Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.347538237720110.0
Sklu_1484.137636111281e-154
KLLA0E14784g37934110241e-138
ADL282W3723248871e-117
YDL107W (MSS2)3513336973e-89
CAGL0H10296g3733666542e-82
Scas_613.123483516087e-76
Scas_705.5590783810.060
Kwal_23.367080272790.10
KLLA0B09262g94170790.10
YBR112C (SSN6)96683780.15
YHR166C (CDC23)62658740.43
CAGL0D01364g114883720.70
ADL344W91072710.87
CAGL0K08316g32381701.1
YBR055C (PRP6)89966691.6
AGL100W77557681.9
YGR198W81728663.3
Scas_579.639042663.5
Kwal_27.1029888228654.4
YBL050W (SEC17)29246644.9
Scas_716.5728784636.3
Kwal_27.1188344294646.7
YKR055W (RHO4)29168628.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3475
         (377 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3475                                                          779   0.0  
Sklu_1484.1 YDL107W, Contig c1484 197-1327 reverse complement         439   e-154
KLLA0E14784g complement(1321041..1322180) similar to sp|P40990 S...   399   e-138
ADL282W [1459] [Homologous to ScYDL107W (MSS2) - SH] complement(...   346   e-117
YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in t...   273   3e-89
CAGL0H10296g complement(1004900..1006021) similar to sp|P40990 S...   256   2e-82
Scas_613.12                                                           238   7e-76
Scas_705.55                                                            36   0.060
Kwal_23.3670                                                           35   0.10 
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    35   0.10 
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    35   0.15 
YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component...    33   0.43 
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    32   0.70 
ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH] complement(...    32   0.87 
CAGL0K08316g 838393..839364 some similarities with sp|Q00246 Sac...    32   1.1  
YBR055C (PRP6) [245] chr2 complement(344562..347261) U4/U6.U5 tr...    31   1.6  
AGL100W [4212] [Homologous to ScYLR233C (EST1) - SH; ScYDR206W (...    31   1.9  
YGR198W (YGR198W) [2148] chr7 (894696..897149) Protein of unknow...    30   3.3  
Scas_579.6                                                             30   3.5  
Kwal_27.10298                                                          30   4.4  
YBL050W (SEC17) [145] chr2 (125090..125119,125236..126084) Prote...    29   4.9  
Scas_716.57                                                            29   6.3  
Kwal_27.11883                                                          29   6.7  
YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein...    28   8.4  

>Kwal_23.3475
          Length = 382

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/377 (100%), Positives = 377/377 (100%)

Query: 1   MRAHPGKMLNRSLQLTRLASSLAKKRPPFYEVFPQKKMVNKILFQLDSKLTFPKLYPVFE 60
           MRAHPGKMLNRSLQLTRLASSLAKKRPPFYEVFPQKKMVNKILFQLDSKLTFPKLYPVFE
Sbjct: 1   MRAHPGKMLNRSLQLTRLASSLAKKRPPFYEVFPQKKMVNKILFQLDSKLTFPKLYPVFE 60

Query: 61  SLYDNAGNRDPSELIPTSFKASDVMIMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMG 120
           SLYDNAGNRDPSELIPTSFKASDVMIMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMG
Sbjct: 61  SLYDNAGNRDPSELIPTSFKASDVMIMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMG 120

Query: 121 DNDAIALLAFSFLKNPGKHAPEDVLHAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAE 180
           DNDAIALLAFSFLKNPGKHAPEDVLHAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAE
Sbjct: 121 DNDAIALLAFSFLKNPGKHAPEDVLHAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAE 180

Query: 181 RYYLHFLELESETPRAGEVYGQLGLIYFRRPNLKEAERCFLSSIRLCPLEAVTHSYYHLA 240
           RYYLHFLELESETPRAGEVYGQLGLIYFRRPNLKEAERCFLSSIRLCPLEAVTHSYYHLA
Sbjct: 181 RYYLHFLELESETPRAGEVYGQLGLIYFRRPNLKEAERCFLSSIRLCPLEAVTHSYYHLA 240

Query: 241 QLYMDSEPLKARSLMESAASEGFRESFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECY 300
           QLYMDSEPLKARSLMESAASEGFRESFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECY
Sbjct: 241 QLYMDSEPLKARSLMESAASEGFRESFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECY 300

Query: 301 IGYFDCSIKMQDLKKARNCLTSLQKLSKTNDLFASAFKSFVDSRQETINKVNVFSVNTLS 360
           IGYFDCSIKMQDLKKARNCLTSLQKLSKTNDLFASAFKSFVDSRQETINKVNVFSVNTLS
Sbjct: 301 IGYFDCSIKMQDLKKARNCLTSLQKLSKTNDLFASAFKSFVDSRQETINKVNVFSVNTLS 360

Query: 361 DGIKLANEAKDTNTSKD 377
           DGIKLANEAKDTNTSKD
Sbjct: 361 DGIKLANEAKDTNTSKD 377

>Sklu_1484.1 YDL107W, Contig c1484 197-1327 reverse complement
          Length = 376

 Score =  439 bits (1128), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 203/361 (56%), Positives = 274/361 (75%)

Query: 17  RLASSLAKKRPPFYEVFPQKKMVNKILFQLDSKLTFPKLYPVFESLYDNAGNRDPSELIP 76
           RL S  A +RPPFY+VFPQKK+VNK+LF+LDS+LTFPKLYP++ESLY+   +      +P
Sbjct: 11  RLISHNASRRPPFYDVFPQKKLVNKLLFELDSRLTFPKLYPLYESLYNTMDDAQSQVKVP 70

Query: 77  TSFKASDVMIMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMGDNDAIALLAFSFLKNP 136
           TS  ASD+M+MKKVLEK+RHRTKS NKNL+ LENE+L  AAEMG+NDAI+LLAF  LK+ 
Sbjct: 71  TSVTASDIMVMKKVLEKLRHRTKSINKNLLALENEILNKAAEMGNNDAISLLAFDTLKDS 130

Query: 137 GKHAPEDVLHAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAERYYLHFLELESETPRA 196
             ++ ED+ +AK LIKELYQL+HPLT+KLT DL  K+N   +AE+YY  FL LE +T  A
Sbjct: 131 DSNSHEDIAYAKTLIKELYQLRHPLTVKLTGDLTFKNNDLINAEKYYKDFLALEDDTFLA 190

Query: 197 GEVYGQLGLIYFRRPNLKEAERCFLSSIRLCPLEAVTHSYYHLAQLYMDSEPLKARSLME 256
           GEVYGQLG I FR+PNL +AE  FL SI+LCPLE   HSY++L Q+YM+S+PLKAR+L+E
Sbjct: 191 GEVYGQLGQISFRKPNLFKAEDYFLKSIKLCPLEYSVHSYFYLGQMYMNSQPLKARALLE 250

Query: 257 SAASEGFRESFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECYIGYFDCSIKMQDLKKA 316
           S A++GF+ESF++LGFLEMNYF DY+KA +WF+LGMEL++ EC++GYFDC +K+++   A
Sbjct: 251 STATQGFKESFKILGFLEMNYFEDYSKAQEWFKLGMELFEMECFVGYFDCCVKLEEWVNA 310

Query: 317 RNCLTSLQKLSKTNDLFASAFKSFVDSRQETINKVNVFSVNTLSDGIKLANEAKDTNTSK 376
           + C  S+  L ++N  +   + +FV +R++ + K+  +S N + D +     AK    SK
Sbjct: 311 KRCFNSMTTLLQSNTNYEPVYSNFVTTRKDKLEKLEKYSTNVVMDSMHAVEAAKRQEVSK 370

Query: 377 D 377
           +
Sbjct: 371 E 371

>KLLA0E14784g complement(1321041..1322180) similar to sp|P40990
           Saccharomyces cerevisiae YDL107w MSS2 ser/thr protein
           kinase singleton, start by similarity
          Length = 379

 Score =  399 bits (1024), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/341 (55%), Positives = 256/341 (75%), Gaps = 1/341 (0%)

Query: 17  RLASSLAKKRPPFYEVFPQKKMVNKILFQLDSKLTFPKLYPVFESLYDNAGNRDPSELIP 76
           RL SSLA KRPP +E+FPQKKMV++ILF+LDS+L + KLYP++E LY+     +  + IP
Sbjct: 14  RLISSLANKRPPLHEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLYEGLDTGNDVD-IP 72

Query: 77  TSFKASDVMIMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMGDNDAIALLAFSFLKNP 136
            S K  D+MIMKKVLEK+RH+TK+ NKNL+ LEN LL+ AAE+GDNDAI+LL F  LK+P
Sbjct: 73  NSIKGKDLMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDAISLLCFDVLKDP 132

Query: 137 GKHAPEDVLHAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAERYYLHFLELESETPRA 196
             +  +DV HAK LIK LYQ+ HPLT+KLTAD+A+K++    AE YY+ FL+L+++T  A
Sbjct: 133 DSNTEDDVSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYMKFLDLQNDTFLA 192

Query: 197 GEVYGQLGLIYFRRPNLKEAERCFLSSIRLCPLEAVTHSYYHLAQLYMDSEPLKARSLME 256
           GEVYGQLG I+FR+PNL EAE+CFL SI+LCP++    SY+ L Q+Y++++  KAR L+E
Sbjct: 193 GEVYGQLGQIHFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYVNNDIFKARYLIE 252

Query: 257 SAASEGFRESFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECYIGYFDCSIKMQDLKKA 316
           S+A++GF+ESF+ LG LEMNYF +Y KA +WF+LGMELY  EC++GYFDC++K  +L  A
Sbjct: 253 SSATQGFKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYFDCTMKNNELLLA 312

Query: 317 RNCLTSLQKLSKTNDLFASAFKSFVDSRQETINKVNVFSVN 357
           + C  S++KL++ N      F+ F   R   I K+  +S N
Sbjct: 313 KRCYESMEKLAENNQDVNRLFEDFSSHRASDIQKIKEYSPN 353

>ADL282W [1459] [Homologous to ScYDL107W (MSS2) - SH]
           complement(206313..207431) [1119 bp, 372 aa]
          Length = 372

 Score =  346 bits (887), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 169/324 (52%), Positives = 227/324 (70%)

Query: 26  RPPFYEVFPQKKMVNKILFQLDSKLTFPKLYPVFESLYDNAGNRDPSELIPTSFKASDVM 85
           RPP +++FP KK+VN++LF LDS+LTF KL PV+E +Y    +     ++P   +A DVM
Sbjct: 24  RPPLHKIFPSKKLVNRMLFDLDSRLTFRKLLPVYEQVYTQLDSSTGDLVVPRGVRAHDVM 83

Query: 86  IMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMGDNDAIALLAFSFLKNPGKHAPEDVL 145
           IMKKVLEK R RTKS+N++L+ LENELL  AA+MG  DA ALLAF  L NP      D+ 
Sbjct: 84  IMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHKDAAALLAFDTLCNPASQTAADME 143

Query: 146 HAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAERYYLHFLELESETPRAGEVYGQLGL 205
           +AK ++K+ Y+  HPLT+KLT DL++ +     AE YY+ FL+ E++T  AGEVYGQLG 
Sbjct: 144 YAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEYYMKFLKKEADTFLAGEVYGQLGR 203

Query: 206 IYFRRPNLKEAERCFLSSIRLCPLEAVTHSYYHLAQLYMDSEPLKARSLMESAASEGFRE 265
           I F R +  +AE  FL +I+L PLE    SY++L QLYM+S+PLKARSL+ESAAS+GF+E
Sbjct: 204 ISFLRSHFAQAEERFLQAIKLTPLEYSVQSYFYLGQLYMNSDPLKARSLLESAASQGFKE 263

Query: 266 SFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECYIGYFDCSIKMQDLKKARNCLTSLQK 325
           SF+ LG LEMNYF D  KA +WF+LGMEL + EC IG FDC+I + DL  A     SL+ 
Sbjct: 264 SFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIGCFDCAITLGDLALAHRASKSLEA 323

Query: 326 LSKTNDLFASAFKSFVDSRQETIN 349
           L+KT+ ++ + +  F D R E ++
Sbjct: 324 LAKTDKIYQALYTQFADYRHEKLS 347

>YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in
           translocation of the Cox2p C-terminal end across the
           mitochondrial inner membrane [1056 bp, 351 aa]
          Length = 351

 Score =  273 bits (697), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 139/333 (41%), Positives = 220/333 (66%), Gaps = 12/333 (3%)

Query: 27  PP----FYEVFPQKKMVNKILFQLDSKLTFPKLYPVFESLYDNAGNRD-PSELIPTSFKA 81
           PP    F E+FP+K+ VNKILFQLD++LT+ ++YP+F  +  N    + P        ++
Sbjct: 12  PPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQNTNEENIPWRKKYPYIRS 71

Query: 82  SDVMIMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMGDNDAIALLAFSFL-----KNP 136
           SD+M M+ VL  +R + K  +K+L+ +E++LL  AAE+G+NDAI++L+F+ +     +N 
Sbjct: 72  SDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISILSFNVIHEYKKENV 131

Query: 137 GKHAPEDVLHAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAERYYLHFLELESETPRA 196
                +D+  A   IK+LY   H LT+KL  DL  ++  ++ AE+YY  FL+LE+ T  A
Sbjct: 132 KSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYYQEFLKLENSTKLA 191

Query: 197 GEVYGQLGLIYFRRPN-LKEAERCFLSSIRLCPLEAVTHSYYHLAQLYMDSEPLKARSLM 255
           GEV+G+LG I  ++ N   +AE+ +LS I L  +E  +  Y+ LA+LYM SEP+KA++L+
Sbjct: 192 GEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARLYMSSEPMKAKALL 251

Query: 256 ESAASEGFRESFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECYIGYFDCSIKMQDLKK 315
           E+ AS GF+E F+ LGFLE+NYF++Y +A +WF+ GME+   EC+ G+FDC +K ++ K 
Sbjct: 252 ENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFGFFDCCVKEENFKG 311

Query: 316 ARNCLTSLQKLSKTNDLFASAFKSFVDSRQETI 348
           AR+CL S++KL    D   +    F++SR+++I
Sbjct: 312 ARDCLESVKKLGNDKDK-KTMINVFLESRKDSI 343

>CAGL0H10296g complement(1004900..1006021) similar to sp|P40990
           Saccharomyces cerevisiae YDL107w MSS2 ser/thr protein
           kinase, hypothetical start
          Length = 373

 Score =  256 bits (654), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 151/366 (41%), Positives = 223/366 (60%), Gaps = 34/366 (9%)

Query: 18  LASSLAKKRP----------PFYEVFPQKKMVNKILFQLDSKLTFPKLYPVFESLYDNAG 67
             S   KK+P           F E FP+KK +NK+LF L+S+LT+ KLYP++  LY    
Sbjct: 3   FVSQFLKKKPDVLGTLEVSKKFMEHFPKKKTINKLLFDLNSRLTYKKLYPIYVGLYHGVP 62

Query: 68  NRDPSELIPTSFKASDVMIMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMGDNDAIAL 127
                +L+    K SD+++M+ VLEK+R+RT+    +++ LE++LLE AAE+G+NDAIA+
Sbjct: 63  VPQQQKLLD-GVKGSDLIVMRNVLEKVRNRTRYARPDMLKLEDKLLELAAELGNNDAIAI 121

Query: 128 LAF-SFLKNPGKHAP-----EDVLHAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAER 181
           L+F S  +N G ++      E+V  AK L K+LY + H L IKL  DLA+++N++E+A  
Sbjct: 122 LSFRSIRENMGTNSAAEANNEEVTIAKKLFKDLYNINHLLAIKLLGDLALEANNWEEALT 181

Query: 182 YYLHFLE---------LESETPRAGEVYGQLGLIYFRR-PNLKEAERCFLSSIRLCPLEA 231
           +Y  ++          L       GEVYG+LG I F    N+ +AE  +   + L  +E 
Sbjct: 182 FYNKYINIAVKDNGHLLTGNDDLTGEVYGKLGEIEFTYLANMTKAEEYWQKCLELTSVED 241

Query: 232 VTHSYYHLAQLYMDSEPLKARSLMESAASEGFRESFQLLGFLEMNYFHDYAKALQWFRLG 291
               Y+  AQ+YM SEPLK+R L+E AAS+GF+ES   LGFLEMNYF DY +A +WF+LG
Sbjct: 242 SVRWYFLAAQIYMSSEPLKSRILLEKAASQGFKESLTSLGFLEMNYFRDYGRAKEWFKLG 301

Query: 292 MELYQFECYIGYFDCSIKMQDLKKARNCLTSLQKLSKTNDLFAS------AFKSFVDSRQ 345
           ME+++ + YIG+FDC +K +D   A  CL S++K+  T + F S         +F++SR 
Sbjct: 302 MEVFELQSYIGFFDCCVKNEDWIAALKCLKSIEKIG-TMESFGSDNTNKATVSNFMNSRA 360

Query: 346 ETINKV 351
           E I+KV
Sbjct: 361 EFIDKV 366

>Scas_613.12
          Length = 348

 Score =  238 bits (608), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 126/351 (35%), Positives = 207/351 (58%), Gaps = 15/351 (4%)

Query: 9   LNRSLQLTRLASSLAKKRPPFYEVFPQKKMVNKILFQLDSKLTFPKLYPVFESLYDNAGN 68
           +NR + + R+A+       PF+E+FP+K+++N+ILF+LDS  T+  LYP FE+LY     
Sbjct: 1   MNRVI-IRRIATKSTSTLRPFHEIFPRKRLINRILFELDSNDTYKTLYPNFETLY----- 54

Query: 69  RDPSELIPTSFKASDVMIMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMGDNDAIALL 128
                 +P++     +++M +VL ++  + K  N+ L+ +  ELLE AA  G+NDAI+ +
Sbjct: 55  --LKHELPSTVSGPQLLLMDRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAISTV 112

Query: 129 AFSFLKNPGKHAPEDVLHAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAERYYLHFLE 188
            ++ L +P   +  D   A  LI EL +  + LT K   DL+       +A+ +Y  F+E
Sbjct: 113 CYNILSSPKDDSKGDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLWYDKFME 172

Query: 189 LE-------SETPRAGEVYGQLGLIYFRRPNLKEAERCFLSSIRLCPLEAVTHSYYHLAQ 241
                    S+    G+V  +LG I F +  +  AE+ +L +I    LE    SY++L++
Sbjct: 173 CVDQDETRVSDVSIIGQVLERLGEIEFNQSRVLGAEKYWLDAIARSKLEDSVKSYFYLSK 232

Query: 242 LYMDSEPLKARSLMESAASEGFRESFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECYI 301
           +Y++SEPLK+R L+E+ A++GFRESF+ LG+LE+NYF +  KA +WFRLGMEL++ EC+ 
Sbjct: 233 VYLNSEPLKSRVLLENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMELFEIECFF 292

Query: 302 GYFDCSIKMQDLKKARNCLTSLQKLSKTNDLFASAFKSFVDSRQETINKVN 352
           G+FD   ++++ K    CL SL+     N+ + +    FV  R+  IN +N
Sbjct: 293 GFFDSCYQLKEYKSCSKCLKSLETFKNINESYKNMVSEFVSHRENKINNMN 343

>Scas_705.55
          Length = 907

 Score = 35.8 bits (81), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 142 EDVLHAKNLIKE-LYQLQHPLTIKLTADLAV---KSNHFEDAERYYLHFLELESETPRAG 197
           +D+  A N  ++ LY L +P   KL   + +   +    + AE  +   LEL+ +  +A 
Sbjct: 138 DDLQRAYNSYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKAN 197

Query: 198 EVYGQLGLIYFRRPNLKEAERCF 220
           E+Y +LG+IY  +    +A  CF
Sbjct: 198 EIYFRLGIIYKHQGKWTQALECF 220

>Kwal_23.3670
          Length = 802

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 152 KELYQLQHPLTIKLTADLAV---KSNHFEDAERYYLHFLELESETPRAGEVYGQLGLIYF 208
           + LY L +P   KL   + +   +    + AE  +   LEL+ +  +A E+Y +LG+IY 
Sbjct: 159 QALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYK 218

Query: 209 RRPNLKEAERCF 220
            +    +A  CF
Sbjct: 219 HQGKWNQALECF 230

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8 general repressor
           of transcription singleton, hypothetical start
          Length = 941

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 154 LYQLQHPLTIKLTADLAV---KSNHFEDAERYYLHFLELESETPRAGEVYGQLGLIYFRR 210
           LY L +P   KL   + +   +    + AE  +   LEL+ +  +A E+Y +LG+IY  +
Sbjct: 203 LYHLSNPNIPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQ 262

Query: 211 PNLKEAERCF 220
               +A  CF
Sbjct: 263 GKWNQALECF 272

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by sequence-specific
           DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex
           undergoes Hog1p-dependent conversion to a
           transcriptional activator [2901 bp, 966 aa]
          Length = 966

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 142 EDVLHAKNLIKE-LYQLQHPLTIKLTADLAV---KSNHFEDAERYYLHFLELESETPRAG 197
           +D+  A N  ++ LY L +P   KL   + +   +    + AE  +   LEL+    +A 
Sbjct: 128 DDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKAN 187

Query: 198 EVYGQLGLIYFRRPNLKEAERCF 220
           E+Y +LG+IY  +    +A  CF
Sbjct: 188 EIYFRLGIIYKHQGKWSQALECF 210

>YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component of
           anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [1881 bp, 626 aa]
          Length = 626

 Score = 33.1 bits (74), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 194 PRAGEVYGQLGLIYFRRPNLKEAERCFLSSIRLC-PLEAVTHSYYHLAQLYMDSEPLK 250
           P    ++  LG  Y +  N  EA +C+  SI+    ++  T  YY LAQLY + E L+
Sbjct: 496 PWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKASQTVDQNTSIYYRLAQLYEELEDLQ 553

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
           cerevisiae YBR112c CYC8 general repressor of
           transcription, hypothetical start
          Length = 1148

 Score = 32.3 bits (72), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 142 EDVLHAKNLIKE-LYQLQHPLTIKLTADLAV---KSNHFEDAERYYLHFLELESETPRAG 197
           +D+  A N  ++ LY L +P   KL   + +   +    + AE  +   LEL+    +A 
Sbjct: 130 DDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKAN 189

Query: 198 EVYGQLGLIYFRRPNLKEAERCF 220
           E+Y +LG+IY  +    +A  CF
Sbjct: 190 EIYFRLGIIYKHQGKWSQALECF 212

>ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH]
           complement(103567..106299) [2733 bp, 910 aa]
          Length = 910

 Score = 32.0 bits (71), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 3/72 (4%)

Query: 152 KELYQLQHPLTIKLTADLAV---KSNHFEDAERYYLHFLELESETPRAGEVYGQLGLIYF 208
           + LY L +P   KL   + +   +    + AE  +   LEL+    +  E+Y +LG+IY 
Sbjct: 155 QALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKVNEIYFRLGIIYK 214

Query: 209 RRPNLKEAERCF 220
            +    +A  CF
Sbjct: 215 HQGKWNQALECF 226

>CAGL0K08316g 838393..839364 some similarities with sp|Q00246
           Saccharomyces cerevisiae YKR055w RHO4 GTP-binding
           protein, hypothetical start
          Length = 323

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 14/81 (17%)

Query: 48  SKLTFPKLYPVFESLYDNAGNRDPSELIPTSFKASDVMIMKKVLEKI------------- 94
           + +  PK   +  +L+D AG  + S L P S+  +DV+++   ++ I             
Sbjct: 122 TNIQGPKGQIIELALWDTAGQEEYSRLRPLSYTGADVLMICYAIDSITSLKNVEDVWFPE 181

Query: 95  -RHRTKSTNKNLIGLENELLE 114
            RH    T   L+GL+++L E
Sbjct: 182 VRHFCPGTPVMLVGLKSDLYE 202

>YBR055C (PRP6) [245] chr2 complement(344562..347261) U4/U6.U5
           tri-snRNP-associated splicing factor, contains
           tetratricopeptide (TPR) repeats [2700 bp, 899 aa]
          Length = 899

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 194 PRAGEVYGQLGLIYFRRPNLKEAERCFLSSIRL---CPLEAVTHSYYHLAQLYMDSEPLK 250
           P   + + QLG IY    N++ +   +LS  RL   CPL  V+ S      L     P++
Sbjct: 665 PICHKFFLQLGQIYHSMGNIEMSRETYLSGTRLVPNCPLLWVSLSKIDEIDL---KNPVR 721

Query: 251 ARSLME 256
           ARS+++
Sbjct: 722 ARSILD 727

>AGL100W [4212] [Homologous to ScYLR233C (EST1) - SH; ScYDR206W
           (EBS1) - SH] complement(513807..516134) [2328 bp, 775
           aa]
          Length = 775

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 176 FEDAERYYLHFLELESETPRAGEVYGQLGLIYFRRPNLKEAERCFL-SSIRLCPLEA 231
           F+D+ RY   F+  +   P  GE Y Q GL+Y +  N   A   F+  S+   P +A
Sbjct: 200 FDDSMRY---FMLAKQIVPSVGETYLQEGLVYVQTGNYGHAAYAFMRGSLSRMPTDA 253

>YGR198W (YGR198W) [2148] chr7 (894696..897149) Protein of unknown
           function [2454 bp, 817 aa]
          Length = 817

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 20/28 (71%)

Query: 199 VYGQLGLIYFRRPNLKEAERCFLSSIRL 226
           ++  LG+++F R   +E++RC L S+++
Sbjct: 100 LFNCLGILFFHRGQFQESQRCLLHSLKI 127

>Scas_579.6
          Length = 390

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 20/42 (47%)

Query: 281 YAKALQWFRLGMELYQFECYIGYFDCSIKMQDLKKARNCLTS 322
           Y K    F +    Y   CY G FD + K++D K  +N  TS
Sbjct: 125 YMKKWNQFLVQNRAYNSRCYQGLFDLTDKLKDQKLQKNVGTS 166

>Kwal_27.10298
          Length = 882

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 161 LTIKLTADLAVKSNHFEDAERYYLHFLE 188
           + IKLTADL +K   F++ +R + HF E
Sbjct: 670 IPIKLTADLLLKKEKFDEIQRTFDHFRE 697

>YBL050W (SEC17) [145] chr2 (125090..125119,125236..126084) Protein
           required for fusion of vesicles to target membranes as
           well as for vacuolar fusion, homolog of mammalian
           alpha-SNAP (Soluble NSF Attachment Protein) [879 bp, 292
           aa]
          Length = 292

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 270 LGFLEMNYFHDYAKALQWFRLGMELYQFECYIGYFD-CSIKMQDLK 314
           LG +  N  HDYAKA+  + L  E Y  +  +   + C IK  DLK
Sbjct: 123 LGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLK 168

>Scas_716.57
          Length = 287

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 1/84 (1%)

Query: 110 NELLETAAEMGDNDAIALLAFS-FLKNPGKHAPEDVLHAKNLIKELYQLQHPLTIKLTAD 168
           NE       +GDND I +L     +   G+     VL    L+ E       + I +   
Sbjct: 105 NETHPETKAVGDNDPIDVLEIGESIAYTGQVKQVKVLGVMALLDEGETDWKVIAIDVNDP 164

Query: 169 LAVKSNHFEDAERYYLHFLELESE 192
           LA K N  ED E+Y+   L   +E
Sbjct: 165 LAPKMNDIEDVEKYFPGLLRATNE 188

>Kwal_27.11883
          Length = 442

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 39/94 (41%), Gaps = 3/94 (3%)

Query: 262 GFRESFQLLGFLEMNYF--HDYAKALQWFRLGMELYQFECYIGYFDCSIKMQDLKKARNC 319
           G  ES++ +   E  +F  H   +   W+       +  C +GY D    MQD  K    
Sbjct: 215 GDNESYRHMCRFESGFFWRHPALEDYDWYWRVEPDTKLHCDVGY-DVFKWMQDNDKVYGF 273

Query: 320 LTSLQKLSKTNDLFASAFKSFVDSRQETINKVNV 353
             S+++   T     +  + F+D   E I+K N+
Sbjct: 274 TISIKEFESTIPTLWATTREFIDKHPEHIHKDNM 307

>YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein,
           member of the rho family in the ras superfamily [876 bp,
           291 aa]
          Length = 291

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 14/68 (20%)

Query: 61  SLYDNAGNRDPSELIPTSFKASDVMI----------MKKV----LEKIRHRTKSTNKNLI 106
           +L+D AG  + S L P S+  +DV++          +K V      +++H   ST   L+
Sbjct: 124 ALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPIMLV 183

Query: 107 GLENELLE 114
           GL+++L E
Sbjct: 184 GLKSDLYE 191

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,866,828
Number of extensions: 502167
Number of successful extensions: 1707
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1724
Number of HSP's successfully gapped: 35
Length of query: 377
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 274
Effective length of database: 13,030,455
Effective search space: 3570344670
Effective search space used: 3570344670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)