Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.347861860932480.0
KLLA0E14762g60158315700.0
Scas_669.1159658715030.0
CAGL0F07843g61260114890.0
YGL142C (GPI10)61658114830.0
ADL281C59558814490.0
Scas_714.365141761113e-05
Kwal_47.188425081451051e-04
KLLA0C08591g541136910.007
KLLA0C06567g530207880.015
Sklu_1894.3551114870.022
Kwal_23.6317545150800.15
YOR149C (SMP3)516176790.19
Kwal_23.4476552115780.26
KLLA0F09911g1654114780.32
CAGL0K05005g558188770.35
KLLA0D19404g553128760.42
Sklu_1475.2508160750.52
CAGL0K09548g496236740.61
ABL185C552129740.70
YNR030W (ECM39)551115721.3
Scas_606.657147711.5
AAR043C537158711.8
Scas_651.11451114702.2
YNL219C (ALG9)55545683.2
AFR395C52845674.2
CAGL0E00913g525112674.3
KLLA0D03344g57074675.1
YDR307W66255666.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3478
         (609 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3478                                                         1255   0.0  
KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces...   609   0.0  
Scas_669.11                                                           583   0.0  
CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces c...   578   0.0  
YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein i...   575   0.0  
ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH] (207452..2...   562   0.0  
Scas_714.36                                                            47   3e-05
Kwal_47.18842                                                          45   1e-04
KLLA0C08591g complement(752256..753881) similar to sp|P53730 Sac...    40   0.007
KLLA0C06567g complement(573595..575187) similar to sp|Q04174 Sac...    39   0.015
Sklu_1894.3 YNL219C, Contig c1894 4461-6116 reverse complement         38   0.022
Kwal_23.6317                                                           35   0.15 
YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein r...    35   0.19 
Kwal_23.4476                                                           35   0.26 
KLLA0F09911g complement(911305..916269) highly similar to sp|P22...    35   0.32 
CAGL0K05005g 484817..486493 similar to sp|P53868 Saccharomyces c...    34   0.35 
KLLA0D19404g 1632929..1634590 similar to sp|P53868 Saccharomyces...    34   0.42 
Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement          33   0.52 
CAGL0K09548g complement(940088..941578) similar to sp|Q04174 Sac...    33   0.61 
ABL185C [407] [Homologous to ScYNL219C (ALG9) - SH] (60000..6165...    33   0.70 
YNR030W (ECM39) [4612] chr14 (678798..680453) Protein involved i...    32   1.3  
Scas_606.6                                                             32   1.5  
AAR043C [229] [Homologous to ScYNR030W (ECM39) - SH] (418301..41...    32   1.8  
Scas_651.11                                                            32   2.2  
YNL219C (ALG9) [4385] chr14 complement(235995..237662) Mannosylt...    31   3.2  
AFR395C [3587] [Homologous to ScYOR149C (SMP3) - SH] (1145381..1...    30   4.2  
CAGL0E00913g complement(83601..85178) similar to sp|P06101 Sacch...    30   4.3  
KLLA0D03344g 279652..281364 similar to sp|P32891 Saccharomyces c...    30   5.1  
YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein contain...    30   6.0  

>Kwal_23.3478
          Length = 618

 Score = 1255 bits (3248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/609 (100%), Positives = 609/609 (100%)

Query: 1   MSIKFMNVITLINTHDQDMSQSSSKKPYGISIQKVLIIFRVLSSLFVVSYFQPDEFWQTL 60
           MSIKFMNVITLINTHDQDMSQSSSKKPYGISIQKVLIIFRVLSSLFVVSYFQPDEFWQTL
Sbjct: 1   MSIKFMNVITLINTHDQDMSQSSSKKPYGISIQKVLIIFRVLSSLFVVSYFQPDEFWQTL 60

Query: 61  EPAHHQAFGYGKLTWEWDYGLRSYAFPFIFEILYRLVSVVSTIAEQIVAITVDCFVFTVS 120
           EPAHHQAFGYGKLTWEWDYGLRSYAFPFIFEILYRLVSVVSTIAEQIVAITVDCFVFTVS
Sbjct: 61  EPAHHQAFGYGKLTWEWDYGLRSYAFPFIFEILYRLVSVVSTIAEQIVAITVDCFVFTVS 120

Query: 121 RIIPGSELAWSMVNEMQHFPQEIKSFLEYYGVIIAPKVMMALIGAVGEMYAFAFIEKLYT 180
           RIIPGSELAWSMVNEMQHFPQEIKSFLEYYGVIIAPKVMMALIGAVGEMYAFAFIEKLYT
Sbjct: 121 RIIPGSELAWSMVNEMQHFPQEIKSFLEYYGVIIAPKVMMALIGAVGEMYAFAFIEKLYT 180

Query: 181 REFSGDEKNKMQSGKLVKMAACLLSTTNFFNNFMITRTFANTLEMDLTCAALYFWDWTGG 240
           REFSGDEKNKMQSGKLVKMAACLLSTTNFFNNFMITRTFANTLEMDLTCAALYFWDWTGG
Sbjct: 181 REFSGDEKNKMQSGKLVKMAACLLSTTNFFNNFMITRTFANTLEMDLTCAALYFWDWTGG 240

Query: 241 ACVSGRNFTISLYCGIFLCLQRPTNALIWVPLGLFLVLNLTARKDFKNLTVLVRKLLLVF 300
           ACVSGRNFTISLYCGIFLCLQRPTNALIWVPLGLFLVLNLTARKDFKNLTVLVRKLLLVF
Sbjct: 241 ACVSGRNFTISLYCGIFLCLQRPTNALIWVPLGLFLVLNLTARKDFKNLTVLVRKLLLVF 300

Query: 301 LQVLAVNLAIDFYFYRELIFPVFRFIKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTP 360
           LQVLAVNLAIDFYFYRELIFPVFRFIKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTP
Sbjct: 301 LQVLAVNLAIDFYFYRELIFPVFRFIKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTP 360

Query: 361 LFLYGFFCSKTEKGREGLNSSMLQARIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSI 420
           LFLYGFFCSKTEKGREGLNSSMLQARIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSI
Sbjct: 361 LFLYGFFCSKTEKGREGLNSSMLQARIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSI 420

Query: 421 ALGPKIPTLEKMSNGPLKYLVWAPPFFSIIASLLVSSYHETGVTEVTKYLHHIPRIHSVG 480
           ALGPKIPTLEKMSNGPLKYLVWAPPFFSIIASLLVSSYHETGVTEVTKYLHHIPRIHSVG
Sbjct: 421 ALGPKIPTLEKMSNGPLKYLVWAPPFFSIIASLLVSSYHETGVTEVTKYLHHIPRIHSVG 480

Query: 481 FIMPCHSTPWQSYIHRNDIQDIWSITCEPPLFLLEDPDAEKLLASYMDESDLLYDNVPKF 540
           FIMPCHSTPWQSYIHRNDIQDIWSITCEPPLFLLEDPDAEKLLASYMDESDLLYDNVPKF
Sbjct: 481 FIMPCHSTPWQSYIHRNDIQDIWSITCEPPLFLLEDPDAEKLLASYMDESDLLYDNVPKF 540

Query: 541 IYQNMPPVFRKELRSPSKEYSHEWPEYLIIFQQLDDTFMKDFLKDSAYSEEARFFNTWSH 600
           IYQNMPPVFRKELRSPSKEYSHEWPEYLIIFQQLDDTFMKDFLKDSAYSEEARFFNTWSH
Sbjct: 541 IYQNMPPVFRKELRSPSKEYSHEWPEYLIIFQQLDDTFMKDFLKDSAYSEEARFFNTWSH 600

Query: 601 WDSRRSGDI 609
           WDSRRSGDI
Sbjct: 601 WDSRRSGDI 609

>KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis singleton, hypothetical
           start
          Length = 601

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/583 (50%), Positives = 392/583 (67%), Gaps = 7/583 (1%)

Query: 34  KVLIIFRVLSSLFVVSYFQPDEFWQTLEPAHHQAFGYGKLTWEWDYGLRSYAFPFIFEIL 93
           KV+++ R + +L   ++FQ DEFWQ+LEPAH+ AFGYG+LTWEW +GLRSYAFP IF+I 
Sbjct: 12  KVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLRSYAFPLIFQIG 71

Query: 94  YRLVSVVSTIAEQIVAITVDCFVFTVSRIIPGSELAWSMVNEMQHFPQEIKSFLEYYGVI 153
           Y LV   +   E IV    D  +  V+ +IP SE  W MV EM+ FP+EI+ F+EY GVI
Sbjct: 72  YTLVKYAAISCELIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEEIRGFIEYQGVI 131

Query: 154 IAPKVMMALIGAVGEMYAFAFIEKLY--TREFSGDEKNKMQSGKLVKMAACLLSTTNFFN 211
            APK++MA++ A+GE +     EKLY  T + S D K   +    V     + + +NFFN
Sbjct: 132 YAPKLIMAVLAAIGEFHVILLAEKLYKLTMDKSDDSKGSDKKHSTVINFTLVATVSNFFN 191

Query: 212 NFMITRTFANTLEMDLTCAALYFWDWTGGACVSGRNFTISLYCGIFLCLQRPTNALIWVP 271
            F ITR+F N+ EM LT  +LY+WDWT G  +   +F  SL  G F  LQRPTNA IW+ 
Sbjct: 192 CFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVLQRPTNAFIWLI 251

Query: 272 LGLFLVLNLTARKDFKNLTVLVRKLLLVFLQVLAVNLAIDFYFYRELIFPVFRFIKFNYT 331
           LG +++LNL   K ++ L  L+ K++      ++ NL ID+YFY  +  PV +FIKFN T
Sbjct: 252 LGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITIPVLKFIKFNCT 311

Query: 332 SALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKG-REGLNSSMLQARIVVI 390
           S+LS FYG APW+FH+ QSLP++ G+S PL ++ FFCS T+K     L +  LQ + VV+
Sbjct: 312 SSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQIKTVVL 371

Query: 391 INIIAFSLISHKEFRFLYILHPFFLL---FSSIALGPKI-PTLEKMSNGPLKYLVWAPPF 446
           +N+I +SLI HKEFRF+Y L PFF++   F  I L  K   T    +      ++W  P 
Sbjct: 372 LNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEFFSQVMWILPV 431

Query: 447 FSIIASLLVSSYHETGVTEVTKYLHHIPRIHSVGFIMPCHSTPWQSYIHRNDIQDIWSIT 506
            S++AS+L+S+ HE+G   V  YLH I  I S+GFIMPCHSTPWQS+ HRND++++W+IT
Sbjct: 432 VSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHFHRNDVKELWAIT 491

Query: 507 CEPPLFLLEDPDAEKLLASYMDESDLLYDNVPKFIYQNMPPVFRKELRSPSKEYSHEWPE 566
           C PPL LL DPDA   L  YMDESD LYDN+ KF+YQ+ PPVFRK LRSP K+Y++EWPE
Sbjct: 492 CSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSLRSPGKQYTYEWPE 551

Query: 567 YLIIFQQLDDTFMKDFLKDSAYSEEARFFNTWSHWDSRRSGDI 609
           YL+IF+ LD  FM D+L DS Y EE RFFN+  HWD RRSGDI
Sbjct: 552 YLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSGDI 594

>Scas_669.11
          Length = 596

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/587 (49%), Positives = 399/587 (67%), Gaps = 15/587 (2%)

Query: 31  SIQKVLIIFRVLSSLFVVSYFQPDEFWQTLEPAHHQAFGYGKLTWEWDYGLRSYAFPFIF 90
           S+ + +++FR+ ++L   ++FQ DEFWQ LEPAH  AFGYG+LTW+W + +RSYAFPFIF
Sbjct: 8   SLFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRSYAFPFIF 67

Query: 91  EILYRLVSVVSTIAEQIVAITVDCFVFTVSRIIPGSELAWSMVNEMQHFPQEIKSFLEYY 150
           E+ YRLV +V  ++  ++ +  +     +  + P +E    +V+++   P ++ + LEY 
Sbjct: 68  ELTYRLVRLVVFMSRWLMELLSELASELLLLLFPSNEFVRLVVDDLVVLPSDMANSLEYI 127

Query: 151 GVIIAPKVMMALIGAVGEMYAFAFIEKLY-----TREFSGDEKNKMQSGKLVKMAACLLS 205
           GVI  PKV+M LI A GE Y    I+KLY     + + + DE  K  S + +   A +LS
Sbjct: 128 GVIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGITKIATVLS 187

Query: 206 TTNFFNNFMITRTFANTLEMDLTCAALYFWDWTGGACVSGRNFTISLYCGIFLCLQRPTN 265
            TNFFN ++ITR+F N+ EM  T  ALYFWDWTGG  +    FT SL   +F CLQRPTN
Sbjct: 188 LTNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFTCLQRPTN 247

Query: 266 ALIWVPLGLFLVLNLTAR-KDFKNLTVLVRKLLLVFLQVLAVNLAIDFYFYRELIFPVFR 324
           A IW+ LG  L+ N+  R  DFK   +L+RK++L F+ V  +N++IDFYFY E+  P+  
Sbjct: 248 AFIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEITIPLIN 307

Query: 325 FIKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKGREGLNSS-ML 383
           FIKFN TS L++FYG++PWHFHL QS+P+ILG++   F+ G FC  + K      ++   
Sbjct: 308 FIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFF 367

Query: 384 QARIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNGPLKYLVWA 443
           Q ++++++N++ FSL +HKEFRF+Y L PFF+  S  AL        K+       + W 
Sbjct: 368 QIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVFAL-------HKLKWYQYSRMTWI 420

Query: 444 PPFFSIIASLLVSSYHETGVTEVTKYLHHIP-RIHSVGFIMPCHSTPWQSYIHRNDIQDI 502
            P  S++ SLLVSS+ E+G  EV K+LH+ P  + SVGFIMPCHSTPWQSY+HR DI D+
Sbjct: 421 LPLASVVLSLLVSSFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQDIPDL 480

Query: 503 WSITCEPPLFLLEDPDAEKLLASYMDESDLLYDNVPKFIYQNMPPVFRKELRSPSKEYSH 562
           W+ITCEPPL LL D DA   L SYMDESD LY N  +F+Y+N PPVF+KELRSP K Y+H
Sbjct: 481 WAITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRSPGKVYTH 540

Query: 563 EWPEYLIIFQQLDDTFMKDFLKDSAYSEEARFFNTWSHWDSRRSGDI 609
           EWPEYLIIF+QLDD  M+++LKDS+Y E  RFFN+WSHWDSRR+GDI
Sbjct: 541 EWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAGDI 587

>CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis, hypothetical start
          Length = 612

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/601 (47%), Positives = 398/601 (66%), Gaps = 11/601 (1%)

Query: 16  DQDMSQSSSKKPYGISIQKVLIIFRVLSSLFVVSYFQPDEFWQTLEPAHHQAFGYGKLTW 75
           D++     S      +I  VL+ FRV++SL   +YFQ DEFWQ+LEPAH++AFGYG+LTW
Sbjct: 9   DENRDVQGSIVTKTSAIFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKAFGYGELTW 68

Query: 76  EWDYGLRSYAFPFIFEILYRLVSVVSTIAEQIVAITVDCFVFTVSRIIPGSELAWSMVNE 135
           EW  GLRSYAFP +FEI+YRLV +++  +++ ++I        +    P S+LA  +  +
Sbjct: 69  EWKVGLRSYAFPMLFEIIYRLVKLLAIASKEALSIICSIGAGLMLLCFPQSKLATEVARD 128

Query: 136 MQHFPQEIKSFLEYYGVIIAPKVMMALIGAVGEMYAFAFIEKLYTREFSGDEKNKMQSGK 195
           +   P E    +EYYGVI APK+ MAL+ A GE +    I+K+Y +  S ++    +   
Sbjct: 129 LLTIPNEYSETVEYYGVIYAPKLFMALLAATGEYFTIKLIQKVYLKTVSKNDDQLPKLSN 188

Query: 196 LVKMAACLLSTTNFFNNFMITRTFANTLEMDLTCAALYFWDWTGGACVSGRNFTISLYCG 255
           + K+A  LL+ TNFFN F ITRTF N+ EM LT  ALY WDW+GG  ++ R+FT SL+  
Sbjct: 189 ITKIA-LLLTLTNFFNCFFITRTFINSFEMILTSIALYNWDWSGGIEINTRSFTKSLFFA 247

Query: 256 IFLCLQRPTNALIWVPLGLFLVLNLTARKDFKNLTVLVRKLLLVFLQVLAVNLAIDFYFY 315
           +F C+QRP+NA+IW+ LG FL +NL  R+D+  +  L  K+L+VF   + VN+ IDFYFY
Sbjct: 248 MFACIQRPSNAIIWIVLGFFLTINLLLRRDYTLIGRLYAKILVVFTITMLVNVVIDFYFY 307

Query: 316 RELIFPVFRFIKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKGR 375
            ++IFPVF+FI FN+TS LS FYG APWHFHLLQSLP++LG+S PLF+YG F + +    
Sbjct: 308 NQIIFPVFKFINFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTKN 367

Query: 376 EGLNSSMLQARIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNG 435
                ++ Q + V+I+NII +S + HKEFRF+Y L P F L S  ALG      +  +  
Sbjct: 368 NIRFGALRQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFCLLS--ALGALKLAGKVQNYR 425

Query: 436 PLKYLVWAPPFFSIIASLLVSSYHETGVTEVTKYLHHIPRIHSVGFIMPCHSTPWQSYIH 495
            LK  VW  P  S+I S+ ++++ E+GV +V K LH+   I SVGF+MPCHSTPWQSY+H
Sbjct: 426 YLKEYVWIIPLMSMIVSIFITTFQESGVIQVMKDLHNEKDIDSVGFVMPCHSTPWQSYLH 485

Query: 496 RNDIQDIWSITCEPPLFLLEDPDAEKLLASYMDESDLLYDNVPKFIYQNMPPVFRKEL-- 553
           RNDI+ +W+I+CEPPL LL   +A   L +YMDESD LY+N+  FI +N P  F   +  
Sbjct: 486 RNDIRQLWAISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPK-FTNSMDM 544

Query: 554 -----RSPSKEYSHEWPEYLIIFQQLDDTFMKDFLKDSAYSEEARFFNTWSHWDSRRSGD 608
                 +   ++ HEWP++LIIF+QLD+ FM  +L DS Y +  + FN++SHWDSRR+GD
Sbjct: 545 ENVNNNASMPQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSRRNGD 604

Query: 609 I 609
           +
Sbjct: 605 L 605

>YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein
           involved in glycosylphosphatidylinositol (GPI)
           synthesis, transfers the third core mannose to the GPI
           core structure [1851 bp, 616 aa]
          Length = 616

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/581 (49%), Positives = 390/581 (67%), Gaps = 8/581 (1%)

Query: 35  VLIIFRVLSSLFVVSYFQPDEFWQTLEPAHHQAFGYGKLTWEWDYGLRSYAFPFIFEILY 94
           V + FRVL+++   ++FQ DEFWQ LEPAH +AF YG+LTWEW +G+RSY FP IFE+ Y
Sbjct: 20  VFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTWEWKFGVRSYLFPMIFELTY 79

Query: 95  RLVSVVSTIAEQIVAITVDCFVFTVSRIIPGSELAWSMVNEMQHFPQEIKSFLEYYGVII 154
           RLVS+ S +    + +        +  ++P  EL+W +  +++  P ++    EYYGVI 
Sbjct: 80  RLVSLSSILLHYALLLLSTIGSDLLILLLPKYELSWQVAEDLKRLPFDVTRSFEYYGVIY 139

Query: 155 APKVMMALIGAVGEMYAFAFIEKLY--TREFSGDEKNKMQSGKLVKMA--ACLLSTTNFF 210
           APK++MA++ ++GE Y   F++KLY  T +   +++ + +   L ++   A LLS TNFF
Sbjct: 140 APKIVMAVLASIGEYYIVRFVQKLYLLTLDKRNEKEEEERRSGLSEITKFALLLSLTNFF 199

Query: 211 NNFMITRTFANTLEMDLTCAALYFWDWTGGACVSGRNFTISLYCGIFLCLQRPTNALIWV 270
           N F ITRTF N+ EM LT  ALY+WDWTGG  +   +FT SL      CLQRP++ LIWV
Sbjct: 200 NCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACLQRPSSGLIWV 259

Query: 271 PLGLFLVLNLTARKDFKNLTVLVRKLLLVFLQVLAVNLAIDFYFYRELIFPVFRFIKFNY 330
              + L+LNL  +K +  L +   K+L  F  V   N  ID YFY ++ FP FRF+KFN+
Sbjct: 260 IPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVTFPFFRFLKFNF 319

Query: 331 TSALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFF--CSKTEKGREGLNSSMLQARIV 388
           T+ LS FYG APWHFH  QSLP++LG S P F +G F   SK    ++ LN    Q ++ 
Sbjct: 320 TTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYLNP-FFQVKLT 378

Query: 389 VIINIIAFSLISHKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNGPLKYLVWAPPFFS 448
           +++N++ +S + HKEFRF++ L P F+L SS  L        K  +G LK L+W  PF S
Sbjct: 379 ILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSG-LKSLLWLVPFVS 437

Query: 449 IIASLLVSSYHETGVTEVTKYLHHIPRIHSVGFIMPCHSTPWQSYIHRNDIQDIWSITCE 508
           +  +LL+ ++HE+G  EV K+LH  P I S+GFIMPCHSTP QSY+HR+DIQD+WSITC 
Sbjct: 438 VFIALLLDTFHESGSIEVMKFLHEEPEIDSLGFIMPCHSTPGQSYLHRSDIQDLWSITCN 497

Query: 509 PPLFLLEDPDAEKLLASYMDESDLLYDNVPKFIYQNMPPVFRKELRSPSKEYSHEWPEYL 568
           PPL LL DP+A   L +YMDESD LYD++  FIY+N PP FRK+LRSP K YSHEWP YL
Sbjct: 498 PPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRKDLRSPGKTYSHEWPTYL 557

Query: 569 IIFQQLDDTFMKDFLKDSAYSEEARFFNTWSHWDSRRSGDI 609
           ++F+ +++ F+KDFLKDS+Y E  RFFN+ +HWDSRRSGDI
Sbjct: 558 VVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSGDI 598

>ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH]
           (207452..209239) [1788 bp, 595 aa]
          Length = 595

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/588 (46%), Positives = 386/588 (65%), Gaps = 15/588 (2%)

Query: 31  SIQKVLIIFRVLSSLFVVSYFQPDEFWQTLEPAHHQAFGYGKLTWEWDYGLRSYAFPFIF 90
           SI + L ++R++++L + S+FQ DE+WQ+LEPAH +AFGYG LTWEW +GLRSYAFP +F
Sbjct: 5   SILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAFPMLF 64

Query: 91  EILYR---LVSVVSTIAEQIVA-ITVDCFVFTVSRIIPGSELAWSMVNEMQHFPQEIKSF 146
           E+ Y    ++ V + +A Q +A  T  C       ++P      + +  +   P+  +  
Sbjct: 65  EMSYYVAWILGVATRMALQGLAHATALC-----GAVVPSGAAGVAAMKAVWELPEAAQEL 119

Query: 147 LEYYGVIIAPKVMMALIGAVGEMYAFAFIEKLYTREFSGDEKNKMQSGKLVKMAACLLST 206
           +EYYGV+  P+V+MA + A GE Y+   + KLY R     +  K  +  + ++A  +L+ 
Sbjct: 120 VEYYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRVADKGDDQKGDAAPVSRLA-LMLTM 178

Query: 207 TNFFNNFMITRTFANTLEMDLTCAALYFWDWTGGACVSGRNFTISLYCGIFLCLQRPTNA 266
           TNFFN F  TRTF N+ EM LT  ALY WDW+GG  V    F+ SL    F CLQRPTN 
Sbjct: 179 TNFFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPTNV 238

Query: 267 LIWVPLGLFLVLNLTARKDFKNLTVLVRKLLLVFLQVLAVNLAIDFYFYRELIFPVFRFI 326
           LIW  LGLFLVLNL   + ++ L  LV K+       +  N+AID+YFY  ++ P+ RFI
Sbjct: 239 LIWAVLGLFLVLNLVRSRRWQLLLTLVAKVAAAGALAVCANIAIDYYFYGGVLLPLLRFI 298

Query: 327 KFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKGREGL-NSSMLQA 385
           +FN T+ L++FYG APWHFHLLQS+PLI+G++ P F+         +G  GL  S ++Q 
Sbjct: 299 EFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIMQI 358

Query: 386 RIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNGPLKY---LVW 442
           + VV++NI  +S I HKEFRFLY L P FL  S++ +   +          LK    L++
Sbjct: 359 KCVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKRVQSLLY 418

Query: 443 APPFFSIIASLLVSSYHETGVTEVTKYLHH-IPRIHSVGFIMPCHSTPWQSYIHRNDIQD 501
             P  SI A+L++++ HE GV  V  YLH  +P   S+GFIMPCHSTPWQS++HRND+  
Sbjct: 419 VLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDLGK 478

Query: 502 IWSITCEPPLFLLEDPDAEKLLASYMDESDLLYDNVPKFIYQNMPPVFRKELRSPSKEYS 561
           +W+I+C+PPL LL   DA   L +YMDESD LY+N+P+FI++N PPVFR++LRSP ++Y+
Sbjct: 479 LWAISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRRDLRSPGRQYA 538

Query: 562 HEWPEYLIIFQQLDDTFMKDFLKDSAYSEEARFFNTWSHWDSRRSGDI 609
           +EWPE+L++F+ +D+ FMK++LKDS Y E  RFFNT SHWDSRR+GD+
Sbjct: 539 YEWPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAGDV 586

>Scas_714.36
          Length = 514

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 82/176 (46%), Gaps = 19/176 (10%)

Query: 292 LVRKLLLVFLQVLAVNLAIDFYFYRELIFPVFRFIKFNYTSALSSFYGTAPWHFHLLQSL 351
           LV  L ++    L + L    Y   E +   +  +K+N+  +    +G  PW+ H+L +L
Sbjct: 220 LVLSLSILLTTSLCILLDTAIYESNEWVITPWNNLKYNFDISNLESHGLHPWYTHILVNL 279

Query: 352 PLILGWSTPLFLYGFFCSKTEKGREGLNSSMLQARIVVIINIIAFSLISHKEFRFLYILH 411
           P +LG   P+ ++             L +S     + ++ +++  S   H+EFRFL  L 
Sbjct: 280 PQLLG---PMIIFLPLI--------LLKTSTTIPTLSIMSSMVTLSYFKHQEFRFLTPLV 328

Query: 412 PFFLLFSSIALGPKIPTLEKMSN--GPLKYLVWAPPFFSIIASLLVSSYHETGVTE 465
           P  L    I L   IP   + S+    +  L+W    F+II +++V  +H++GV +
Sbjct: 329 PLLL----IQLAACIPNSIQQSSFKRSVIRLLWV--LFNIIFAVIVGVFHQSGVIQ 378

>Kwal_47.18842
          Length = 508

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 68/145 (46%), Gaps = 21/145 (14%)

Query: 326 IKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKGREGLNSSMLQA 385
           + +N  ++  + +G  P + HLL ++P +LG   PL +  FF S+    R+ +N S L  
Sbjct: 246 LAYNLKNSNLAEHGLHPRYTHLLLNVPQMLG---PLLI--FFVSR----RQRINLSFLAC 296

Query: 386 RIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNGPLKYLVWAPP 445
               I  II  S+  H+E RFL  L P F       +   +   +K  +  L    W   
Sbjct: 297 ----ISGIIVLSMFQHQELRFLIPLLPLF------CVSVDLSNFDKFVSSQLVNKAWLA- 345

Query: 446 FFSIIASLLVSSYHETGVTEVTKYL 470
            F++I  +++ S H+ GV  V + L
Sbjct: 346 -FNVIFGVIMGSLHQRGVVTVIEEL 369

>KLLA0C08591g complement(752256..753881) similar to sp|P53730
           Saccharomyces cerevisiae YNR030w ECM39 involved in cell
           wall biogenesis and architecture singleton, start by
           similarity
          Length = 541

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 61/136 (44%), Gaps = 11/136 (8%)

Query: 288 NLTVLVRKLLLVFLQVLAVNLAIDFYFYRELIFPVFRFIKFNYTSALSSFYGTAPWHFHL 347
           +LT +VR   +     + +++ +D YF+  L  P      FN     SS +GT P+  +L
Sbjct: 220 SLTSIVRTGFIGAGAGIFLSIQVDSYFWNRLTVPEIEAFIFNVVHGESSKWGTQPFFAYL 279

Query: 348 LQSLPLILGWSTPLFL--YGFFCSKTEKGREGLNSSMLQARIVVIINIIAFSLISHKEFR 405
              LP++    T L L   GF        + G NS  +   I    +++  SL  HKE+R
Sbjct: 280 TGYLPMMFIPPTALLLNHLGF--------KIGPNSFRVVG-IAAYFHVLVMSLQPHKEWR 330

Query: 406 FLYILHPFFLLFSSIA 421
           F+   +P   L  + A
Sbjct: 331 FIIYSNPPITLLGATA 346

>KLLA0C06567g complement(573595..575187) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein singleton, start by similarity
          Length = 530

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 82/207 (39%), Gaps = 45/207 (21%)

Query: 338 YGTAPWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKGREGLNSSMLQARIVVIINIIAFS 397
           +G  P + HLL +LPLI G   P+ L  F   K       L+          I  I+  S
Sbjct: 285 HGLHPRYTHLLINLPLICG---PIILL-FISQKAVLKLPALSC---------ISGILMLS 331

Query: 398 LISHKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNGPLKYLVWAPPFFSIIASLLVSS 457
           L  H+E RF+  + P  LL +S+ L     T  +       +LV     F+I+  L++  
Sbjct: 332 LFRHQELRFIIPVLP--LLCASMNLD-NFDTFFQAETIITSWLV-----FNIVMGLIMGV 383

Query: 458 YHETGVTEVTKYLHHIPRIHSVGFIMPCHSTPWQSYIHRNDIQDIWSITCEPPLFLLEDP 517
           +H+ G+  +  Y          G   P H               IW  T  PP ++  +P
Sbjct: 384 FHQAGIIPLISYFS--------GEEFPVH---------------IWWKTYSPPTWMYSNP 420

Query: 518 DAEKLLASYMDESDLLYDNVPKFIYQN 544
           D      ++ +  + + DN+P  +  N
Sbjct: 421 DLTVSTTNFKENVEFV-DNIPWHVVSN 446

>Sklu_1894.3 YNL219C, Contig c1894 4461-6116 reverse complement
          Length = 551

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 58/114 (50%), Gaps = 23/114 (20%)

Query: 41  VLSSLFVVS-YFQP--------DEFWQTLEPAHHQAFGYGKLTWEW--DYGLRSYAF--P 87
           +LS LFV   Y QP        DE +   EP +    G+GK TWE+  +Y +RS+AF  P
Sbjct: 10  LLSLLFVERLYLQPLYSLISDCDETFNYWEPLNVLVRGFGKQTWEYSPEYSIRSWAFLLP 69

Query: 88  FIFEILYRLVSVVSTIAEQIVAITVDCFVFTVSRIIPG---SELAWSMVNEMQH 138
           F + IL  L ++++       A+      F V+R + G   S L WS+ NE++ 
Sbjct: 70  F-YTILKPLGTILAKNNVPAYAL------FYVTRGLLGLTSSVLEWSLFNELEQ 116

>Kwal_23.6317
          Length = 545

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 66/150 (44%), Gaps = 19/150 (12%)

Query: 310 IDFYFYRELIFPVFRFIKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTPLFL--YGFF 367
           +D YF+R   FP      FN     S+ +GT P++ +L   LP++    T L L   GF 
Sbjct: 248 VDSYFWRTWTFPEMDAFLFNVIDGKSAKWGTLPFYSYLTTMLPMLFIPPTVLVLDFMGFR 307

Query: 368 CSKTEKGREGLNSSMLQARIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSIALGPKIP 427
            +  E         + +A    I +I+  S   HKE+RF+    P   L +S     +I 
Sbjct: 308 AAPQEL------KVLTEAS---IFHILVLSFQPHKEWRFIVYSIPALTLLASYG-ASRIF 357

Query: 428 TLEKMSNGPLKYLVWAPPFFSIIASLLVSS 457
            ++++    +  L+       II SLLVS 
Sbjct: 358 KMQRVKGVNILKLI-------IIFSLLVSG 380

>YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein
           required for addition of the fourth mannose in
           glycosylphosphotidylinositol biosynthesis, functions in
           the protein kinase C pathway and required for plasmid
           maintenance [1551 bp, 516 aa]
          Length = 516

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 73/176 (41%), Gaps = 26/176 (14%)

Query: 326 IKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFFCS-KTEKGREGLNSSMLQ 384
           +K+N        +G  P + HLL +LP I+G   P+ L   F   K +K           
Sbjct: 250 LKYNLNVQNLQVHGLHPRYTHLLVNLPQIVG---PVLLLAIFSGYKLDK----------L 296

Query: 385 ARIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSIALGPKIPTL--EKMSNGPLKYLVW 442
           +   +I  ++  S   H+E RFL  L P  LL +++   P   TL  +K+  G      W
Sbjct: 297 STYAIISGLLFLSFFQHQELRFLVPLVP--LLVTNLNWTPLSSTLVNKKIFKG-----TW 349

Query: 443 APPFFSIIASLLVSSYHETGVTE-VTKYLHHIPRIHSVGFIMPCHSTPWQSYIHRN 497
               F+II + ++   H+ G+ + +  Y H       V      +S P   Y+  N
Sbjct: 350 L--LFNIIMAFIMGISHQAGIIQFLGDYFHFRTEQMGVHIWWKTYSPPTWMYMSNN 403

>Kwal_23.4476
          Length = 552

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (47%), Gaps = 20/115 (17%)

Query: 38  IFRVLSSLFVVS--YFQP--------DEFWQTLEPAHHQAFGYGKLTWEW--DYGLRSYA 85
           IF +L S  + S  Y QP        DE +   EP +    G+GK TWE+  +Y +RS+A
Sbjct: 7   IFVILFSALLASRLYLQPVFSLISDCDETFNYWEPLNFLLRGFGKQTWEYSPEYSIRSWA 66

Query: 86  FPFIFEILYRLVSVVSTIAEQIVAITVDCFVFTVSRIIPG---SELAWSMVNEMQ 137
           F      L+ L+S ++ I +  V      +VF  +R   G     + WS+ NE+ 
Sbjct: 67  F---LLPLFTLLSPINKIVQ--VFELPPSYVFYAARFFLGLLSLVMEWSLYNEIS 116

>KLLA0F09911g complement(911305..916269) highly similar to sp|P22137
            Saccharomyces cerevisiae YGL206c CHC1 clathrin heavy
            chain singleton, start by similarity
          Length = 1654

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 48/114 (42%), Gaps = 11/114 (9%)

Query: 156  PKVMMALIGAVGEMYAFAFIEKLYT------REFSGDEKNKMQSGKLVKMAACLLSTTNF 209
            P +  ALI A  E+     IE L +       E  GD+ ++    K  K+  C  S +N+
Sbjct: 1172 PVIDGALILAYAELSKLNEIENLLSVSTVANLEEVGDKLSQHNDYKAAKL--CYSSISNY 1229

Query: 210  ---FNNFMITRTFANTLEMDLTCAALYFWDWTGGACVSGRNFTISLYCGIFLCL 260
                +  +    + N ++     + +  W     AC+S + F ++  CG+ L +
Sbjct: 1230 SKLASTLVYLGDYQNAVDTARKASNVKVWRQVNDACISNKEFRLAQICGLNLVV 1283

>CAGL0K05005g 484817..486493 similar to sp|P53868 Saccharomyces
           cerevisiae YNL219c ALG9, start by similarity
          Length = 558

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 84/188 (44%), Gaps = 40/188 (21%)

Query: 35  VLIIFRVLSSLFVVSYF----QPDEFWQTLEPAHHQAFGYGKLTWEW--DYGLRSYAF-- 86
           VL++  V + L++  ++      DE +   EP +    G+GK TWE+  +Y +RS++F  
Sbjct: 9   VLVVLLVATRLYIQPFYSLISDCDETFNYWEPLNLLLRGFGKQTWEYSPEYSIRSWSFLL 68

Query: 87  PFIFEILYRLVSVVSTIAEQIVAITVDCFVFTVSRIIPGSELAWSMVNEMQHFPQ----- 141
           PF + +LY L +V    A          + F   RI+ G    +S++ E + F +     
Sbjct: 69  PF-YSLLYPLNAVAEIQAN---------WNFYAVRILLG---LFSLIQEWKLFKEITGTT 115

Query: 142 --EIKSFLEYY----------GVIIAPKVMMALIGAVGEM-YAFAFIEKLYTREFSGDEK 188
             EI +F  +Y           V + P   +A+I  +G + YA  ++    +  F G   
Sbjct: 116 TLEIANFWLFYQLFNPGWFHASVELLPSA-IAMILQLGSINYALKYLSTSASSNFIGSLT 174

Query: 189 NKMQSGKL 196
             M +G L
Sbjct: 175 FNMIAGIL 182

>KLLA0D19404g 1632929..1634590 similar to sp|P53868 Saccharomyces
           cerevisiae YNL219c ALG9 mannosyltransferase singleton,
           start by similarity
          Length = 553

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 15/128 (11%)

Query: 299 VFLQVLAVNLAIDFYFYRELIFPVFRFIKFNYTSALS----SFYGTAPWHFHLLQSLPLI 354
           VF  + ++  AID +FY +L    F  + +N  SA      + +G  PW++++     L+
Sbjct: 221 VFAIISSIVAAIDSFFYGKLSVVPFNIVMYNIISANEDSGPNIFGVEPWYYYIQN---LL 277

Query: 355 LGWSTPLFLYGFFCSKTEKGREGLNSSMLQARIVVIINIIAFSLISHKEFRFLYILHPFF 414
           L +      +G        G   L+   L   + + +N+  F    HKE RFLY ++   
Sbjct: 278 LNFPITTLFFGVI------GFTQLSIWPLSGSLFIWLNV--FLAQPHKEERFLYPIYGII 329

Query: 415 LLFSSIAL 422
            L +++ L
Sbjct: 330 SLLAAVGL 337

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 2/35 (5%)

Query: 54 DEFWQTLEPAHHQAFGYGKLTWEW--DYGLRSYAF 86
          DE +   EP +    G+GK TWE+  +Y +RS+AF
Sbjct: 37 DETFNYWEPLNLLVRGFGKQTWEYSPEYSIRSWAF 71

>Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement
          Length = 508

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 68/160 (42%), Gaps = 21/160 (13%)

Query: 338 YGTAPWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKGREGLNSSMLQARIVVIINIIAFS 397
           +G  P + H+L ++P ILG   P  +  FF S+  K    L S         I  ++  S
Sbjct: 258 HGLHPRYTHILFNVPQILG---PALI--FFFSRRYKLALPLLS--------CISGLVILS 304

Query: 398 LISHKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNGPLKYLVWAPPFFSIIASLLVSS 457
           L  H+E RFL  L P F +  +++   K+   E +        +W    F+I + +++  
Sbjct: 305 LFKHQELRFLVPLLPLFCISMNLSNFDKVIKWEHVIK------LWL--LFNICSGIIMGG 356

Query: 458 YHETGVTEVTKYLHHIPRIHSVGFIMPCHSTPWQSYIHRN 497
            H+ GV     +L        V      +S P   Y+++N
Sbjct: 357 LHQRGVILAIDHLRTSSDTAGVHVWWKTYSPPTWMYMNKN 396

>CAGL0K09548g complement(940088..941578) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein, hypothetical start
          Length = 496

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 95/236 (40%), Gaps = 55/236 (23%)

Query: 289 LTVLVRKLLLVFLQVLAVNLAIDFYFY--------RELIFPVFRFIKFNYTSALSSFYGT 340
           L VL RK + + +  +++ L+     Y         E+I    + + +N      + +G 
Sbjct: 200 LKVLYRKWIQMVVIAVSMTLSTSIIVYFDTFMYESDEIIIAPLKNVVYNLNVDNLAKHGL 259

Query: 341 APWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKGREGLNSSMLQARIVVIINIIAFSLIS 400
            P + HLL ++PLILG   P    G    +  K  + LN  +L     +I ++   S + 
Sbjct: 260 HPRYTHLLVNIPLILG---P----GLLMIRNTKN-DFLNLPLLS----IISSLFFLSALR 307

Query: 401 HKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNGPLKYLVWAPPFFSIIASLLVSSYHE 460
           H+E RFL    P   LFS++        L +    P  + +W    F+    +++  +H+
Sbjct: 308 HQELRFLL---PVVPLFSTL--------LTRFRYRPYLFRIWL--VFNAAMCIIMGIFHQ 354

Query: 461 TGVTEVTKYLHHIPRIHSVGFIMPCHSTPWQSYIHRNDIQDIWSITCEPPLFLLED 516
            GV         IP I ++                ++   DIW  T  PP +L  +
Sbjct: 355 GGV---------IPMISNIN-------------AEQDLTIDIWWKTYSPPTWLYNN 388

>ABL185C [407] [Homologous to ScYNL219C (ALG9) - SH] (60000..61658)
           [1659 bp, 552 aa]
          Length = 552

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 56/129 (43%), Gaps = 15/129 (11%)

Query: 297 LLVFLQVLAVNLAIDFYFYRELIFPVFRFIKFNY--TSALSS--FYGTAPWHFHLLQSLP 352
           +LV   +L     +D  FYR L    +  +K+N   TSA S    +GT PW++++   L 
Sbjct: 218 VLVLSMILGCVFVVDSIFYRRLTLVPWNIVKYNVLGTSADSGPHIFGTEPWYYYVFSLLL 277

Query: 353 LILGWSTPLFLYGFFCSKTEKGREGLNSSMLQARIVVIINIIAFSLISHKEFRFLYILHP 412
            +   +    +              L++++      +   ++ F    HKE RF+Y ++ 
Sbjct: 278 NLPLPTLIFAIVAL-----------LHTNLWPVWCSLFAWLVVFIAQPHKEERFMYPIYA 326

Query: 413 FFLLFSSIA 421
           F  L SSI 
Sbjct: 327 FVTLASSIG 335

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 54 DEFWQTLEPAHHQAFGYGKLTWEW--DYGLRSYAFPFIFEIL 93
          DE +   EP +    G+GK TWE+  +Y +RS+AF    ++L
Sbjct: 32 DETFNYWEPLNLLVRGFGKQTWEYSPEYSIRSWAFLMPLQVL 73

>YNR030W (ECM39) [4612] chr14 (678798..680453) Protein involved in
           the dolichol pathway for N-glycosylation, member of a
           family of mannosyltransferases [1656 bp, 551 aa]
          Length = 551

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 7/115 (6%)

Query: 305 AVNLAIDFYFYRELIFPVFRFIKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTPLFLY 364
           A+++ +D YF++E   P      FN  +  +S +G  P   +    L ++    T L L 
Sbjct: 238 AISITVDSYFWQEWCLPEVDGFLFNVVAGYASKWGVEPVTAYFTHYLRMMFMPPTVLLL- 296

Query: 365 GFFCSKTEKGREGLNSSMLQARIVVIINIIAFSLISHKEFRFLYILHPFFLLFSS 419
            +F  K    +  + S      +  + +II  S   HKE+RF+    P  +L  +
Sbjct: 297 NYFGYKLAPAKLKIVS------LASLFHIIVLSFQPHKEWRFIIYAVPSIMLLGA 345

>Scas_606.6
          Length = 571

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 10/47 (21%)

Query: 50 YFQP--------DEFWQTLEPAHHQAFGYGKLTWEW--DYGLRSYAF 86
          YFQP        DE +   EP +    G+GK TWE+  +Y +RS+AF
Sbjct: 25 YFQPFNSLISDCDETFNYWEPLNLLLRGFGKQTWEYSPEYSIRSWAF 71

>AAR043C [229] [Homologous to ScYNR030W (ECM39) - SH]
           (418301..419914) [1614 bp, 537 aa]
          Length = 537

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 67/158 (42%), Gaps = 15/158 (9%)

Query: 304 LAVNLAIDFYFYRELIFPVFRFIKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTPLFL 363
           L ++  ID YF+     P      FN     S+ +GT P   +  + LP +  +  P+  
Sbjct: 234 LGLSATIDSYFWGRSCVPEMDAFVFNVIGGQSAKWGTEPLLAYFTRYLPRL--FFPPMVT 291

Query: 364 YGFFCSKTEKGREGLNSSMLQARIVV---IINIIAFSLISHKEFRFLYILHPFFLLFSSI 420
              FC        G+  +    RIV    +I+I+  SL  HKE+RF+    P   L  S+
Sbjct: 292 --VFCIA------GVRIASTPFRIVFAASLIHIMLLSLQPHKEWRFIIYSVPAITLLGSM 343

Query: 421 ALGPKIPTLE-KMSNG-PLKYLVWAPPFFSIIASLLVS 456
                      + +NG  ++ L+   P   ++ S+L+S
Sbjct: 344 GAAYLFSLANWRQANGFSMRILILISPLLMLMHSVLMS 381

>Scas_651.11
          Length = 451

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 34/114 (29%)

Query: 499 IQDIWSITCEPPLFLLEDPDAEKL----LASYMDESDLLYDNVPKFIYQNMPPVFRKELR 554
           I D  SITCE   +L+E+ +   +    L S+ D  DL+ +NV             KE+ 
Sbjct: 101 ILDGTSITCERRTWLVEECEKHNIQPMFLESWSDNEDLIMENV-------------KEIN 147

Query: 555 SPSKEYSHEWPEYLIIFQQLD-DTFMKDFLKDSAYSEEARFFNTWSHWDSRRSG 607
           + S +Y+H           LD  +  +DF+K   Y E+      +  +DS + G
Sbjct: 148 TKSPDYAH-----------LDVASATRDFMKKIEYYEKV-----YETFDSEKDG 185

>YNL219C (ALG9) [4385] chr14 complement(235995..237662)
          Mannosyltransferase involved in N-glycosylation,
          catalyzes transfer of mannose from Dol-P-Man to
          lipid-linked oligosaccharides [1668 bp, 555 aa]
          Length = 555

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 5/45 (11%)

Query: 54 DEFWQTLEPAHHQAFGYGKLTWEW--DYGLRSYAF--PFIFEILY 94
          DE +   EP +    G+GK TWE+  +Y +RS+AF  PF + ILY
Sbjct: 32 DETFNYWEPLNLLVRGFGKQTWEYSPEYSIRSWAFLLPF-YCILY 75

>AFR395C [3587] [Homologous to ScYOR149C (SMP3) - SH]
          (1145381..1146967) [1587 bp, 528 aa]
          Length = 528

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 49 SYFQPDEFWQTLEPAHHQAFGY-GKLTWEW--DYGLRSYAFPFIF 90
          +Y  PDE  Q++E    + FG  G + WE+  +Y  RS+A  +IF
Sbjct: 52 AYVHPDEHMQSVEVMMQKIFGLRGTVPWEFQPEYAARSFAPLWIF 96

>CAGL0E00913g complement(83601..85178) similar to sp|P06101
           Saccharomyces cerevisiae YDR168w cell division control
           protein, start by similarity
          Length = 525

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 6/112 (5%)

Query: 474 PRIHSVGFIMPCHSTPWQSYIHRNDIQDIWSITCEPPLFLLEDPDAEKLLASYMDESDLL 533
           P +    FI     +  +    RN  QDI ++  +  ++   +   +KLL S  DE    
Sbjct: 23  PNVDKKSFIKWKQQSIHEQRFKRN--QDIKNLEAQVGMYSFLNKRVDKLLGSLADEDLAE 80

Query: 534 YDNVPKFIYQNMPPVFRKELRSPSKEYSHEWPEYLIIFQQLDDTFMKDFLKD 585
            D V KF+ +N    F K  +S  +    +   Y  + + L D   +D +KD
Sbjct: 81  QDKVTKFLNEN----FDKNEKSVGENVDPQIATYNEMVEDLFDQLRRDAIKD 128

>KLLA0D03344g 279652..281364 similar to sp|P32891 Saccharomyces
           cerevisiae YDL174c DLD1 D-lactate ferricytochrome C
           oxidoreductase (D-LCR), start by similarity
          Length = 570

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 9/74 (12%)

Query: 523 LASYMDESDLLYDNVPKFIYQNMPPVFRKELRSPSKEY-------SHEWPEYLIIFQQLD 575
           LA Y+  S  +  NVP+F++ +      ++LRSP  EY              L+I Q+ D
Sbjct: 39  LAGYVGSSITIAQNVPQFLFPSGSKTSLQDLRSP--EYLDPRFALDKFKSRLLLIVQEQD 96

Query: 576 DTFMKDFLKDSAYS 589
            +F K  L D +++
Sbjct: 97  LSFKKGDLDDHSFN 110

>YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein containing
           three MIR (protein mannosyltransferase, IP3R and RyR)
           domains, which may have a ligand transferase function,
           has weak similarity to mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase, S.
           cerevisiae Pmt1p) [1989 bp, 662 aa]
          Length = 662

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 95  RLVSVVSTIAEQIVAITVDCFVFTVSRIIPGSELAWSMVNEMQHFPQEIKSFLEY 149
           RL+S V     QI+   + C +F +  IIPGS    S  N + +F  +   F +Y
Sbjct: 221 RLISDVKVTTIQIIKFVILCLLFVL--IIPGSIFIISYSNLLSNFKTDTPQFSKY 273

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.141    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,073,116
Number of extensions: 886043
Number of successful extensions: 2614
Number of sequences better than 10.0: 38
Number of HSP's gapped: 2628
Number of HSP's successfully gapped: 46
Length of query: 609
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 502
Effective length of database: 12,891,983
Effective search space: 6471775466
Effective search space used: 6471775466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 65 (29.6 bits)