMS  E   Y + +EF   NPPL+         +     +  +  Q + + G  A+   P
Sbjct: 61  RMSRFEVELYLRAKEFQAMNPPLV---------KAFGTYMCPEDRQCVRDRGIQAYYLLP 111

Query: 184 DPKLPNDSV----------LVENKSEITFLNYNYDVSVMTNLPIPRLNR-VYYCEFKIFE 232
                ND+V          LV++K  +TF  YN   S + N P+P   R   Y E K+++
Sbjct: 112 SI---NDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYK 168

Query: 233 LNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSPELAS 292
                  N  + N + S GL T PYPYF +PG   +SIAY+STG  R N+SF  S    +
Sbjct: 169 FR-----NYLASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYAS----T 219

Query: 293 IFPRCEKGDVIGIGYRTNSGTVFFTRNGKKLNEKS----------IGGHIKGWKFKYVYP 342
           + P+ ++GDV+G+GYR  +GTVF T NGKK+ + +          IG     +   Y   
Sbjct: 220 LLPKLQEGDVVGLGYRYRTGTVFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKE 279

Query: 343 IVGSNI---------------------------------PCKVHVN---------FGTYG 360
            +  +I                                 P   H+N          G  G
Sbjct: 280 GLLDDIDNVELRKQIQDLEADQKRDITEVMNEQLLRPHDPRTRHINSDEIELQVNLGGVG 339

Query: 361 FVFIEANVKKWGYAKSNGMKLPPPSY--EDYSQDVLLE 396
           FVF+EANVKK+ +    G    PP+Y  ++   DV+L+
Sbjct: 340 FVFVEANVKKYAFGSLYGEIGIPPAYNGDETKTDVILQ 377

>CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces
           cerevisiae YKL124w SSH4, hypothetical start
          Length = 587

 Score =  118 bits (295), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 155/362 (42%), Gaps = 89/362 (24%)

Query: 105 NARWPSALDDADAV----RDKLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVD 160
           N   P   DD +      R+ L +MS  E   Y + +EF   +PP           +   
Sbjct: 105 NFTNPGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPP---------AVQEFG 155

Query: 161 PIINEQTLQFIDEEGAHAWEFQPDPKLPNDSV----------LVENKSEITFLNYNYDVS 210
             ++ + LQ I + G  ++ F P     ND+V          LV++K E+ F  +N   S
Sbjct: 156 TYLDSKDLQMIKDRGIQSYYFIPSI---NDNVDKSGHFLPSFLVQDKLEVEFTRWNKSSS 212

Query: 211 VMTNLPIPRLNR-VYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHS 269
            + N P+P   +   Y E K++       N+  + N + S GL T PYPYFR+PG    S
Sbjct: 213 AVLNYPLPYNKKDAVYFEVKVY-------NHKPNSNSIFSIGLVTVPYPYFRIPGMCKFS 265

Query: 270 IAYDSTGGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVF-------------- 315
           IAY+STG  R ND F  S    ++ P+  +GDV+G GYR  +GT+F              
Sbjct: 266 IAYESTGKLRINDPFFPS----TLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQN 321

Query: 316 -------------------FTRNGKKLNEKSI---GGHIKGWKFKYVYPIVGSNIP---- 349
                              +T++G   +  +I       +G + K    I   + P    
Sbjct: 322 VSVELFIALGAMNASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDET 381

Query: 350 ---------CKVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSY--EDYSQDVLLESS 398
                     ++HVN G  GFVFIEANVKK+G+    G    PP+Y   D  +D L++  
Sbjct: 382 KWDIIDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKG 441

Query: 399 YE 400
            E
Sbjct: 442 EE 443

>Scas_721.126
          Length = 573

 Score =  110 bits (275), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 105/213 (49%), Gaps = 32/213 (15%)

Query: 121 KLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIINEQTLQFIDEEGAHAWE 180
           +L RMS  E   YK+  EF +  PP +         +     +    LQ I + G  ++ 
Sbjct: 128 ELNRMSPFELELYKRSNEFQEVAPPHI---------DEFGTYLKATDLQVIKDRGIQSYF 178

Query: 181 FQPDPK---------LPNDSVLVENKSEITFLNYNYDVSVMTNLPIPRLNR-VYYCEFKI 230
             P            LP  S L+++K ++ F  YN   S + N P+P   R   Y E K+
Sbjct: 179 LLPSINDNVNKQGNFLP--SFLIQDKLDMVFTKYNKSSSTVMNYPLPYTKRDAVYFEVKV 236

Query: 231 FELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSPEL 290
           F+       +    N + S GL T PYPYFR+PG    SIAY+STG  R N+ F  S   
Sbjct: 237 FK-------HQPVSNTIFSIGLVTVPYPYFRIPGMAKFSIAYESTGKLRINNPFMAS--- 286

Query: 291 ASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKKL 323
            ++ P+  +GDV+G GYR +SGT+F T NGKKL
Sbjct: 287 -TLLPKLVEGDVVGFGYRYSSGTIFITHNGKKL 318

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 42/79 (53%), Gaps = 8/79 (10%)

Query: 350 CKVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSY--EDYSQDVLLESSYEDDATDNE 407
            ++HVN G  GFVFIEANVKK+ +    G    PPSY  E+   D LL+    D+   N 
Sbjct: 392 VELHVNLGQVGFVFIEANVKKYAFGTVYGNIGIPPSYNGEEIKNDKLLQKG--DELPPNY 449

Query: 408 ST----STIDGDIIDSEGH 422
            T    +   GDI  +EGH
Sbjct: 450 GTLLDSNGFFGDIHINEGH 468

>CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30, start by similarity
          Length = 910

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 11/125 (8%)

Query: 299 KGDVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGT 358
           + DVIG G    +G+VFFT+NG  L E ++   +      Y+    G++    V  NFG 
Sbjct: 504 RDDVIGCGINYVNGSVFFTKNGVFLGE-AVSSLMNVNAIPYIALKSGNS----VRTNFGL 558

Query: 359 Y-GFVF----IEANVKKWGYAKSNGMKLPPPSYEDYSQDVLLESSYE-DDATDNESTSTI 412
           Y  FVF     + N K+  Y       +    + D    ++ ES  E DD  D    S +
Sbjct: 559 YEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLIDESQMEIDDDADESQLSLL 618

Query: 413 DGDII 417
              +I
Sbjct: 619 QKGLI 623

>AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH]
           (873480..875951) [2472 bp, 823 aa]
          Length = 823

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 5/61 (8%)

Query: 299 KGDVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGT 358
           + DVIG G     GT+FFT+NG  L     G   K      + P V       +  NFG 
Sbjct: 404 RDDVIGCGINYVDGTIFFTKNGIHL-----GTAFKDVAHLDLVPYVSLKPANSIRTNFGL 458

Query: 359 Y 359
           Y
Sbjct: 459 Y 459

>Scas_712.23
          Length = 973

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 33/71 (46%), Gaps = 16/71 (22%)

Query: 299 KGDVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFKYVYPI-VGSNIPCK----VH 353
           + D+IG G     GT+FFT+NG  L          G  F  VY + V  +I  K    V 
Sbjct: 582 RDDIIGCGINYIDGTIFFTKNGVFL----------GTAFTNVYDLNVVPSIALKPGNSVR 631

Query: 354 VNFGTY-GFVF 363
            NFG Y  FVF
Sbjct: 632 TNFGIYEEFVF 642

>Kwal_47.19173
          Length = 836

 Score = 32.7 bits (73), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 30/71 (42%), Gaps = 16/71 (22%)

Query: 299 KGDVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFKYVY-----PIVGSNIPCKVH 353
           + DVIG G     GT+FFT+NG  L          G  F  VY     P +       V 
Sbjct: 441 RNDVIGCGVNYVDGTIFFTKNGLHL----------GTAFTDVYDVDLAPFIALKPGNMVR 490

Query: 354 VNFGTY-GFVF 363
            NFG +  FVF
Sbjct: 491 TNFGLHEEFVF 501

>AER037C [2542] [Homologous to ScYBR153W (RIB7) - SH]
           (703668..704408) [741 bp, 246 aa]
          Length = 246

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 52/129 (40%), Gaps = 17/129 (13%)

Query: 84  RYFRTGISLSEGESRVIGPAVNARWPSALDDADAVRDKLAR---MSAEEQFYYKQGEEFI 140
           RY  +GI +  G +    P +N RW  A D AD       R   +    ++ Y+  +   
Sbjct: 66  RYHHSGILIGSGTALADDPGLNCRWTPAADGADCTEQSSPRPIILDVRGRWRYRGSKIEY 125

Query: 141 KQNPPLLLPDRSPVGAETVDPIINEQTLQF----IDEEGAHAW-----EFQPDPKLPNDS 191
             N   L   ++P+     +P + E  + +    +DE G   W         +  L  +S
Sbjct: 126 LHN---LGKGKAPIVVTGGEPEVRELGVSYLQLGVDEGGRLNWGELFERLYSEHHL--ES 180

Query: 192 VLVENKSEI 200
           V+VE  +E+
Sbjct: 181 VMVEGGAEV 189

>YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulates
           expression of genes that are involved in nitrogen
           metabolism [2877 bp, 958 aa]
          Length = 958

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 282 DSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKKL 323
           +S E S E A  F R    DVIG G     G++FFT+NG  L
Sbjct: 521 NSTEQSKEYAKPFGR---DDVIGCGINFIDGSIFFTKNGIHL 559

>AAR073W [259] [Homologous to NOHBY] complement(475533..479159) [3627
            bp, 1208 aa]
          Length = 1208

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 31/61 (50%), Gaps = 6/61 (9%)

Query: 405  DNESTSTIDGDIIDSEG--HLLPPPPGFEYSVSPQPSAAGQFTLNSLPPEPPRYASDTPE 462
            D +STS    D   S+G    +PP  GF     P P+A G  TL SLPPE P   +D  E
Sbjct: 986  DGQSTSEWASDDAPSDGLDFSMPPNQGF---AKPSPAANGMKTL-SLPPEAPASTNDFLE 1041

Query: 463  D 463
            D
Sbjct: 1042 D 1042

>CAGL0L10736g complement(1143245..1144273) some similarities with
           sp|Q03694 Saccharomyces cerevisiae YMR204c, start by
           similarity
          Length = 342

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 8/102 (7%)

Query: 362 VFIEANVKKWGYAKSNGMKLPPPSYEDYSQ-DVLLESSYEDDATDNESTSTIDGDIIDSE 420
           +FI+ N+ K    KSN  K PP +     Q    ++++ E+D  + E    +  D I+ E
Sbjct: 225 IFIDENITKLASLKSN--KTPPNNVNTLDQIKEKVQTATENDDDEAEELDYLLEDPIEQE 282

Query: 421 GHLLPPPPGFEYSVSPQPSAAGQFTLNSLPPEPPRYASDTPE 462
                P   FEY V    +   Q T+  +     R  S  P+
Sbjct: 283 -----PTSSFEYDVPTDLTEVFQRTMGRINSNGSRRYSSVPQ 319

>Kwal_23.5731
          Length = 621

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 11/59 (18%)

Query: 98  RVIGPAVNARWPSALDDADAVRDKLARMSAEEQF-----------YYKQGEEFIKQNPP 145
           ++ GPA++ R+ SA +    +R+ L R + + QF           Y+  G +  K++PP
Sbjct: 540 KLEGPALSLRFNSAHEQESHLRETLVRTAQQSQFLQGYIKNMHKQYHINGSQATKRSPP 598

>YDL147W (RPN5) [721] chr4 (190925..192262) Non-ATPase subunit of
           the 26S proteasome complex that also functions in RNA
           polymerase II transcription elongation, putative subunit
           of the signalosome complex that may function in Rub1p
           removal from Cdc53p [1338 bp, 445 aa]
          Length = 445

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 151 RSPVGAETVDPIINEQTLQFIDEEGAHAWE 180
           R P+  +T +P++NE  L F  E   H WE
Sbjct: 310 RWPIVQKTYEPVLNEDDLAFGGEANKHHWE 339

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,128,544
Number of extensions: 876567
Number of successful extensions: 3082
Number of sequences better than 10.0: 58
Number of HSP's gapped: 3100
Number of HSP's successfully gapped: 71
Length of query: 495
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 389
Effective length of database: 12,926,601
Effective search space: 5028447789
Effective search space used: 5028447789
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)