Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.347340940420820.0
KLLA0E14806g40037612771e-176
YKL161C43332637.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3473
         (404 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3473                                                          806   0.0  
KLLA0E14806g 1322461..1323663 similar to ca|CA0218|IPF15294 Cand...   496   e-176
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    29   7.6  

>Kwal_23.3473
          Length = 409

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/404 (96%), Positives = 391/404 (96%)

Query: 1   MSLTKCFRRKWRLLDSRKTAFRSLATSSAGSVDYSHXXXXXXXXXXXXXSELSKIAGNKV 60
           MSLTKCFRRKWRLLDSRKTAFRSLATSSAGSVDYSH             SELSKIAGNKV
Sbjct: 1   MSLTKCFRRKWRLLDSRKTAFRSLATSSAGSVDYSHAVIGGGVVGLAVASELSKIAGNKV 60

Query: 61  VLIEKNPSTGLETSSRNSEVIHAGLYYPPSSLKTKLCLEGSSIIYNELTPFKTGVNWSKC 120
           VLIEKNPSTGLETSSRNSEVIHAGLYYPPSSLKTKLCLEGSSIIYNELTPFKTGVNWSKC
Sbjct: 61  VLIEKNPSTGLETSSRNSEVIHAGLYYPPSSLKTKLCLEGSSIIYNELTPFKTGVNWSKC 120

Query: 121 GKWIVAQTDADDAYLESLYQKATKDLGLPVEMIPAHKTKWIEPAVMVRRSALSSPTSGII 180
           GKWIVAQTDADDAYLESLYQKATKDLGLPVEMIPAHKTKWIEPAVMVRRSALSSPTSGII
Sbjct: 121 GKWIVAQTDADDAYLESLYQKATKDLGLPVEMIPAHKTKWIEPAVMVRRSALSSPTSGII 180

Query: 181 DSHSLMQYLSTGFDNNDGELAIGTEVIDIQHQEGRSYNILCQSTVNDSNEQVEIQVENIV 240
           DSHSLMQYLSTGFDNNDGELAIGTEVIDIQHQEGRSYNILCQSTVNDSNEQVEIQVENIV
Sbjct: 181 DSHSLMQYLSTGFDNNDGELAIGTEVIDIQHQEGRSYNILCQSTVNDSNEQVEIQVENIV 240

Query: 241 NAAGLYAHNVANMLLPKERHLKQYFAKGNYFSLSGSAFAPVRRLIYPVPPKNGKSLGTHL 300
           NAAGLYAHNVANMLLPKERHLKQYFAKGNYFSLSGSAFAPVRRLIYPVPPKNGKSLGTHL
Sbjct: 241 NAAGLYAHNVANMLLPKERHLKQYFAKGNYFSLSGSAFAPVRRLIYPVPPKNGKSLGTHL 300

Query: 301 TIDLNGQMRFGPDLEYVDSPSDYDVNTSNLVPAYEAITKYYPHIQLTDLQPAYSGIRPKL 360
           TIDLNGQMRFGPDLEYVDSPSDYDVNTSNLVPAYEAITKYYPHIQLTDLQPAYSGIRPKL
Sbjct: 301 TIDLNGQMRFGPDLEYVDSPSDYDVNTSNLVPAYEAITKYYPHIQLTDLQPAYSGIRPKL 360

Query: 361 AGPGDTKFKDFYIREEDGLPGFVNLQGIESPGLTSSLAIGRYVR 404
           AGPGDTKFKDFYIREEDGLPGFVNLQGIESPGLTSSLAIGRYVR
Sbjct: 361 AGPGDTKFKDFYIREEDGLPGFVNLQGIESPGLTSSLAIGRYVR 404

>KLLA0E14806g 1322461..1323663 similar to ca|CA0218|IPF15294 Candida
           albicans unknown function, hypothetical start
          Length = 400

 Score =  496 bits (1277), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 239/376 (63%), Positives = 292/376 (77%), Gaps = 2/376 (0%)

Query: 29  AGSVDYSHXXXXXXXXXXXXXSELSKIAGNKVVLIEKNPSTGLETSSRNSEVIHAGLYYP 88
           +  VDYSH             +EL+K+ GNKV+++EKN   G ETSSRNSEVIHAGLYYP
Sbjct: 22  SAPVDYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNAKIGQETSSRNSEVIHAGLYYP 81

Query: 89  PSSLKTKLCLEGSSIIYNELTPFKTGVNWSKCGKWIVAQTDADDAYLESLYQKATKDLGL 148
             SLKTK C+EG+ IIYNEL P KTGV+W KCGKW+VAQTD +DAY+E +Y KA  +L L
Sbjct: 82  VDSLKTKFCIEGNHIIYNELNPRKTGVDWLKCGKWVVAQTDFEDAYVERMYYKAKYELNL 141

Query: 149 PVEMIPAHKTKWIEPAVMVRRSALSSPTSGIIDSHSLMQYLSTGFDNNDGELAIGTEVID 208
           PVE++P+HKT+W EPAV+V RSAL SPT+GIIDSHSL++YLS   DN  G+  IG+EV D
Sbjct: 142 PVEILPSHKTQWQEPAVIVERSALVSPTTGIIDSHSLIEYLSAMVDNQGGDTVIGSEVKD 201

Query: 209 IQHQEGRSYNILCQSTVNDSNEQVEIQVENIVNAAGLYAHNVANMLLPKERHLKQYFAKG 268
           IQ   G SY + C  T+N + E+VEI+VEN++NAAGLYA  +ANM+LP ER +KQY+AKG
Sbjct: 202 IQFL-GSSYALQCVETLNGTAEEVEIRVENVINAAGLYADKIANMILPPERQVKQYYAKG 260

Query: 269 NYFSLSGSAFAPVRRLIYPVPPKNGKSLGTHLTIDLNGQMRFGPDLEYVDSPSDYDVNTS 328
           NYF+ S +    VRRLIYPVPP+NGKSLGTHLTIDLN Q+RFGPDLEYVDS  D   N  
Sbjct: 261 NYFT-SKTQVPAVRRLIYPVPPRNGKSLGTHLTIDLNHQVRFGPDLEYVDSADDLIPNPL 319

Query: 329 NLVPAYEAITKYYPHIQLTDLQPAYSGIRPKLAGPGDTKFKDFYIREEDGLPGFVNLQGI 388
           N+  A + IT+Y+PH+Q  +L+ +Y GIRPKLA PGDT+FKDFYI+EE+G PGFVNL GI
Sbjct: 320 NIEDAAKTITRYFPHLQPGELEASYCGIRPKLAAPGDTEFKDFYIKEEEGFPGFVNLLGI 379

Query: 389 ESPGLTSSLAIGRYVR 404
           ESPGLTSS+ IGRYV+
Sbjct: 380 ESPGLTSSIPIGRYVK 395

>YKL161C (YKL161C) [3109] chr11 complement(149391..150692)
           Serine/threonine protein kinase with similarity to MAP
           kinases [1302 bp, 433 aa]
          Length = 433

 Score = 28.9 bits (63), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 214 GR-SYNILCQSTVNDSNEQVEIQVENIVNAAG 244
           GR S++++C ST  +SNE+  + +  I NA G
Sbjct: 30  GRGSHSLICSSTYTESNEETHVAIRKIPNAFG 61

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,374,127
Number of extensions: 586360
Number of successful extensions: 1419
Number of sequences better than 10.0: 7
Number of HSP's gapped: 1442
Number of HSP's successfully gapped: 7
Length of query: 404
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 300
Effective length of database: 12,995,837
Effective search space: 3898751100
Effective search space used: 3898751100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 63 (28.9 bits)