Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.347126025713780.0
ADL283W30625711921e-167
KLLA0E14828g31025711791e-165
Scas_613.13*31225411361e-158
CAGL0H10318g30725411131e-155
YDL108W (KIN28)30625411011e-153
KLLA0D11990g3042534893e-60
AGL242C3032564659e-57
KLLA0B09790g2952484571e-55
Scas_568.9*3062634572e-55
Kwal_27.118032462504513e-55
ADR058C2952464543e-55
CAGL0L12474g3022514544e-55
YBR160W (CDC28)2982494451e-53
Scas_721.462962464432e-53
CAGL0H07535g2982534413e-53
Scas_610.76683034336e-49
AFR205C4572524062e-46
Kwal_55.219006252934036e-45
CAGL0I08349g6672884021e-44
CAGL0L12650g5672683953e-44
Kwal_26.75524612523888e-44
ABR177C7532923952e-43
CAGL0D02002g5532553875e-43
KLLA0E10527g3712823742e-42
AFR019W3592553723e-42
CAGL0J00539g4882393784e-42
Kwal_27.118305752643806e-42
KLLA0D10527g6453063801e-41
Kwal_17.26873622593671e-41
Scas_721.1105202593733e-41
Kwal_27.119192091593492e-40
YKL139W (CTK1)5282573646e-40
Scas_667.184372713599e-40
Scas_680.204822553583e-39
YMR139W (RIM11)3702523523e-39
KLLA0B11902g4952393574e-39
CAGL0D01694g4322653545e-39
ADL315C4342573536e-39
KLLA0A02497g3622753481e-38
KLLA0B11946g4392453521e-38
Scas_688.144792643522e-38
KLLA0F17006g4152603492e-38
Scas_710.283522573443e-38
KLLA0D11814g5932683543e-38
Kwal_23.55765042393505e-38
YHR030C (SLT2)4842393495e-38
Kwal_56.238414322513466e-38
Kwal_14.14163652713427e-38
CAGL0J04290g3572663418e-38
YGR040W (KSS1)3682733428e-38
ACL191C3652613429e-38
Kwal_27.125594142703431e-37
YBL016W (FUS3)3532583391e-37
KLLA0E12177g4552633442e-37
Scas_713.384322513423e-37
AER232C5692643463e-37
Kwal_47.178683652533366e-37
Scas_683.63772723366e-37
Scas_623.113782533359e-37
YLR113W (HOG1)4352493381e-36
AGR048C4532493381e-36
KLLA0F20053g4442493371e-36
CAGL0K04169g3982733342e-36
AGL249C5812713384e-36
CAGL0M11748g4472493329e-36
ADR253W3802533272e-35
CAGL0L06820g3662533252e-35
YKL161C4332403222e-34
Scas_22.12482362954e-32
YDL079C (MRK1)5012502944e-30
Scas_678.134622562751e-27
YJL106W (IME2)6452812761e-27
Scas_711.157271962752e-27
Kwal_26.72766462772717e-27
CAGL0G04455g7511942718e-27
Kwal_55.220013632752614e-26
KLLA0E07414g3652552605e-26
KLLA0F02838g7551942655e-26
AFR076W8202052602e-25
CAGL0E01683g3752542553e-25
YNL307C (MCK1)3752552535e-25
ADL168C3622752535e-25
Scas_635.13782552474e-24
CAGL0M08910g6122552504e-24
AEL230W6082532434e-23
Scas_660.286232552419e-23
YDR477W (SNF1)6332532419e-23
Kwal_47.182335982402391e-22
KLLA0A03806g6022522373e-22
YOL128C (YGK3)3751822282e-21
ABR014W9711892285e-21
CAGL0K12496g3602252211e-20
Scas_493.211172282197e-20
YCL024W (KCC4)10371542162e-19
ADL102C3722492132e-19
KLLA0A05819g7042762162e-19
YJL141C (YAK1)8072742143e-19
ACR249C6432912133e-19
YDR507C (GIN4)11422282134e-19
CAGL0K08514g14891612119e-19
CAGL0J11638g7461902101e-18
Kwal_26.78619551892091e-18
Kwal_33.139846491612082e-18
CAGL0K02673g9151562082e-18
Scas_616.1014611612082e-18
Kwal_47.180983742532052e-18
CAGL0K05709g11032282073e-18
Scas_651.37931952064e-18
KLLA0B13607g9891552054e-18
YFL029C (CAK1)3681582034e-18
YKL101W (HSL1)15181612055e-18
Scas_707.73762212025e-18
CAGL0I05896g7781642046e-18
KLLA0F08877g3211392006e-18
Kwal_14.12493442332008e-18
ABL034W14251612012e-17
Scas_668.228931552002e-17
KLLA0C01650g11121542002e-17
Scas_648.173401741963e-17
AFR696C11421551993e-17
Kwal_55.217093401251954e-17
KLLA0E04136g3731251947e-17
YHL007C (STE20)9391551967e-17
ADR204W3391251929e-17
CAGL0G02035g3391771929e-17
AFR377C7261791951e-16
KLLA0F13552g12671611951e-16
Kwal_56.224766971601931e-16
AFR150C3492311912e-16
Scas_673.20*7581551932e-16
KLLA0F16467g3401251902e-16
Scas_698.373472421902e-16
Scas_704.503691661902e-16
YMR001C (CDC5)7051801922e-16
CAGL0M10153g8671551923e-16
Scas_644.157261781913e-16
YOR061W (CKA2)3392051893e-16
KLLA0E03487g6471511913e-16
Kwal_26.89416611891904e-16
AEL284C4791601894e-16
CAGL0L07810g5962441895e-16
YIL035C (CKA1)3721681876e-16
Scas_477.57031791896e-16
ADR313W5781561888e-16
ADR174C6711481879e-16
KLLA0C06138g7081601879e-16
Scas_692.247181741871e-15
Scas_201.1*2741511821e-15
Scas_711.2515151491871e-15
ABL011C7011821861e-15
Kwal_26.778812671681862e-15
Scas_613.55171761852e-15
YOR267C (HRK1)7592091842e-15
Kwal_33.141925771971842e-15
CAGL0L07326g5062531832e-15
CAGL0B02739g6762091833e-15
Kwal_26.735514462351843e-15
CAGL0K10604g4461511823e-15
ACL006W7081601834e-15
Kwal_0.964271511824e-15
CAGL0B01925g9441561834e-15
AER223C9021501834e-15
CAGL0I09504g5281551824e-15
Scas_700.348641641825e-15
YLR362W (STE11)7171931825e-15
CAGL0I05192g3732001805e-15
CAGL0F04741g4421511806e-15
Kwal_55.203267501841807e-15
YGL179C (TOS3)5601751807e-15
YDL101C (DUN1)5132791808e-15
KLLA0F14190g13381481808e-15
YDL025C6201451799e-15
AFR092W14231541801e-14
YJL095W (BCK1)14781541801e-14
KLLA0E01584g4151781781e-14
Kwal_33.144347591451781e-14
KLLA0F11319g8432441781e-14
Scas_598.67901631781e-14
Scas_678.2416101301782e-14
CAGL0J03828g4671661772e-14
CAGL0C02893g6491481762e-14
AEL205W7931631762e-14
Kwal_23.632515421591773e-14
YAR019C (CDC15)9741511763e-14
YDR283C (GCN2)16591801773e-14
AAR009W4531511753e-14
KLLA0B13112g7301731753e-14
CAGL0C05005g10761531763e-14
KLLA0C07535g6241741754e-14
CAGL0L03520g14471481746e-14
AFR335C10332761746e-14
KLLA0C04191g7971511736e-14
KLLA0A07403g8791631738e-14
CAGL0F09075g7461361729e-14
YNL298W (CLA4)8421631729e-14
Scas_693.1710491571729e-14
YOR233W (KIN4)8002371721e-13
YFR014C (CMK1)4461511711e-13
Scas_653.256661751721e-13
AGR058W10711571721e-13
Kwal_55.215458651531711e-13
CAGL0M03729g8611631711e-13
KLLA0F23155g4271631701e-13
Scas_640.14*7281631711e-13
ADL389W7111711711e-13
Scas_713.79831511711e-13
KLLA0E11979g6141421701e-13
Scas_618.84272301701e-13
KLLA0B03586g7341711702e-13
Scas_700.546982441702e-13
CAGL0M02233g7671691692e-13
Kwal_23.566816891351702e-13
Kwal_33.132221481221602e-13
KLLA0E06413g11612091692e-13
Scas_703.57491711692e-13
AEL118C6831491683e-13
CAGL0K01661g4821461683e-13
CAGL0H01199g16481141684e-13
Kwal_26.87098291641674e-13
Kwal_23.35904992731664e-13
ACR119W9312201675e-13
KLLA0C08525g15511591675e-13
Scas_700.354391271665e-13
YHR205W (SCH9)824981665e-13
Kwal_14.24974181441655e-13
YCR008W (SAT4)6032421665e-13
Scas_628.96211421666e-13
AAL083W16981011666e-13
KLLA0C03938g5932221656e-13
CAGL0J04972g3391521646e-13
YOL016C (CMK2)4471511656e-13
Kwal_33.138317001471657e-13
KLLA0C10802g16721411667e-13
KLLA0D08415g7741451658e-13
Scas_718.906472391648e-13
CAGL0M11396g11921581641e-12
CAGL0M02519g7561681641e-12
KLLA0F01276g5191681631e-12
KLLA0D07348g9091491641e-12
Kwal_47.167617441711631e-12
CAGL0F03707g6082091631e-12
Kwal_23.52908191631631e-12
CAGL0B04301g5422441621e-12
Kwal_0.3074901421612e-12
Kwal_14.12734151421602e-12
CAGL0J03872g6611591612e-12
YNL183C (NPR1)7901451613e-12
ACR117W5241221603e-12
CAGL0J11308g7281451613e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3471
         (257 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3471                                                          535   0.0  
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...   463   e-167
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...   458   e-165
Scas_613.13*                                                          442   e-158
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...   433   e-155
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...   428   e-153
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...   192   3e-60
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...   183   9e-57
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...   180   1e-55
Scas_568.9*                                                           180   2e-55
Kwal_27.11803                                                         178   3e-55
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...   179   3e-55
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...   179   4e-55
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...   176   1e-53
Scas_721.46                                                           175   2e-53
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...   174   3e-53
Scas_610.7                                                            171   6e-49
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...   160   2e-46
Kwal_55.21900                                                         159   6e-45
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...   159   1e-44
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...   156   3e-44
Kwal_26.7552                                                          154   8e-44
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...   156   2e-43
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...   153   5e-43
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...   148   2e-42
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...   147   3e-42
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...   150   4e-42
Kwal_27.11830                                                         150   6e-42
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...   150   1e-41
Kwal_17.2687                                                          145   1e-41
Scas_721.110                                                          148   3e-41
Kwal_27.11919                                                         139   2e-40
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...   144   6e-40
Scas_667.18                                                           142   9e-40
Scas_680.20                                                           142   3e-39
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...   140   3e-39
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...   142   4e-39
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...   140   5e-39
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...   140   6e-39
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...   138   1e-38
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...   140   1e-38
Scas_688.14                                                           140   2e-38
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...   139   2e-38
Scas_710.28                                                           137   3e-38
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...   140   3e-38
Kwal_23.5576                                                          139   5e-38
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...   139   5e-38
Kwal_56.23841                                                         137   6e-38
Kwal_14.1416                                                          136   7e-38
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...   135   8e-38
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...   136   8e-38
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...   136   9e-38
Kwal_27.12559                                                         136   1e-37
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...   135   1e-37
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...   137   2e-37
Scas_713.38                                                           136   3e-37
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...   137   3e-37
Kwal_47.17868                                                         134   6e-37
Scas_683.6                                                            134   6e-37
Scas_623.11                                                           133   9e-37
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...   134   1e-36
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...   134   1e-36
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...   134   1e-36
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...   133   2e-36
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...   134   4e-36
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...   132   9e-36
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...   130   2e-35
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...   129   2e-35
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...   128   2e-34
Scas_22.1                                                             118   4e-32
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...   117   4e-30
Scas_678.13                                                           110   1e-27
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...   110   1e-27
Scas_711.15                                                           110   2e-27
Kwal_26.7276                                                          108   7e-27
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...   108   8e-27
Kwal_55.22001                                                         105   4e-26
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...   104   5e-26
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...   106   5e-26
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...   104   2e-25
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...   102   3e-25
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...   102   5e-25
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...   102   5e-25
Scas_635.1                                                            100   4e-24
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   100   4e-24
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    98   4e-23
Scas_660.28                                                            97   9e-23
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    97   9e-23
Kwal_47.18233                                                          97   1e-22
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    96   3e-22
YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of t...    92   2e-21
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    92   5e-21
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    90   1e-20
Scas_493.2                                                             89   7e-20
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    88   2e-19
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    87   2e-19
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    88   2e-19
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    87   3e-19
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    87   3e-19
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    87   4e-19
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    86   9e-19
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    86   1e-18
Kwal_26.7861                                                           85   1e-18
Kwal_33.13984                                                          85   2e-18
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    85   2e-18
Scas_616.10                                                            85   2e-18
Kwal_47.18098                                                          84   2e-18
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    84   3e-18
Scas_651.3                                                             84   4e-18
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    84   4e-18
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    83   4e-18
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    84   5e-18
Scas_707.7                                                             82   5e-18
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    83   6e-18
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    82   6e-18
Kwal_14.1249                                                           82   8e-18
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    82   2e-17
Scas_668.22                                                            82   2e-17
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    82   2e-17
Scas_648.17                                                            80   3e-17
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    81   3e-17
Kwal_55.21709                                                          80   4e-17
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    79   7e-17
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    80   7e-17
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    79   9e-17
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    79   9e-17
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    80   1e-16
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    80   1e-16
Kwal_56.22476                                                          79   1e-16
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    78   2e-16
Scas_673.20*                                                           79   2e-16
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    78   2e-16
Scas_698.37                                                            78   2e-16
Scas_704.50                                                            78   2e-16
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    79   2e-16
CAGL0M10153g complement(1010688..1013291) some similarities with...    79   3e-16
Scas_644.15                                                            78   3e-16
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    77   3e-16
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    78   3e-16
Kwal_26.8941                                                           78   4e-16
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    77   4e-16
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    77   5e-16
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    77   6e-16
Scas_477.5                                                             77   6e-16
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    77   8e-16
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    77   9e-16
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    77   9e-16
Scas_692.24                                                            77   1e-15
Scas_201.1*                                                            75   1e-15
Scas_711.25                                                            77   1e-15
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    76   1e-15
Kwal_26.7788                                                           76   2e-15
Scas_613.5                                                             76   2e-15
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    75   2e-15
Kwal_33.14192                                                          75   2e-15
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    75   2e-15
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    75   3e-15
Kwal_26.7355                                                           75   3e-15
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    75   3e-15
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    75   4e-15
Kwal_0.96                                                              75   4e-15
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    75   4e-15
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    75   4e-15
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    75   4e-15
Scas_700.34                                                            75   5e-15
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    75   5e-15
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    74   5e-15
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    74   6e-15
Kwal_55.20326                                                          74   7e-15
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    74   7e-15
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    74   8e-15
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    74   8e-15
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    74   9e-15
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    74   1e-14
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    74   1e-14
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    73   1e-14
Kwal_33.14434                                                          73   1e-14
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    73   1e-14
Scas_598.6                                                             73   1e-14
Scas_678.24                                                            73   2e-14
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    73   2e-14
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    72   2e-14
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    72   2e-14
Kwal_23.6325                                                           73   3e-14
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    72   3e-14
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    73   3e-14
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    72   3e-14
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    72   3e-14
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    72   3e-14
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    72   4e-14
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    72   6e-14
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    72   6e-14
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    71   6e-14
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    71   8e-14
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    71   9e-14
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    71   9e-14
Scas_693.17                                                            71   9e-14
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    71   1e-13
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    70   1e-13
Scas_653.25                                                            71   1e-13
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    71   1e-13
Kwal_55.21545                                                          70   1e-13
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    70   1e-13
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    70   1e-13
Scas_640.14*                                                           70   1e-13
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    70   1e-13
Scas_713.7                                                             70   1e-13
KLLA0E11979g complement(1060048..1061892) some similarities with...    70   1e-13
Scas_618.8                                                             70   1e-13
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    70   2e-13
Scas_700.54                                                            70   2e-13
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    70   2e-13
Kwal_23.5668                                                           70   2e-13
Kwal_33.13222                                                          66   2e-13
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    70   2e-13
Scas_703.5                                                             70   2e-13
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    69   3e-13
CAGL0K01661g complement(146952..148400) some similarities with t...    69   3e-13
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    69   4e-13
Kwal_26.8709                                                           69   4e-13
Kwal_23.3590                                                           69   4e-13
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    69   5e-13
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    69   5e-13
Scas_700.35                                                            69   5e-13
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    69   5e-13
Kwal_14.2497                                                           68   5e-13
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    69   5e-13
Scas_628.9                                                             69   6e-13
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    69   6e-13
KLLA0C03938g complement(358851..360632) some similarities with s...    68   6e-13
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    68   6e-13
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    68   6e-13
Kwal_33.13831                                                          68   7e-13
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    69   7e-13
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    68   8e-13
Scas_718.90                                                            68   8e-13
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    68   1e-12
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    68   1e-12
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    67   1e-12
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    68   1e-12
Kwal_47.16761                                                          67   1e-12
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    67   1e-12
Kwal_23.5290                                                           67   1e-12
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    67   1e-12
Kwal_0.307                                                             67   2e-12
Kwal_14.1273                                                           66   2e-12
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    67   2e-12
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    67   3e-12
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    66   3e-12
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    67   3e-12
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    66   3e-12
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    66   3e-12
Scas_580.6                                                             66   3e-12
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    66   3e-12
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    66   3e-12
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    65   3e-12
Kwal_26.8796                                                           66   4e-12
Scas_640.16                                                            66   4e-12
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    65   4e-12
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    66   4e-12
Kwal_26.8751                                                           66   4e-12
Scas_564.7                                                             66   5e-12
Scas_707.3                                                             66   5e-12
Scas_675.2                                                             65   5e-12
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    66   5e-12
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    66   5e-12
Kwal_27.10581                                                          66   5e-12
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    65   6e-12
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    65   6e-12
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    65   7e-12
KLLA0D12100g complement(1031728..1033161) some similarities with...    65   7e-12
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    65   7e-12
Kwal_26.7635                                                           65   7e-12
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    65   8e-12
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    65   8e-12
Scas_700.28                                                            65   8e-12
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    65   9e-12
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    65   9e-12
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    64   1e-11
Scas_690.13                                                            64   1e-11
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    65   1e-11
Kwal_56.24091                                                          64   1e-11
Scas_660.20                                                            65   1e-11
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    64   1e-11
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    64   1e-11
Kwal_56.23717                                                          64   1e-11
Scas_715.34                                                            64   1e-11
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    64   2e-11
Kwal_56.24059                                                          64   2e-11
Kwal_27.9773                                                           64   2e-11
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    64   2e-11
KLLA0A06820g complement(615686..618004) some similarities with s...    64   2e-11
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    64   2e-11
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    64   2e-11
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    64   2e-11
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    64   2e-11
Kwal_56.24584                                                          64   2e-11
Kwal_26.7682                                                           64   2e-11
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    64   2e-11
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    63   3e-11
Kwal_27.9763                                                           64   3e-11
YKL198C (PTK1) [3074] chr11 complement(68274..70223) Protein con...    64   3e-11
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    63   3e-11
Scas_721.124                                                           63   3e-11
Kwal_56.22788                                                          63   4e-11
Scas_619.5*                                                            63   4e-11
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    62   4e-11
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    62   4e-11
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    63   4e-11
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    63   4e-11
Kwal_33.13112                                                          63   4e-11
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    62   5e-11
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    63   5e-11
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    63   5e-11
Scas_720.94                                                            63   5e-11
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    62   6e-11
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    62   7e-11
Kwal_56.22693                                                          62   7e-11
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    62   8e-11
Scas_685.24                                                            62   8e-11
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    62   8e-11
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    62   9e-11
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    62   9e-11
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    62   1e-10
Scas_568.13                                                            61   1e-10
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    61   1e-10
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    62   1e-10
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    62   1e-10
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    61   1e-10
Scas_582.1                                                             61   1e-10
Scas_655.2                                                             61   2e-10
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    61   2e-10
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    61   2e-10
Scas_593.14d                                                           61   2e-10
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    61   2e-10
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    60   2e-10
Scas_651.19                                                            61   2e-10
Scas_627.7                                                             60   2e-10
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    60   2e-10
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    60   2e-10
KLLA0B07205g complement(624606..625973) some similarities with s...    60   2e-10
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    60   3e-10
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    60   3e-10
Scas_502.2                                                             60   4e-10
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    60   4e-10
Scas_602.11                                                            60   4e-10
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    60   4e-10
Kwal_14.1159                                                           60   4e-10
Scas_717.69                                                            60   4e-10
Kwal_26.8703                                                           60   4e-10
Kwal_27.11777                                                          60   4e-10
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    60   5e-10
Scas_683.12                                                            59   5e-10
Scas_634.5                                                             60   6e-10
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    60   6e-10
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    59   6e-10
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    59   6e-10
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    59   6e-10
Scas_336.1                                                             59   7e-10
Kwal_55.20221                                                          59   7e-10
Scas_721.61                                                            59   9e-10
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    59   1e-09
Scas_689.25*                                                           58   1e-09
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    59   1e-09
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    59   1e-09
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    58   1e-09
CAGL0M08404g complement(836791..838179) some similarities with s...    58   2e-09
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    58   2e-09
Kwal_23.4276                                                           58   2e-09
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    58   2e-09
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    58   2e-09
Kwal_47.18307                                                          58   2e-09
KLLA0C16577g complement(1451181..1452695) some similarities with...    57   2e-09
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    58   2e-09
Scas_544.6                                                             57   2e-09
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    58   3e-09
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    58   3e-09
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    57   3e-09
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    57   3e-09
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    57   3e-09
CAGL0M08360g complement(833220..835520) some similarities with s...    57   3e-09
Kwal_33.13846                                                          57   4e-09
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    57   4e-09
Scas_677.18                                                            57   4e-09
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    57   4e-09
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    57   4e-09
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    57   4e-09
Scas_584.11                                                            57   5e-09
Scas_689.24                                                            57   5e-09
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    56   5e-09
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    56   7e-09
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    56   7e-09
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    56   8e-09
Scas_548.6                                                             56   8e-09
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    55   8e-09
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    56   9e-09
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    56   9e-09
Scas_643.20                                                            56   9e-09
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    55   1e-08
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    56   1e-08
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    55   1e-08
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    55   1e-08
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    55   1e-08
Scas_651.18                                                            55   1e-08
Kwal_47.17252                                                          55   2e-08
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    55   2e-08
Scas_633.29                                                            55   2e-08
YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine pr...    55   2e-08
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    55   2e-08
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    55   2e-08
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    55   2e-08
KLLA0D09328g complement(788565..791705) some similarities with s...    55   2e-08
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    55   2e-08
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    55   2e-08
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    55   2e-08
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    55   2e-08
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    54   2e-08
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    54   2e-08
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    55   3e-08
Kwal_26.7154                                                           55   3e-08
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    54   3e-08
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    54   4e-08
Scas_721.132                                                           54   4e-08
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    53   6e-08
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    54   6e-08
Scas_584.8                                                             53   7e-08
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    53   8e-08
Kwal_47.17263                                                          53   9e-08
Scas_707.34                                                            53   1e-07
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    53   1e-07
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    52   1e-07
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    53   1e-07
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    53   1e-07
Scas_673.34*                                                           52   1e-07
Scas_707.36                                                            52   1e-07
Kwal_23.6458                                                           52   2e-07
Kwal_33.14081                                                          52   2e-07
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    52   2e-07
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    52   2e-07
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    52   2e-07
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    52   2e-07
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    52   2e-07
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    52   2e-07
Kwal_55.20189                                                          52   2e-07
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    52   2e-07
Kwal_33.13681                                                          52   2e-07
Scas_654.12                                                            52   3e-07
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    51   3e-07
Kwal_33.14554                                                          51   3e-07
Kwal_23.3992                                                           51   3e-07
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    51   4e-07
Scas_695.33                                                            51   4e-07
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    51   4e-07
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    51   4e-07
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    51   4e-07
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    50   5e-07
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    50   5e-07
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    50   7e-07
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    50   8e-07
Scas_618.15                                                            50   9e-07
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    50   9e-07
YLR248W (RCK2) [3644] chr12 (634254..636086) Calcium/calmodulin-...    50   1e-06
Scas_720.103                                                           49   1e-06
Scas_671.16                                                            49   1e-06
Scas_716.73                                                            49   1e-06
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    49   2e-06
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    49   2e-06
Kwal_27.10004                                                          49   2e-06
Scas_629.16                                                            49   2e-06
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    49   3e-06
Scas_573.10                                                            48   3e-06
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    49   3e-06
Scas_716.33                                                            48   3e-06
Kwal_0.155                                                             48   4e-06
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    48   4e-06
Scas_705.23                                                            47   5e-06
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    47   5e-06
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    47   6e-06
Scas_684.28                                                            47   8e-06
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    47   9e-06
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    47   9e-06
Scas_601.6                                                             46   1e-05
Kwal_33.14167                                                          46   1e-05
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    46   2e-05
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    46   2e-05
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    46   2e-05
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    45   2e-05
Kwal_27.9804                                                           45   3e-05
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    45   3e-05
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    45   3e-05
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    45   3e-05
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    45   4e-05
Kwal_47.17345                                                          45   4e-05
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    44   5e-05
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    44   5e-05
Scas_703.47                                                            44   5e-05
KLLA0B06501g complement(576636..579089) some similarities with s...    44   7e-05
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    44   9e-05
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    44   1e-04
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    43   1e-04

>Kwal_23.3471
          Length = 260

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/257 (100%), Positives = 257/257 (100%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60
           MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS
Sbjct: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60

Query: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
           WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR
Sbjct: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180
           WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD
Sbjct: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180

Query: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240
           WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE
Sbjct: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240

Query: 241 YFVELPVPTTPSELPQL 257
           YFVELPVPTTPSELPQL
Sbjct: 241 YFVELPVPTTPSELPQL 257

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score =  463 bits (1192), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 212/257 (82%), Positives = 238/257 (92%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60
           MSAIREVKYLQEIRH NVIEL+D++MAQ NLNLVLEFLPADLEM+IKD+S+LFTQADIKS
Sbjct: 48  MSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKS 107

Query: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
           WLLMTLRGVHHCHR+FILHRDLKPNNLLLAPDGQLK+ADFGLAR + +P + +TSNVVTR
Sbjct: 108 WLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTR 167

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180
           WYRAPELLFGA+HYT A+D+WSVGVIFAELMLRIPYLPG+DD+DQIDVTFRALGTPTDKD
Sbjct: 168 WYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKD 227

Query: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240
           WPE+S+F  YNKIQ YPPPSR E+R RFIAATENAL+LM GMLTM+PHKRWD  +CL S+
Sbjct: 228 WPEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQ 287

Query: 241 YFVELPVPTTPSELPQL 257
           YFVELP  T P+ELP+L
Sbjct: 288 YFVELPEATPPTELPKL 304

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score =  458 bits (1179), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 209/257 (81%), Positives = 236/257 (91%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60
           MSA+REVK+LQE++HVNVIEL+DV+MA  NLNLVLEFLPADLE+IIKD SI+F+ ADIKS
Sbjct: 52  MSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKS 111

Query: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
           W+LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLK+ADFGLAR M SPQ++LTSNVVTR
Sbjct: 112 WILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTR 171

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180
           WYRAPELLFGAKHYT A+D+WSVGVIFAELMLRIPYLPGKDD+DQI+VTFRALGTPTD D
Sbjct: 172 WYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDAD 231

Query: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240
           WPE+S+F  YNKIQ YPPPSREE+RRRFIAATENAL L+ GM+ MNP KRWD ++CL S+
Sbjct: 232 WPEVSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQ 291

Query: 241 YFVELPVPTTPSELPQL 257
           YF ELP PT P +LP+L
Sbjct: 292 YFQELPEPTLPQDLPKL 308

>Scas_613.13*
          Length = 312

 Score =  442 bits (1136), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 203/254 (79%), Positives = 234/254 (92%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60
           MSAIREVKYLQEI+H NVIEL+D++MA  NLNLVLEFLP+DLE+IIKD SILFT ADIKS
Sbjct: 56  MSAIREVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKS 115

Query: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
           W+LMTLRGVHHCHRNFILHRDLKPNNLLL+PDG +K+ADFGLAR + SP +MLTSNVVTR
Sbjct: 116 WMLMTLRGVHHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTR 175

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180
           WYRAPELLFGAKHYT AID+WSVGVIFAELMLRIPYLPG++DIDQ++VTFRALGTPTDK+
Sbjct: 176 WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKE 235

Query: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240
           WPE+S+FG+YNK+Q YPPPS +E+R+RFIAA+ENALN M GMLTMNP KRW+ I+CL SE
Sbjct: 236 WPEVSSFGSYNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESE 295

Query: 241 YFVELPVPTTPSEL 254
           YF E+P P+ PSE+
Sbjct: 296 YFKEMPPPSDPSEI 309

>CAGL0H10318g complement(1006299..1007222) highly similar to
           sp|P06242 Saccharomyces cerevisiae YDL108w KIN28
           cyclin-dependent ser/thr protein kinase, hypothetical
           start
          Length = 307

 Score =  433 bits (1113), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 193/254 (75%), Positives = 232/254 (91%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60
           MSAIREVKYLQE++HVNVIEL+D++M+  NLNLVLE+LP DLE++IKD SILFT ADIKS
Sbjct: 48  MSAIREVKYLQEMQHVNVIELVDIFMSYGNLNLVLEYLPTDLEVVIKDKSILFTPADIKS 107

Query: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
           W+LM++RGVHHCHRNFILHRDLKPNNLL+APDGQ+K+ADFGLAR + SP ++LTSNVVTR
Sbjct: 108 WMLMSVRGVHHCHRNFILHRDLKPNNLLIAPDGQIKVADFGLARAVPSPHEVLTSNVVTR 167

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180
           WYRAPELLFGAKHYT AID+WS+GVIFAELMLRIPYLPG++D++Q++VTFRALGTPTDKD
Sbjct: 168 WYRAPELLFGAKHYTSAIDVWSLGVIFAELMLRIPYLPGQNDLEQMEVTFRALGTPTDKD 227

Query: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240
           WPE+S+F +YNK+Q YPPPSR+E+R+RFIAATENALN M+GM+ +NP KRW   QCL SE
Sbjct: 228 WPEVSSFNSYNKLQMYPPPSRDELRKRFIAATENALNFMNGMMCLNPAKRWSTAQCLESE 287

Query: 241 YFVELPVPTTPSEL 254
           YF ELP P+ P+ +
Sbjct: 288 YFKELPRPSDPATI 301

>YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699)
           Cyclin-dependent serine/threonine protein kinase,
           component of TFIIK subcomplex of transcription factor
           TFIIH, phosphorylates C-terminal domain (CTD) of Rpo21p
           [921 bp, 306 aa]
          Length = 306

 Score =  428 bits (1101), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 195/254 (76%), Positives = 230/254 (90%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60
           MSAIREVKYLQE++H NVIELID++MA  NLNLVLEFLP DLE++IKD SILFT ADIK+
Sbjct: 49  MSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKA 108

Query: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
           W+LMTLRGV+HCHRNFILHRDLKPNNLL +PDGQ+K+ADFGLAR + +P ++LTSNVVTR
Sbjct: 109 WMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTR 168

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180
           WYRAPELLFGAKHYT AID+WSVGVIFAELMLRIPYLPG++D+DQ++VTFRALGTPTD+D
Sbjct: 169 WYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRD 228

Query: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240
           WPE+S+F TYNK+Q YPPPSR+E+R+RFIAA+E AL+ M GMLTMNP KRW  +QCL S+
Sbjct: 229 WPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESD 288

Query: 241 YFVELPVPTTPSEL 254
           YF ELP P+ PS +
Sbjct: 289 YFKELPPPSDPSSI 302

>KLLA0D11990g join(complement(1023928..1023944),
           gi|2499590|sp|Q92241|PH85_KLULA Kluyveromyces lactis
           NEGATIVE REGULATOR OF THE PHO SYSTEM, hypothetical start
          Length = 304

 Score =  192 bits (489), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 150/253 (59%), Gaps = 12/253 (4%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMII----KDNSILFTQAD 57
           +AIRE+  ++E++H N++ L DV   ++ L LV EF+  DL+  +    K NS    + D
Sbjct: 49  TAIREISLMKELKHDNIVRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSHKGLEMD 108

Query: 58  -IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSN 116
            +K +    L+GV  CH N ILHRDLKP NLL+   GQLKL DFGLAR  G P +  +S 
Sbjct: 109 LVKYFQWQLLQGVAFCHENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFSSE 168

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
           VVT WYRAP++L G+++Y  +ID+WS G I AE+++  P  PG +D +Q+ + F  +GTP
Sbjct: 169 VVTLWYRAPDVLMGSRNYCTSIDIWSCGCILAEMIMGKPLFPGSNDEEQLKLIFDTMGTP 228

Query: 177 TDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATE-----NALNLMDGMLTMNPHKRW 231
            ++ WP+++    YN +   PP    ++++     TE     N ++L+ G+L +NP  R 
Sbjct: 229 VEQTWPQVTQLAKYNPL--LPPHMPRDLKQLLQNNTEEVLDDNVVDLLHGLLQLNPDARL 286

Query: 232 DPIQCLTSEYFVE 244
                L   +F E
Sbjct: 287 SAKDALNHPWFAE 299

>AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH]
           (246896..247790,247838..247854) [912 bp, 303 aa]
          Length = 303

 Score =  183 bits (465), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 146/256 (57%), Gaps = 18/256 (7%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDN-------SILFT 54
           +AIRE+  ++E++H N++ L DV   ++ L LV EF+  DL+  +           +  +
Sbjct: 51  TAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRGLELS 110

Query: 55  QADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLT 114
                 W L  L+GV  CH N ILHRDLKP NLL+   GQLKL DFGLAR  G P +  +
Sbjct: 111 LVKYFQWQL--LQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS 168

Query: 115 SNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALG 174
           S VVT WYRAP++L G++ Y  +ID+WS G I AE+++     PG +D +Q+ + F  +G
Sbjct: 169 SEVVTLWYRAPDVLMGSRTYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFETMG 228

Query: 175 TPTDKDWPEISTFGTYN-KIQFYPPPSREEMRRRFIAATENAL-----NLMDGMLTMNPH 228
           TPT++ W  +S    YN +I  YP    +++++   A T+  +     NL+ G+L +NP 
Sbjct: 229 TPTEQTWVGVSQLPKYNPQIPLYP---NKDIKQLLQATTKEQISDVLVNLIQGLLQLNPS 285

Query: 229 KRWDPIQCLTSEYFVE 244
            R    Q L+   F E
Sbjct: 286 MRLSAQQALSHPLFEE 301

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score =  180 bits (457), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 97/248 (39%), Positives = 142/248 (57%), Gaps = 9/248 (3%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSN-LNLVLEFLPADL----EMIIKDNSILFTQA 56
           +AIRE+  L+E++  N++ L D+  + ++ L LV EFL  DL    E I KD  +     
Sbjct: 51  TAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQPL--GGN 108

Query: 57  DIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSN 116
            IK +++   +G+ +CH + I+HRDLKP NLL+  DG LKL DFGLAR  G P    T  
Sbjct: 109 IIKKFMMQLCKGIAYCHAHRIIHRDLKPQNLLINRDGNLKLGDFGLARAFGVPLRAYTHE 168

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
           +VT WYRAPE+L G K Y+  +D+WS+G IFAE+  R P   G  +IDQI   FR LGTP
Sbjct: 169 IVTLWYRAPEVLLGGKQYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQIFKIFRVLGTP 228

Query: 177 TDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQC 236
            ++ WP+I     +     +P  +R  +     +   N ++L+D ++T +P  R    + 
Sbjct: 229 NERTWPDIIYLPDFKTT--FPKWNRRNLSEVIPSLDANGIDLLDKLITYDPIHRISAKRA 286

Query: 237 LTSEYFVE 244
           +   YF E
Sbjct: 287 VQHPYFKE 294

>Scas_568.9*
          Length = 306

 Score =  180 bits (457), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 97/263 (36%), Positives = 145/263 (55%), Gaps = 16/263 (6%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQAD---- 57
           +AIRE+  ++E++H N++ L DV   ++ L LV E++  DL+  +   ++  +       
Sbjct: 44  TAIREISLMKELKHENIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELN 103

Query: 58  -IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSN 116
            +K +    L G+  CH N ILHRDLKP NLL+   G LKL DFGLAR  G P +  +S 
Sbjct: 104 LVKYFQWQLLEGLAFCHENKILHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFSSE 163

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
           VVT WYRAP++L G++ Y+ +ID+WS G I AE++   P  PG +D +Q+ + F  +GTP
Sbjct: 164 VVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGSNDEEQLKLIFETMGTP 223

Query: 177 TDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAA-------TENALNLMDGMLTMNPHK 229
           T+  WP +S    YN   F   P R     R +          +N ++L+ G+L +NP  
Sbjct: 224 TEATWPGVSALPKYNP-NF---PQRLPKDLRMVLQPYCKEPLDDNVIDLLHGLLQLNPDM 279

Query: 230 RWDPIQCLTSEYFVELPVPTTPS 252
           R    Q L   +F E     TP+
Sbjct: 280 RLSAKQALHHPWFAEYYQHYTPA 302

>Kwal_27.11803
          Length = 246

 Score =  178 bits (451), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 141/250 (56%), Gaps = 22/250 (8%)

Query: 10  LQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEM-----IIKDNSILFTQADIKSWLLM 64
           ++E++H N++ L DV   ++ L LV EF+  DL+      I+ +    F  + +K +   
Sbjct: 1   MKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQ 60

Query: 65  TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRA 124
            L+GV  CH N ILHRDLKP NLL+   GQLKL DFGLAR  G P +  +S VVT WYRA
Sbjct: 61  LLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRA 120

Query: 125 PELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEI 184
           P++L G++ Y+ +ID+WS G I AE++   P  PG +D +Q+ + F  +GTPT++ WP +
Sbjct: 121 PDVLMGSRTYSTSIDIWSCGCILAEMITGRPLFPGTNDEEQLKLIFETMGTPTERTWPGV 180

Query: 185 STFGTYNKI--QFYP--------PPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPI 234
           ST   YN    Q  P          +RE+M    I       +L+ G+L  NP +R    
Sbjct: 181 STLPKYNPQLPQHLPKDLGALLQSQTREKMDLTLI-------DLLYGLLQPNPDRRLSAK 233

Query: 235 QCLTSEYFVE 244
           Q L   +F E
Sbjct: 234 QALNHPWFAE 243

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score =  179 bits (454), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 143/246 (58%), Gaps = 9/246 (3%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSN-LNLVLEFLPADL----EMIIKDNSILFTQA 56
           +AIRE+  L+E++  N++ L D+  + ++ L LV EFL  DL    E + KD  +     
Sbjct: 51  TAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPL--GDK 108

Query: 57  DIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSN 116
            IK +++   +G+ +CH + I+HRDLKP NLL+  +G LKL DFGLAR  G P    T  
Sbjct: 109 IIKKFMMQLCKGIAYCHAHRIIHRDLKPQNLLINRNGNLKLGDFGLARAFGVPLRAYTHE 168

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
           +VT WYRAPE+L G K Y+  +D+WS+G IFAE+  R P   G  +IDQI   FR LGTP
Sbjct: 169 IVTLWYRAPEVLLGGKQYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQIFKIFRLLGTP 228

Query: 177 TDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQC 236
            +  WP+I     +     +P   R ++ +   +  E+ L+L+D ++T +P  R    + 
Sbjct: 229 NESVWPDIVYLPDFKPT--FPKWQRRDLAQVVPSLNEHGLDLLDKLVTYDPIHRISAKRA 286

Query: 237 LTSEYF 242
           +T  YF
Sbjct: 287 VTHPYF 292

>CAGL0L12474g complement(1345044..1345952) highly similar to
           sp|P17157 Saccharomyces cerevisiae YPL031c
           cyclin-dependent protein kinase, start by similarity
          Length = 302

 Score =  179 bits (454), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 143/251 (56%), Gaps = 8/251 (3%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSIL-----FTQA 56
           +AIRE+  ++E++H N++ L DV   ++ L LV E++  DL+  +   ++          
Sbjct: 48  TAIREISLMKELKHDNIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMN 107

Query: 57  DIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSN 116
            +K +    L G+  CH N ILHRDLKP NLL+   GQLKL DFGLAR  G P +  +S 
Sbjct: 108 LVKYFQWQLLEGLAFCHENKILHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTFSSE 167

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
           VVT WYRAP++L G++ Y+ +ID+WS G I AE++   P  PG +D +Q+ + F  +GTP
Sbjct: 168 VVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDKMGTP 227

Query: 177 TDKDWPEISTFGTYN-KIQFYPPPSREEMRRRFIAA--TENALNLMDGMLTMNPHKRWDP 233
            +  WP +++   YN   Q   P   +   + ++     +N ++L+ G+L +NP  R   
Sbjct: 228 NETTWPGVTSLPKYNPNFQQRLPKDLKAELQPYVKEPLDDNVIDLLHGLLQLNPDMRLSA 287

Query: 234 IQCLTSEYFVE 244
            Q L   +F E
Sbjct: 288 KQALLHPWFSE 298

>YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent
           protein kinase essential for completion of START and for
           mitosis, associates with Cks1p and cyclins [897 bp, 298
           aa]
          Length = 298

 Score =  176 bits (445), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 99/249 (39%), Positives = 141/249 (56%), Gaps = 11/249 (4%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSN-LNLVLEFLPADL----EMIIKDNSILFTQA 56
           +AIRE+  L+E++  N++ L D+  + ++ L LV EFL  DL    E I KD  +    A
Sbjct: 54  TAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPL---GA 110

Query: 57  DI-KSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTS 115
           DI K +++   +G+ +CH + ILHRDLKP NLL+  DG LKL DFGLAR  G P    T 
Sbjct: 111 DIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTH 170

Query: 116 NVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGT 175
            +VT WYRAPE+L G K Y+  +D WS+G IFAE+  R P   G  +IDQI   FR LGT
Sbjct: 171 EIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGT 230

Query: 176 PTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQ 235
           P +  WP+I     +     +P   R+++ +   +     ++L+D +L  +P  R    +
Sbjct: 231 PNEAIWPDIVYLPDFKP--SFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARR 288

Query: 236 CLTSEYFVE 244
                YF E
Sbjct: 289 AAIHPYFQE 297

>Scas_721.46
          Length = 296

 Score =  175 bits (443), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 140/246 (56%), Gaps = 9/246 (3%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSN-LNLVLEFLPADL----EMIIKDNSILFTQA 56
           +AIRE+  L+E++  N++ L D+  + ++ L LV EFL  DL    E I KD S+     
Sbjct: 52  TAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQSL--GSD 109

Query: 57  DIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSN 116
            IK ++    +G+ +CH + ILHRDLKP NLL+  +G LKL DFGLAR  G P    T  
Sbjct: 110 IIKKFMRQLCKGIAYCHAHRILHRDLKPQNLLINKEGNLKLGDFGLARAFGVPLRAYTHE 169

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
           +VT WYRAPE+L G K Y+  +D WS+G IFAE+  R P   G  +IDQI   FR LGTP
Sbjct: 170 IVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRSPIFSGDSEIDQIFKIFRILGTP 229

Query: 177 TDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQC 236
            +  WP+I     +     +P   R+++++   +     ++L+D +L  +P  R    + 
Sbjct: 230 NESVWPDIVYLPDFKP--NFPQWRRKDLKQVVPSLDPQGIDLLDKLLAYDPINRISARRA 287

Query: 237 LTSEYF 242
           +   YF
Sbjct: 288 VVHPYF 293

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score =  174 bits (441), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 100/253 (39%), Positives = 142/253 (56%), Gaps = 19/253 (7%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSN-LNLVLEFLPADL----EMIIKDNSILFTQA 56
           +AIRE+  L+E++  N++ L D+  + ++ L LVLEFL  DL    E I KD  +     
Sbjct: 54  TAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNI- 112

Query: 57  DIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSN 116
            IK +++   +G+ +CH + ILHRDLKP NLL+  +G LKL DFGLAR  G P    T  
Sbjct: 113 -IKKFMVQLCKGIAYCHAHRILHRDLKPQNLLIDKEGNLKLGDFGLARAFGVPLRAYTHE 171

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
           +VT WYRAPE+L G K Y+  +D WS+G IFAE+  R P   G  +IDQI   FR LGTP
Sbjct: 172 IVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRILGTP 231

Query: 177 TDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAAT-----ENALNLMDGMLTMNPHKRW 231
           ++  WP+I     +        PS  + RR+ +A        + ++L+D +L  +P  R 
Sbjct: 232 SEAVWPDIVYLPDFK-------PSFPQWRRKDLAEVVPSLDPHGIDLLDKLLAYDPINRI 284

Query: 232 DPIQCLTSEYFVE 244
              +     YF E
Sbjct: 285 SARRAANHPYFHE 297

>Scas_610.7
          Length = 668

 Score =  171 bits (433), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 161/303 (53%), Gaps = 60/303 (19%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDV---YMAQSNLN-----------------------LV 34
           ++A RE+  L+ + H N+I+LI++   Y   S+ +                       ++
Sbjct: 114 ITAQREIVILKRLNHKNIIKLIEMVYDYAPDSSSSRAAEVKSLSTAAGPPASPSKHFYMI 173

Query: 35  LEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ 94
           L ++ ADL  I+ +  I     DIK+ +L  L GV++ H    +HRD+K  N+L+  +G 
Sbjct: 174 LPYMVADLSGILHNPRITLEMPDIKNIMLQVLEGVNYIHCQKFMHRDIKAANILIDHNGI 233

Query: 95  LKLADFGLARNM-GSPQDM-----------LTSNVVTRWYRAPELLFGAKHYTGAIDMWS 142
           LKLADFGLAR   GSP ++            TS VVTRWYRAPEL+ G KHYT A+D+W 
Sbjct: 234 LKLADFGLARTYYGSPPNLKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKHYTTAVDIWG 293

Query: 143 VGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSRE 202
           VG +FAEL  + P L G  DIDQ  + F+ +GTPT+++W          K+  Y P S  
Sbjct: 294 VGCVFAELFEKKPILQGSSDIDQGHIIFKLMGTPTEEEW----------KLAHYLPGS-- 341

Query: 203 EMRRRFIAAT----------ENALNLMDGMLTMNPHKRWDPIQCLTSEYFVELPVPTTPS 252
           E+ R    +T          ++ L+ + G+L ++P+KR   +  +  E+F E P+P+T  
Sbjct: 342 ELTRTNYKSTIDERFGKWLDKSGLDFLKGLLALDPYKRLTAMSAVKHEFFKEEPLPSTTL 401

Query: 253 ELP 255
            LP
Sbjct: 402 SLP 404

>AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH]
           (805583..806956) [1374 bp, 457 aa]
          Length = 457

 Score =  160 bits (406), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 138/252 (54%), Gaps = 5/252 (1%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYM-AQSNLNLVLEFLPADLEMIIKDNSILFTQADIK 59
           +++IRE+K LQ  +H NV  + ++   AQ  + ++ E+   DL  ++ +  I F+ A+ K
Sbjct: 164 ITSIREIKLLQHCQHENVSTIAEIMCEAQKTVYMIFEYADNDLSGLLMNKEIHFSDANCK 223

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVT 119
                 L+G+ + H   ILHRD+K +N+L+   G LK+ DFGLAR M    D  T+ V+T
Sbjct: 224 HLFRQLLKGMEYLHECRILHRDIKGSNILIDNRGNLKITDFGLARKMKQEPD-YTNRVIT 282

Query: 120 RWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDK 179
            WYR PELL G   Y   +DMW  G +  EL L+  +  G ++++Q+   F+ LGTPT +
Sbjct: 283 LWYRPPELLLGTTRYGTEVDMWGCGCLLVELFLKAAFFQGTNELEQLRCIFQVLGTPTIE 342

Query: 180 DWPEISTFGTYNKI---QFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQC 236
            WP +     +  +   Q    PSR + +   +  T++  +L  G+L  +  KR+   + 
Sbjct: 343 QWPGLFDMPWWFMMIPQQKENYPSRFDEKVSGVLPTQSCRDLARGLLLYDQKKRFSASEA 402

Query: 237 LTSEYFVELPVP 248
           L S YF ELP P
Sbjct: 403 LKSAYFYELPRP 414

>Kwal_55.21900
          Length = 625

 Score =  159 bits (403), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 159/293 (54%), Gaps = 44/293 (15%)

Query: 1   MSAIREVKYLQEIRHVNVIELID-VY-------MAQSNLN--------------LVLEFL 38
           ++A RE+  L+++ H NVI+LI+ VY          SN                ++L ++
Sbjct: 99  ITAQREITILRKLNHKNVIKLIEMVYDYPPTSSNGSSNTTTLPNPNTPSTKSFYMILPYM 158

Query: 39  PADLEMIIKDNSILFTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLA 98
            ADL  I+ +  I      IK+ LL  L G+++ H    +HRD+K  NLLL   G LK+A
Sbjct: 159 IADLSGILHNPRIKLGMEGIKNILLQILEGINYIHCQKFMHRDIKAANLLLDHKGVLKIA 218

Query: 99  DFGLARNM-GSPQDM-----------LTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVI 146
           DFGLARN  G+P ++            TS VVTRWYRAPEL+ G KHYT A+DMW VG +
Sbjct: 219 DFGLARNYYGAPPNLKYPGGAGVDAKYTSVVVTRWYRAPELVLGDKHYTTAVDMWGVGCV 278

Query: 147 FAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTF---GTYNKIQFYPPPSREE 203
           F EL  + P L G+ DIDQ  V F+ LGTP++++WP ++ F       + ++ P      
Sbjct: 279 FGELFEKKPILQGQTDIDQGHVIFKLLGTPSEEEWP-LARFLPGAELTRTKYSP-----N 332

Query: 204 MRRRFIAA-TENALNLMDGMLTMNPHKRWDPIQCLTSEYFVELPVPTTPSELP 255
           +R RF    T+  L+L+  +L ++P+KR   +      +F E P+P    +LP
Sbjct: 333 IRERFGEYLTDTGLDLLSQLLCLDPYKRLTAMAAKKHPFFTEEPLPEPILQLP 385

>CAGL0I08349g complement(813728..815731) similar to sp|P23293
           Saccharomyces cerevisiae YPR161c SGV1 ser/thr protein
           kinase, hypothetical start
          Length = 667

 Score =  159 bits (402), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 154/288 (53%), Gaps = 47/288 (16%)

Query: 1   MSAIREVKYLQEIRHVNVIELID-VY----------MAQSNLN--------------LVL 35
           ++A RE+  L+ + H N+I+L++ VY           AQ N N              ++L
Sbjct: 102 ITAQREITILKRLNHKNIIKLLEMVYDFPPESNNKDYAQFNQNNSANPPAVPKKFFYMIL 161

Query: 36  EFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQL 95
            ++ ADL  I+ +  I    ADIK+ +   L GV+  H +  +HRD+K  NLL+  +G L
Sbjct: 162 PYMVADLSGILHNPRIELKMADIKNMMKQILEGVNFIHCSKFMHRDIKTANLLIDHNGVL 221

Query: 96  KLADFGLARNM-GSPQDM-----------LTSNVVTRWYRAPELLFGAKHYTGAIDMWSV 143
           KLADFGLAR   GSP ++            TS VVTRWYRAPEL+ G K+YT A+D+W V
Sbjct: 222 KLADFGLARQYYGSPPNIKFPGSAGSGAKYTSVVVTRWYRAPELVLGDKYYTTAVDIWGV 281

Query: 144 GVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTF---GTYNKIQFYPPPS 200
           G +FAE   + P L GK DIDQ  V F+ +GTP ++ W E++ +       K ++     
Sbjct: 282 GCVFAEFFEKKPILQGKTDIDQGHVIFKLMGTPDERTW-ELAKYLPGAELTKTEY----- 335

Query: 201 REEMRRRFIAA-TENALNLMDGMLTMNPHKRWDPIQCLTSEYFVELPV 247
           +  +  RF    T   L+ + G+L ++P+KR   +  +   +F E P+
Sbjct: 336 KSTIDERFGKHLTPTGLSFLKGLLALDPYKRLTAMSAMKHPFFQEEPL 383

>CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces
           cerevisiae YPL042c cyclin-dependent CTD kinase,
           hypothetical start
          Length = 567

 Score =  156 bits (395), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 96/268 (35%), Positives = 151/268 (56%), Gaps = 22/268 (8%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNS----ILFTQAD 57
           SA RE+   +E+ + ++ +L+++++ + ++ +V EF   DL  II  +S     +     
Sbjct: 210 SACREMALCRELDNNHLTKLVEIFLQKKSIYMVYEFAEHDLLQIIHFHSHPEKRMIPPRM 269

Query: 58  IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP-QDMLTSN 116
           I+S +   L GV + H+N++LHRDLKP N+++  DG +K+ D GLAR   +  Q M T +
Sbjct: 270 IRSIMWQILDGVSYLHQNWVLHRDLKPANIMVTMDGVVKIGDLGLARKFSNMLQTMYTGD 329

Query: 117 --VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKD-----------DI 163
             VVT WYRAPELL GA+HYT AID+W+VG IFAEL+   P   G++             
Sbjct: 330 KVVVTIWYRAPELLLGARHYTPAIDLWAVGCIFAELIGLQPIFKGEEAKMDSKKTVPFQA 389

Query: 164 DQIDVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAAT---ENALNLMD 220
           +Q+    + LGTPT K WP +  +  Y ++  + P  R+ +   F +A    ++AL+L+ 
Sbjct: 390 NQLQRILKILGTPTPKSWPHLQKYPEYEQLSKF-PKYRDNLPGWFHSAGGRDKHALSLLY 448

Query: 221 GMLTMNPHKRWDPIQCLTSEYFVELPVP 248
            +L  NP +R D I  L   YF    +P
Sbjct: 449 HLLNYNPIERIDAINALDHSYFTHGDMP 476

>Kwal_26.7552
          Length = 461

 Score =  154 bits (388), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 85/252 (33%), Positives = 136/252 (53%), Gaps = 5/252 (1%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYM-AQSNLNLVLEFLPADLEMIIKDNSILFTQADIK 59
           +++IRE+K LQ   H N+  L ++ + +Q  + ++ E+   DL  ++ +  I  + A+ K
Sbjct: 173 ITSIREIKLLQSFDHRNISTLSEIMVESQKTVYMIFEYADNDLSGLLMNEQITLSNANCK 232

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVT 119
                 L G+H+ H N ILHRD+K +N+L+   GQLK+ DFGLAR M    D  T+ V+T
Sbjct: 233 HLFKSLLEGIHYLHDNGILHRDIKGSNILIDNKGQLKITDFGLARKMRDDSD-YTNRVIT 291

Query: 120 RWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDK 179
            WYR PELL G+ +Y  A+DMW  G +  EL  +     G ++++Q++  F  +GTPT +
Sbjct: 292 LWYRPPELLMGSTNYGTAVDMWGCGCLLVELFKKTAIFQGTNEVEQLNAIFSIMGTPTVE 351

Query: 180 DWP---EISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQC 236
            WP   E+  F      Q     S+ + +   I  +  A +L  G+L  +  +R+     
Sbjct: 352 QWPNLFEMPWFFMMIPQQTRKHESKFDEKFGPILPSSAAADLAKGLLLYDEKRRFSASDA 411

Query: 237 LTSEYFVELPVP 248
           L  +YF E P P
Sbjct: 412 LKHQYFREEPEP 423

>ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH]
           (735828..738089) [2262 bp, 753 aa]
          Length = 753

 Score =  156 bits (395), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 102/292 (34%), Positives = 158/292 (54%), Gaps = 41/292 (14%)

Query: 1   MSAIREVKYLQEIRHVNVIELI-----------------DVYMAQSNLN------LVLEF 37
           ++A RE+  L+ + H NV++LI                 D   A ++ +      ++L +
Sbjct: 98  ITAQREITILKRLNHRNVVQLIEMVYDYPPAQNGAAYGQDSSQASASADTMKSFYMILPY 157

Query: 38  LPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKL 97
           + ADL  I+ +  +    ADIK+ +L  L G+++ H    +HRD+K  N+LL   G LK+
Sbjct: 158 MVADLSGILHNPRVTLEMADIKNMMLQILEGINYIHCKKFMHRDIKTANILLDHKGILKI 217

Query: 98  ADFGLARNM-GSPQDM-----------LTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGV 145
           ADFGLARN  G+P ++            TS VVTRWYRAPEL+ G K+YT A+D+W +G 
Sbjct: 218 ADFGLARNYYGAPPNLKYPGGAGTDAKYTSVVVTRWYRAPELVLGDKNYTTAVDIWGIGC 277

Query: 146 IFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTF--GTYNKIQFYPPPSREE 203
           +FAE   + P L GK DIDQ  V F+ +GTP+D DW +++ +  G       Y P  +E 
Sbjct: 278 VFAEFFEKRPILQGKTDIDQGHVIFKLMGTPSDSDW-QLARYLPGAELTRTSYEPTYKER 336

Query: 204 MRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYFVELPVPTTPSELP 255
             +     TE  L+L+  +L+++P+KR   +  +   +F E P+P     LP
Sbjct: 337 FGKYL---TEKGLDLLSTLLSLDPYKRLTAMAAMQHPFFSEDPLPKLQLTLP 385

>CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces
           cerevisiae YKL139w CTK1 carboxy-terminal domain kinase,
           hypothetical start
          Length = 553

 Score =  153 bits (387), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 136/255 (53%), Gaps = 7/255 (2%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYM-AQSNLNLVLEFLPADLEMIIKDNSILFTQADIK 59
           +++IRE+K LQ   H NV  + ++ + +Q  + ++ E+   DL  ++ +  I    A  K
Sbjct: 263 ITSIREIKLLQSFNHENVSTIKEIMVESQKIIYMIFEYADNDLGGLLLNKQININAAQSK 322

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDML---TSN 116
                 L G+ + H N ILHRD+K +N+L+   G LKL DFGLAR +   +D +   T+ 
Sbjct: 323 HIFKQILHGIEYLHDNNILHRDIKGSNILIDNQGSLKLTDFGLARKIDCNRDAIRDYTNR 382

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
           V+T WYR PELL G  +Y   +DMW  G I  EL  ++    G ++++Q++  F+ +G+P
Sbjct: 383 VITIWYRPPELLLGTTNYGPEVDMWGCGCILVELFNKMAIFQGTNELEQLEAIFKVMGSP 442

Query: 177 TDKDWPEISTFGTYNKI---QFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDP 233
           + + WP I     +  I   Q    P+  E + R +  T+N   L  G+L  +  KR   
Sbjct: 443 SIEQWPNIFDMPWFFMIMPQQATKYPNVFEEKFRAVLETDNCFKLAQGLLRYDQEKRLTA 502

Query: 234 IQCLTSEYFVELPVP 248
            + L SEYF E P P
Sbjct: 503 SEALQSEYFKEDPQP 517

>KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces
           cerevisiae YBL016w FUS3 mitogen-activated protein kinase
           (MAP kinase), start by similarity
          Length = 371

 Score =  148 bits (374), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 142/282 (50%), Gaps = 36/282 (12%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQS-----NLNLVLEFLPADLEMIIKDNSILFTQ 55
           +  +RE+K L+  +H N+I + DV    S      + ++ E +  DL  +I    +  ++
Sbjct: 54  IRTLREIKILKHFQHENIISIFDVQKPSSFEQFNEVYIIQELMQTDLHRVIVTQEL--SE 111

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR----------- 104
             ++ ++  TLR +   H + ++HRDLKP+NLLL  +  LK+ DFGLAR           
Sbjct: 112 DHVQYFVYQTLRALKVLHGSNVIHRDLKPSNLLLNSNCDLKICDFGLARIVSERATDGDA 171

Query: 105 ----------------NMGSPQ-DMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIF 147
                           N G P    +T  V TRWYRAPE++  A  Y+ ++D+WS G I 
Sbjct: 172 HVDADDTDDNSPSSAANDGDPAISGMTEYVATRWYRAPEVMLTAAQYSKSMDVWSCGCIL 231

Query: 148 AELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPE-ISTFGTYNKIQFYPPPSREEMRR 206
           AEL+ + P  PGKD  DQ+ + F+ LGTPT+++  E +        I+  P   +   RR
Sbjct: 232 AELLGKQPLFPGKDYRDQLILIFQTLGTPTEQELVELVENRRAREYIRSLPKHPKINWRR 291

Query: 207 RFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYFVELPVP 248
           RF  A+  AL+L+D ML  +P  R    + L+  Y V    P
Sbjct: 292 RFPNASAAALDLLDRMLQFDPRLRITATEALSHPYLVSYHDP 333

>AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH]
           complement(471481..472560) [1080 bp, 359 aa]
          Length = 359

 Score =  147 bits (372), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 128/255 (50%), Gaps = 14/255 (5%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQS-----NLNLVLEFLPADLEMIIKDNSILFTQ 55
           +  +RE+K L+  +H N+I + D+    S      + ++ E +  DL  +I    +  + 
Sbjct: 54  LRTLREIKILKHFQHENIISIYDIQKPASFDTFNEVYIIQELMQTDLHRVIATQPL--SD 111

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR-------NMGS 108
             I+ ++  TLRG+   H + I+HRDLKP+NLLL  +  LK+ DFGLAR       ++  
Sbjct: 112 DHIQYFIYQTLRGLKALHGSGIIHRDLKPSNLLLNANCDLKICDFGLARIEHGGAADLEH 171

Query: 109 PQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDV 168
           PQ  +T  V TRWYRAPE++  A  YT AID+WS G I AEL ++ P   GKD   Q+ +
Sbjct: 172 PQAGMTEYVATRWYRAPEVMLTAAQYTKAIDIWSSGCILAELFMKRPLFAGKDYKHQLML 231

Query: 169 TFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPH 228
            F  LGTP   D   + +      I   P   R  +R     A    L+L+  ML  +P 
Sbjct: 232 IFELLGTPQGDDLAAVKSRRAREYIATLPRYRRASLRAVIPHANPLGLDLLQRMLVFDPR 291

Query: 229 KRWDPIQCLTSEYFV 243
           +R      L   Y  
Sbjct: 292 RRITAADALRHPYLA 306

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score =  150 bits (378), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 130/239 (54%), Gaps = 12/239 (5%)

Query: 3   AIREVKYLQEIR-HVNVIELID---VYMAQSNLN---LVLEFLPADLEMIIKDNSILFTQ 55
           ++RE+K L+  R H N+  L D   V+    ++N   L  E +  D+  IIK    L T 
Sbjct: 67  SLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQAL-TD 125

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMG-SPQD--- 111
           A  +S+    L G+ + H   +LHRDLKP NLL+  D QLK+ DFGLAR    +P++   
Sbjct: 126 AHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQ 185

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFR 171
            LT  V TRWYRAPE++   + YT AID+WS G I AE +   P   GKD +DQ++   +
Sbjct: 186 FLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNRILQ 245

Query: 172 ALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
            LGTP D+    + +    + I       +      F  A E+AL+L++GML  +P KR
Sbjct: 246 VLGTPPDETLRRVGSKNVQDYIHQLGYIQKIPFSELFPNANEDALDLLEGMLAFDPQKR 304

>Kwal_27.11830
          Length = 575

 Score =  150 bits (380), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 144/264 (54%), Gaps = 22/264 (8%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNS----ILFTQA 56
            SA RE+   +E+R+ ++  L+++++   ++ +V EF   DL  II  +S     L    
Sbjct: 211 QSACREMSLCRELRNKHLTHLVEIFLEHKSIYMVSEFAEHDLLQIIHFHSHPEKRLIPPR 270

Query: 57  DIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSN 116
            +KS +   L GV + H+N+ILHRDLKP N+++  DG +K+ D GLAR   +    L + 
Sbjct: 271 MLKSIIWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFHNMVQTLYAG 330

Query: 117 ---VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKD-----------D 162
              VVT WYRAPELL GA+HYT AID+W+VG IFAEL+   P   G++            
Sbjct: 331 DKVVVTIWYRAPELLLGARHYTPAIDLWAVGCIFAELIGLRPIFKGEEAKMDSKKSVPFQ 390

Query: 163 IDQIDVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAA---TENALNLM 219
            +Q+      LG+PT+K WP I  +  Y +I  + P  R+ +   + +A    + AL+L+
Sbjct: 391 ANQLQRILEVLGSPTEKSWPNIFKYPEYEQITKF-PRYRDNLPVWYHSAGGRNKEALDLL 449

Query: 220 DGMLTMNPHKRWDPIQCLTSEYFV 243
             +L  +P  R D +  L   YF 
Sbjct: 450 YQLLRYDPITRIDAVDALEHPYFT 473

>KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces
           cerevisiae YPR161c SGV1 ser/thr protein kinase,
           hypothetical start
          Length = 645

 Score =  150 bits (380), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 96/306 (31%), Positives = 158/306 (51%), Gaps = 61/306 (19%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDV--------------------YMAQSNLN-------- 32
           ++A RE+  L+ + H N+++LI++                    Y   +  N        
Sbjct: 97  ITAQREITILKRMNHKNIVKLIEIVYDESPTPKTDSTSPRPVGNYHGNNTANQQKLITGK 156

Query: 33  ---LVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLL 89
              ++L ++ +DL  ++ +  + F  AD+K+ +L  L G+++ H N  LHRD+K  N+L+
Sbjct: 157 HFFMILPYMVSDLTGLLHNPRVEFGMADVKNIMLQLLEGINYIHCNKFLHRDIKTANILI 216

Query: 90  APDGQLKLADFGLARNM-GSPQDM-----------LTSNVVTRWYRAPELLFGAKHYTGA 137
              G +K+ADFGLARN  GSP ++            TS VVTRWYRAPE++ G +HYT A
Sbjct: 217 DHKGVVKIADFGLARNYYGSPPNLKYPGGAGSGAKYTSVVVTRWYRAPEIVLGDRHYTTA 276

Query: 138 IDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTFGTYNKIQFYP 197
           +D+W +G +FAE   + P L G+ DIDQ  V F+ +GTP+  +W           + ++ 
Sbjct: 277 VDIWGIGCVFAEFFEKKPILQGQTDIDQGHVIFKLMGTPSMDEW----------GLAYHL 326

Query: 198 PPS-------REEMRRRFIAA-TENALNLMDGMLTMNPHKRWDPIQCLTSEYFVELPVPT 249
           P S       +  ++ RF  A  E  L+L+  +L ++P+KR   ++     +F E P+P 
Sbjct: 327 PGSELTKTNYKSTLQERFSKALNETGLDLLSKLLALDPYKRVTAMKAKKHPFFFEEPLPN 386

Query: 250 TPSELP 255
               LP
Sbjct: 387 AQLTLP 392

>Kwal_17.2687
          Length = 362

 Score =  145 bits (367), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 85/259 (32%), Positives = 133/259 (51%), Gaps = 19/259 (7%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQS-----NLNLVLEFLPADLEMIIKDNSILFTQ 55
           +  +RE+K L+  +H N+I + D+    S      + ++ E +  DL  +I   ++  + 
Sbjct: 54  LRTLREIKLLRCFQHENIISIFDIQRPASFETFNEVYIIQELMDTDLHRVIATQTL--SD 111

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMG-------- 107
             I+ ++   LR +   H   ++HRDLKP NLL+  +  +KL DFGLAR  G        
Sbjct: 112 DHIQYFVYQILRALKCLHGAEVIHRDLKPANLLVNANCDVKLCDFGLARCAGMGPGASNT 171

Query: 108 ---SPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDID 164
                   +T  V TRWYRAPE++  A  YT A+D+WS G I AEL+LR P  PGKD   
Sbjct: 172 GKAGEAGQMTEYVATRWYRAPEVMLTAAEYTFAMDVWSCGCILAELLLRRPLFPGKDYHH 231

Query: 165 QIDVTFRALGTPTDKDWPEISTFGTYNKIQFYPP-PSREEMRRRFIAATENALNLMDGML 223
           Q+ + F+ +G+PT+ D   + +      +   P   +RE +R+    A+  AL+L+  ML
Sbjct: 232 QLLLIFQVIGSPTEADLECVRSRRARQYLGTLPRYAAREGLRQLLPQASAEALDLLKRML 291

Query: 224 TMNPHKRWDPIQCLTSEYF 242
             +P +R    Q L   Y 
Sbjct: 292 VFDPRRRISAAQALRHPYL 310

>Scas_721.110
          Length = 520

 Score =  148 bits (373), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 135/259 (52%), Gaps = 13/259 (5%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNL-NLVLEFLPADLEMIIKDNSILFTQADIK 59
           +++IRE+K LQ   H N+  L+++ +  S +  ++ E+   DL  ++ D +++ +    K
Sbjct: 227 ITSIREIKLLQTFHHPNIATLVEIMVESSKMVYMIFEYADNDLTGLLGDKNVVMSLGQRK 286

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSN--- 116
                 LRGV + H + ILHRD+K +N+L+   G LK+ DFGLAR M    D   SN   
Sbjct: 287 HLFQQLLRGVKYLHDSLILHRDIKGSNILIDNKGNLKITDFGLARKMHVKSDSDGSNDYT 346

Query: 117 --VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALG 174
             V+T WYR PELL G  +Y+  +DMW  G I  EL   +    G+++I+Q+   F+ +G
Sbjct: 347 NRVITLWYRPPELLMGTTNYSTEVDMWGCGCILMELFNNVSIFQGQNEIEQLLSIFKIMG 406

Query: 175 TPTDKDWPEISTFGTYNKI-----QFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHK 229
           +P   +WP       +  I     + YP    EE  +  + ++E   NL  G+L  +  K
Sbjct: 407 SPNLDNWPNFFEMPWFFMIIPMLTEKYPDLF-EEKYKNLLPSSE-CFNLAKGLLLYDQKK 464

Query: 230 RWDPIQCLTSEYFVELPVP 248
           R    + L S YF E P P
Sbjct: 465 RLSAEEALKSPYFTEDPQP 483

>Kwal_27.11919
          Length = 209

 Score =  139 bits (349), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 101/159 (63%), Gaps = 7/159 (4%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSN-LNLVLEFLPADL----EMIIKDNSILFTQA 56
           +AIRE+  L+E++  N++ L D+  + ++ L LV EFL  DL    E I K+  +     
Sbjct: 51  TAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPL--GDN 108

Query: 57  DIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSN 116
            IK +++   +G+ +CH + ILHRDLKP NLL+  DG +KLADFGLAR  G P    T  
Sbjct: 109 IIKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINRDGNMKLADFGLARAFGVPLRAYTHE 168

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIP 155
           +VT WYRAPE+L G K Y+  +D+WS+G IFAE+  R P
Sbjct: 169 IVTLWYRAPEVLLGGKQYSTGVDIWSIGCIFAEMCNRKP 207

>YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain
           (CTD) kinase alpha subunit, cyclin-dependent protein
           kinase that phosphorylates C-terminal domain of RNA
           polymerase II large subunit Rpo21p [1587 bp, 528 aa]
          Length = 528

 Score =  144 bits (364), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 81/257 (31%), Positives = 134/257 (52%), Gaps = 15/257 (5%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYM-AQSNLNLVLEFLPADLEMIIKDNSILFTQADIK 59
           +++IRE+K LQ   H NV  + ++ + +Q  + ++ E+   DL  ++ +  +  + +  K
Sbjct: 225 ITSIREIKLLQSFDHPNVSTIKEIMVESQKTVYMIFEYADNDLSGLLLNKEVQISHSQCK 284

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVT 119
                 L G+ + H N ILHRD+K +N+L+   G LK+ DFGLAR M S  D  T+ V+T
Sbjct: 285 HLFKQLLLGMEYLHDNKILHRDVKGSNILIDNQGNLKITDFGLARKMNSRAD-YTNRVIT 343

Query: 120 RWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDK 179
            WYR PELL G  +Y   +DMW  G +  EL  +     G ++++QI+  F+ +GTPT  
Sbjct: 344 LWYRPPELLLGTTNYGTEVDMWGCGCLLVELFNKTAIFQGSNELEQIESIFKIMGTPTIN 403

Query: 180 DWPEISTFGTYNKIQFY---PPPSREEMRR-----RFIAATENALNLMDGMLTMNPHKRW 231
            WP +     Y+   F+   P  + + +       + +  +   L L   +L  +  KR+
Sbjct: 404 SWPTL-----YDMPWFFMIMPQQTTKYVNNFSEKFKSVLPSSKCLQLAINLLCYDQTKRF 458

Query: 232 DPIQCLTSEYFVELPVP 248
              + L S+YF E P P
Sbjct: 459 SATEALQSDYFKEEPKP 475

>Scas_667.18
          Length = 437

 Score =  142 bits (359), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 143/271 (52%), Gaps = 29/271 (10%)

Query: 3   AIREVKYLQEIR-HVNVIELIDVYMAQSN-----LNLVLEFLPADLEMIIKDNSILFTQA 56
           AIRE+K++   + H N++ LID+ +   N     L    E +  DL  +I  +SI  T+ 
Sbjct: 125 AIRELKFMNFFQGHKNIVNLIDLEIINENSPYDGLYCYQELIDYDLAKVI-HSSIKLTEF 183

Query: 57  DIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR-----------N 105
            I+ ++   L G+ + H   ++HRDLKP N+L   +G LK+ DFGLAR           N
Sbjct: 184 HIQYFMYQILSGLKYIHSADVIHRDLKPGNILCTLNGNLKICDFGLARGINPKFYNDNGN 243

Query: 106 MGSPQ-DMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDID 164
           + SP+   +T+ V TRWYRAPEL+   K YT AID+WSVG I AE   R P   G D + 
Sbjct: 244 LASPKLHDITNYVATRWYRAPELILSHKMYTKAIDLWSVGCILAEFYGRRPIFMGHDTLH 303

Query: 165 QIDVTFRALGTPTDKDWPEISTFGTYN-------KIQFYPPPSREEMRRRFIAATENALN 217
           Q+    + LG P+ +   + ++   YN       K+ +  P   + +   +  A+ ++++
Sbjct: 304 QVYEIVKILGPPSQRLLSQFASVKAYNIFNNNLAKLHWNSPIDWKTL---YPEASNSSIH 360

Query: 218 LMDGMLTMNPHKRWDPIQCLTSEYFVELPVP 248
           L+  +L  NP +R+D  Q +T  +  E+  P
Sbjct: 361 LLQNLLKWNPRERFDVEQAITHPFLNEVRTP 391

>Scas_680.20
          Length = 482

 Score =  142 bits (358), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 137/255 (53%), Gaps = 18/255 (7%)

Query: 5   REVKYLQEIRHVNVIELIDVYMA-----QSNLNLVLEFLPADLEMIIKDNSILFTQA--- 56
           RE+  L+ + H N+I L   ++      +S LNL+ EF+P  L   I+  +   +     
Sbjct: 207 RELHMLRLLDHPNIISLKYFFVEPIDNDESYLNLIFEFVPLSLYQRIRQVATTTSSVQPS 266

Query: 57  ---DIKSWLLMTLRGVHHCHRNF-ILHRDLKPNNLLLAP-DGQLKLADFGLARNMGSPQD 111
              + K ++    + + + H    I HRD+KP N+L+ P D  LK+ DFG A+ + +P D
Sbjct: 267 HKLEFKCYMWQIFKALDYLHNEVNICHRDIKPQNILIDPMDWSLKICDFGSAKRL-NPHD 325

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFR 171
              S + +R+YRAPEL+ GA  YT +ID+WS G +FAEL+L  P+  GK D DQI    R
Sbjct: 326 KNVSFICSRFYRAPELILGAIQYTNSIDLWSTGCVFAELLLLKPFFAGKSDTDQIVEIIR 385

Query: 172 ALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATE-NALNLMDGMLTMNPHKR 230
            LGTPT KD   IS    Y   +F P        R F    E +A++L+D +L  +P +R
Sbjct: 386 ILGTPTLKDI--ISMNENYKDYRF-PRIHGISWSRLFSDKVEKSAIDLLDKILRYDPTER 442

Query: 231 WDPIQCLTSEYFVEL 245
            D  +CL   YF +L
Sbjct: 443 IDSSKCLIHPYFDDL 457

>YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3
           subfamily of protein kinases, required for induction of
           IME2 by Ime1p [1113 bp, 370 aa]
          Length = 370

 Score =  140 bits (352), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 141/252 (55%), Gaps = 16/252 (6%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSN-----LNLVLEFLPADLEMIIKD---NSILFTQA 56
           RE++ ++ + H+N+I+L   +  + +     LNL+LE++P  L   ++         ++ 
Sbjct: 79  RELEIMKMLSHINIIDLKYFFYERDSQDEIYLNLILEYMPQSLYQRLRHFVHQRTPMSRL 138

Query: 57  DIKSWLLMTLRGVHHCHR-NFILHRDLKPNNLLLAPDG-QLKLADFGLARNMGSPQDMLT 114
           +IK ++    + +++ H    + HRD+KP NLL+ P+   LKL DFG A+ +  P +   
Sbjct: 139 EIKYYMFQLFKSLNYLHHFANVCHRDIKPQNLLVDPETWSLKLCDFGSAKQL-KPTEPNV 197

Query: 115 SNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALG 174
           S + +R+YRAPEL+FGA +YT  ID+WS G + AEL+L  P  PG+  IDQ+    + LG
Sbjct: 198 SYICSRYYRAPELIFGATNYTNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILG 257

Query: 175 TPTDKDWPEISTFGTYNKI-QFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDP 233
           TP+ ++   ++     +K  Q  P P    + R F    +  +  +  +L  +P +R++ 
Sbjct: 258 TPSKQEICSMNPNYMEHKFPQIKPIP----LSRVFKKEDDQTVEFLADVLKYDPLERFNA 313

Query: 234 IQCLTSEYFVEL 245
           +QCL S YF EL
Sbjct: 314 LQCLCSPYFDEL 325

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score =  142 bits (357), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 126/239 (52%), Gaps = 12/239 (5%)

Query: 3   AIREVKYLQEIR-HVNVIELID---VYMAQSNLN---LVLEFLPADLEMIIKDNSILFTQ 55
           ++RE+K L+  R H N+  L D   V+      N   L  E +  D+  I+K    L T 
Sbjct: 71  SLRELKLLRHFRGHKNITCLYDMDIVFQPDGMFNGLYLYEELMECDMHQIVKSGQPL-TD 129

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR----NMGSPQD 111
           A  +S++   L G+ + H   +LHRDLKP NLL+  D QLK+ DFGLAR    N      
Sbjct: 130 AHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQ 189

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFR 171
            LT  V TRWYRAPE++   + YT AID+WS G I AEL+   P   GKD +DQ++   +
Sbjct: 190 FLTEYVATRWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVDQLNRILQ 249

Query: 172 ALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
            LGTP ++    I +    + I       +      +  A  +ALNL++GML+ +P  R
Sbjct: 250 VLGTPPEETLKRIGSKNVQDYIHQLGYIPKIPFSTLYPNANPDALNLLEGMLSFDPQLR 308

>CAGL0D01694g complement(176981..178279) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, hypothetical start
          Length = 432

 Score =  140 bits (354), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 135/265 (50%), Gaps = 19/265 (7%)

Query: 3   AIREVKYLQEIR-HVNVIELIDVYMAQS----NLNLVLEFLPADLEMIIKDNSILFTQAD 57
           AIRE+K++   + H +++ LID+ + Q      L    E +  DL  +I  +S+  ++  
Sbjct: 118 AIREIKFMNYFKGHKHIVNLIDIEIVQDKPYDGLYCYQELIDYDLARVIH-SSVQLSEFH 176

Query: 58  IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR-------NMGSPQ 110
           I+ ++   L GV + H   ++HRDLKP N+L   +G LK+ DFGLAR       N  S  
Sbjct: 177 IQHFIYQILCGVKYIHSADVIHRDLKPGNILCTVNGCLKICDFGLARGVAKQFVNKNSKP 236

Query: 111 DMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTF 170
           + +T+ V TRWYRAPEL+     YT ++DMWSVG I AE   R P   GKD I Q+    
Sbjct: 237 NEITNYVATRWYRAPELILSNNEYTKSVDMWSVGCILAEFYGRRPIFMGKDSIHQVYEIK 296

Query: 171 RALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRR------FIAATENALNLMDGMLT 224
           + LGTP+     +  T   +N        + + ++        +  A+  AL+L+D +L 
Sbjct: 297 KILGTPSRSLLVKYGTLKAWNLFGHNSNHNLDNLKSGMPWSTVYPMASATALDLIDKLLQ 356

Query: 225 MNPHKRWDPIQCLTSEYFVELPVPT 249
             P  R + +Q L  ++   +  P 
Sbjct: 357 WEPESRLNVLQSLEHQFVQSVRKPN 381

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score =  140 bits (353), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 87/257 (33%), Positives = 133/257 (51%), Gaps = 25/257 (9%)

Query: 3   AIREVKYLQEIR-HVNVIELIDVYMAQS----NLNLVLEFLPADLEMIIKDNSILFTQAD 57
           AIRE+K++   + H N++ LI++ +        L    E +  DL  +I  N + F++  
Sbjct: 120 AIRELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDYDLARVIHSN-VQFSEFH 178

Query: 58  IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMG------SPQD 111
           IK +    L GV + H   ++HRDLKP N+L +  GQLK+ DFGLAR +          +
Sbjct: 179 IKHFTYQILCGVKYIHSADVIHRDLKPGNILCSISGQLKICDFGLARGISPLFTNTKTSN 238

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFR 171
            +T+ V TRWYRAPEL+   K Y  +IDMW++G I AE   R P   G+D + QI    +
Sbjct: 239 HITNYVATRWYRAPELILSHKRYNKSIDMWAIGCILAEFYGRKPIFMGQDSMHQISEIVK 298

Query: 172 ALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMR----RRFIAATENALNLMDGMLTMNP 227
            LGTP+      I  +G+      + PP  +  +      +  A  +AL+L++ +L    
Sbjct: 299 VLGTPSRDT---IIKYGSSRAYDIFCPPKPQYAKIPWAEIYPFAGPDALDLIERLLD--- 352

Query: 228 HKRWDPIQCLTSEYFVE 244
              WDP + LT E  +E
Sbjct: 353 ---WDPDRRLTVEEAIE 366

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score =  138 bits (348), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 90/275 (32%), Positives = 139/275 (50%), Gaps = 28/275 (10%)

Query: 3   AIREVKYLQEIR-HVNVIELIDVYMAQS-----NLNLVLEFLPADLEMIIKDNSILFTQA 56
            +RE+K L+    H N+I ++D+    S      + LV E +  DL+ II   ++  ++ 
Sbjct: 56  TLRELKLLKFFHSHENIISVLDIVRPTSWHKFEAVYLVQELMETDLQKIINQQNL--SED 113

Query: 57  DIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQD----- 111
            I+ ++   LR +   H   ++HRDLKP+NLLL  +  LK+ DFGLAR + S        
Sbjct: 114 HIQYFVYQILRALKSLHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQSRENM 173

Query: 112 --MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVT 169
              +T  V TRWYRAPE++   + YT A+D+WS G I AE+++  P  PGKD   Q+ + 
Sbjct: 174 VGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMIMGKPLFPGKDYHHQLWII 233

Query: 170 FRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRR-----RFIAATEN--ALNLMDGM 222
              LG+PT +D+ +I +      I   P      M++       +    N  A++L+  M
Sbjct: 234 LEVLGSPTLEDFEQIKSKRAKEYISQLP------MKKGIPWANVLNKEVNPLAIDLLSKM 287

Query: 223 LTMNPHKRWDPIQCLTSEYFVELPVPTTPSELPQL 257
           LT NP KR   ++ L   Y      P    + PQL
Sbjct: 288 LTFNPDKRISAVEALEHPYLATYHDPDDEPDYPQL 322

>KLLA0B11946g complement(1048033..1049352) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, start by similarity
          Length = 439

 Score =  140 bits (352), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 132/245 (53%), Gaps = 22/245 (8%)

Query: 3   AIREVKYLQEIR-HVNVIELIDVYMAQ----SNLNLVLEFLPADLEMIIKDNSILFTQAD 57
           AIRE+K++   + H N++ LID+ +      S L    E +  DL  +I  N +LF++  
Sbjct: 120 AIRELKFMSYFKGHRNIVSLIDLEIVNEEPYSGLYCYQELVDYDLARVIHSN-VLFSEFH 178

Query: 58  IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNM-------GSPQ 110
           IK +L   L G+ + H   ++HRDLKP N+L +  G++K+ DFGLAR +       G   
Sbjct: 179 IKHFLYQILCGMKYIHSADVIHRDLKPGNILCSITGEIKICDFGLARGISPSFTVAGGIS 238

Query: 111 DMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTF 170
           + +T+ V TRWYRAPEL+   K Y+ ++DMW+VG I AE   R P   G D + Q+    
Sbjct: 239 NHITNYVATRWYRAPELILSHKRYSKSVDMWAVGCILAEFYGRKPVFMGNDSLHQVMEIQ 298

Query: 171 RALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRR-----FIAATENALNLMDGMLTM 225
           + LGTP       I T+G+      +   S+ + ++      F  A+  A++LM+ ++  
Sbjct: 299 KILGTPKQ---IVIRTYGSSRCYDIF-STSKPQYKKTPWCEIFPYASSEAVDLMERLIDW 354

Query: 226 NPHKR 230
           NP  R
Sbjct: 355 NPEAR 359

>Scas_688.14
          Length = 479

 Score =  140 bits (352), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/264 (35%), Positives = 132/264 (50%), Gaps = 15/264 (5%)

Query: 3   AIREVKYLQEIR-HVNVIELID---VYMAQSNLN---LVLEFLPADLEMIIKDNSILFTQ 55
           ++RE+K L+  R H N+  L D   V+      N   L  E +  D+  IIK +  L T 
Sbjct: 69  SLRELKLLRHFRGHKNITCLYDMDIVFYPDGTFNGLYLYEELMECDMHQIIKSSQPL-TD 127

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR----NMGSPQD 111
           A  +S++   L G+ + H   +LHRDLKP NLL+  D QLK+ DFGLAR    N      
Sbjct: 128 AHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQ 187

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFR 171
            LT  V TRWYRAPE++   + YT AID+WS G I AE +   P   GKD +DQ+    +
Sbjct: 188 FLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVDQLTRILQ 247

Query: 172 ALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRW 231
            LGTP D+    I +    + I       +      +  A   AL+L++ ML  +P KR 
Sbjct: 248 VLGTPPDETLRRIGSKNVQDYIHQLGYIPKVPFVNLYPDANPQALDLLEKMLAFDPQKRI 307

Query: 232 DPIQCLTSEYFVELPVPTTPSELP 255
              + L   Y   L +   PS+ P
Sbjct: 308 TTDEALEHPY---LSIWHDPSDEP 328

>KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA61157.1
           Kluyveromyces lactis protein kinase, start by similarity
          Length = 415

 Score =  139 bits (349), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 149/260 (57%), Gaps = 17/260 (6%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSN----LNLVLEFLPADLEMIIKDNSILFTQAD--- 57
           RE++ ++ I H N+I+L   ++ QS+    LNL+++++P  L   +K+   L    D   
Sbjct: 127 RELEIMKLISHPNLIDLKYYFLEQSDQELYLNLIVDYMPMSLYQRLKEFISLHQPMDRYE 186

Query: 58  IKSWLLMTLRGVHHCHRNF-ILHRDLKPNNLLLAPDGQL-KLADFGLARNMGSPQDMLTS 115
           IK ++    + +++ H+   + HRD+KP N+L+ PD  L K+ D G A+ +  P +   S
Sbjct: 187 IKIYMFQLFKSLNYLHQVVNVCHRDIKPQNILVDPDTLLLKICDLGSAKQL-KPNEPNVS 245

Query: 116 NVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGT 175
            + +R+YRAPEL+FGA +YT  ID+WS G + AEL+L  P  PG+  IDQ+    + LGT
Sbjct: 246 YICSRYYRAPELIFGATNYTTKIDIWSAGCVMAELLLGQPIFPGESKIDQLVEIIKVLGT 305

Query: 176 PTDKDWPEISTFGTYNKI-QFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPI 234
           PT ++   ++   + +K  Q  P P    + R F   T+  ++L+  ++  +P+ R+  +
Sbjct: 306 PTREEICSMNENYSEHKFPQIRPIP----LNRIFKKETQETIDLLYHIMKYDPNIRYSAL 361

Query: 235 QCL-TSEYFVELPVPTTPSE 253
           QC+  S YF ++ V  T S+
Sbjct: 362 QCMFNSTYFTDI-VSNTGSD 380

>Scas_710.28
          Length = 352

 Score =  137 bits (344), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 130/257 (50%), Gaps = 17/257 (6%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQS--NLN---LVLEFLPADLEMIIKDNSILFTQ 55
           +  +RE+K L+  +H N+I + D+   +S  N N   ++ E +  DL  +I   ++  T 
Sbjct: 54  LRTLREIKILKHFQHENIISIFDIQRPESFENFNEVYIIQELMQTDLHRVISTQNL--TD 111

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNM--------- 106
             I+ ++  TLR V   H + ++HRDLKP+NLL+  +  LK+ DFGLAR +         
Sbjct: 112 DHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKICDFGLARIIEEDTGDDEP 171

Query: 107 -GSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQ 165
               Q+ +T  V TRWYRAPE++  A  Y+ A+D+WS G I AEL ++ P  PGKD   Q
Sbjct: 172 NAQLQNGMTEYVATRWYRAPEVMLTAARYSKAMDIWSCGCILAELFMKRPIFPGKDYRHQ 231

Query: 166 IDVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTM 225
           + + F  +GTP+ +D   I +      I   P        + F       ++L+  ML  
Sbjct: 232 LMLIFGLIGTPSGRDLLCIESRRAREYITTLPKYEPVPWEKVFPNVNPLGIDLLQRMLIF 291

Query: 226 NPHKRWDPIQCLTSEYF 242
           +P  R    + L   Y 
Sbjct: 292 DPRSRITAEEALAHPYL 308

>KLLA0D11814g complement(1007240..1009021) similar to sp|P39073
           Saccharomyces cerevisiae YPL042c SSN3 cyclin-dependent
           CTD kinase, start by similarity
          Length = 593

 Score =  140 bits (354), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/268 (33%), Positives = 145/268 (54%), Gaps = 22/268 (8%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNS----ILFTQAD 57
           SA RE+   +E+ + ++ +L+++++ + ++ +V EF   DL  II  +S     L     
Sbjct: 229 SACREMSLCRELDNNHLTKLVEIFLEKKSIYMVSEFAEHDLLQIIHFHSHPEKRLIPPRM 288

Query: 58  IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGS-PQDMLTSN 116
           +KS +   L GV + H+N+ILHRDLKP N+++  DG +K+ D GLAR   +  Q + T +
Sbjct: 289 LKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFNNMVQTLYTGD 348

Query: 117 --VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKD-----------DI 163
             +VT WYRAPEL+ GA+HYT AID+W+VG IFAEL+   P   G++             
Sbjct: 349 KVIVTIWYRAPELILGARHYTPAIDLWAVGCIFAELIGLRPIFKGEEAKMESKKSVLFQA 408

Query: 164 DQIDVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAAT---ENALNLMD 220
           +Q       +G+P  K WP I ++  Y ++    P  R+ +   +  A    + AL+++ 
Sbjct: 409 NQFQKILEVMGSPDHKIWPNIDSYPEYLQLAKM-PKYRDNLTAWYQTAGGKDKTALDILY 467

Query: 221 GMLTMNPHKRWDPIQCLTSEYFVELPVP 248
            +L  +P KR D I  L   YF     P
Sbjct: 468 RLLQYDPIKRIDAIDALDHVYFTNGDPP 495

>Kwal_23.5576
          Length = 504

 Score =  139 bits (350), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 125/239 (52%), Gaps = 12/239 (5%)

Query: 3   AIREVKYLQEIR-HVNVIELIDVYMAQS------NLNLVLEFLPADLEMIIKDNSILFTQ 55
           ++RE+K L+  R H N+  L D+ +  S       L L  E +  D+  IIK    L T 
Sbjct: 69  SLRELKLLRHFRGHKNITCLYDMDIVFSPNNTFNGLYLYEELMECDIHQIIKSGQPL-TD 127

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR----NMGSPQD 111
           A  +S++   L  + + H   +LHRDLKP NLL+  D QLK+ DFGLAR    N      
Sbjct: 128 AHYQSFIYQLLCALKYIHSADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSENPVENNQ 187

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFR 171
            LT  V TRWYRAPE++   + YT AID+WS G I AEL+   P   GKD +DQ++   +
Sbjct: 188 FLTEYVATRWYRAPEIMLSYQGYTKAIDIWSCGCILAELLGGKPIFKGKDYVDQLNRILQ 247

Query: 172 ALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
            LGTP ++    I +    + I       +      +  A   AL+L++ MLT +P KR
Sbjct: 248 VLGTPPEETLERIGSKNVQDYIHQLGYIPKVPFVTLYPQANVQALDLLEKMLTFDPQKR 306

>YHR030C (SLT2) [2317] chr8 complement(168882..170336)
           Serine/threonine protein kinase of MAP kinase family
           involved in the cell wall integrity (low-osmolarity)
           pathway and in G2 phase cell-cycle checkpoint control
           [1455 bp, 484 aa]
          Length = 484

 Score =  139 bits (349), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 124/239 (51%), Gaps = 12/239 (5%)

Query: 3   AIREVKYLQEIR-HVNVIELID---VYMAQSNLN---LVLEFLPADLEMIIKDNSILFTQ 55
           ++RE+K L+  R H N+  L D   V+    ++N   L  E +  D+  IIK    L T 
Sbjct: 69  SLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQPL-TD 127

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR----NMGSPQD 111
           A  +S+    L G+ + H   +LHRDLKP NLL+  D QLK+ DFGLAR    N      
Sbjct: 128 AHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQ 187

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFR 171
            LT  V TRWYRAPE++   + YT AID+WS G I AE +   P   GKD ++Q++   +
Sbjct: 188 FLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQ 247

Query: 172 ALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
            LGTP D+    I +    + I       +      +  A   AL+L++ ML  +P KR
Sbjct: 248 VLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQALDLLEQMLAFDPQKR 306

>Kwal_56.23841
          Length = 432

 Score =  137 bits (346), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 139/251 (55%), Gaps = 16/251 (6%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQ-SNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           RE+K L+ +RH N+I L D++++   ++  V E    DL  +++   +   +  ++ +L 
Sbjct: 69  RELKLLKHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLY 126

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             LRG+ + H   ++HRDLKP+N+L+  +  LK+ DFGLAR +  PQ  +T  V TR+YR
Sbjct: 127 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYR 183

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPE 183
           APE++   + Y   +D+WS G IFAE++   P  PGKD + Q  +    LG+P     PE
Sbjct: 184 APEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSP-----PE 238

Query: 184 --ISTFGTYNKIQFYPP-PSREEM--RRRFIAATENALNLMDGMLTMNPHKRWDPIQCLT 238
             I+T  + N ++F    P R+ +    RF     +A++L++ ML  +P+KR      L+
Sbjct: 239 DVINTICSVNTLKFVTSLPHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRITAADALS 298

Query: 239 SEYFVELPVPT 249
             Y      PT
Sbjct: 299 HPYLAPYHDPT 309

>Kwal_14.1416
          Length = 365

 Score =  136 bits (342), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 89/271 (32%), Positives = 136/271 (50%), Gaps = 19/271 (7%)

Query: 4   IREVKYLQEIR-HVNVIELIDVYMAQS-----NLNLVLEFLPADLEMIIKDNSILFTQAD 57
           +RE+K L+    H N+I ++DV    S      + LV E +  DL  +I       +   
Sbjct: 57  LRELKLLKLFHSHENIISVLDVVRPTSMDKFQAVYLVQELMETDLHKVISSGGASLSDDH 116

Query: 58  IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQ------- 110
           I+ +    LR +   H   ++HRD+KP+NLLL  +  LK+ DFGLAR + S         
Sbjct: 117 IQYFTYQILRALKAIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLISSTHSRQNLV 176

Query: 111 DMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTF 170
             +T  V TRWYRAPE++   + YT A+D+WS G I AE++   P  PG+D   Q+ +  
Sbjct: 177 GFMTEYVATRWYRAPEIMLTFQQYTVAMDIWSCGCILAEMITGKPLFPGRDYHHQLWLIL 236

Query: 171 RALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATEN----ALNLMDGMLTMN 226
            ALGTP+ +D+  I++      I     P R+++  + +   ++    A++L+D MLT N
Sbjct: 237 EALGTPSYEDFENINSKRAKEYIANL--PLRQKLPWQVVLQKQDINPQAVDLLDKMLTFN 294

Query: 227 PHKRWDPIQCLTSEYFVELPVPTTPSELPQL 257
           P KR    + L   Y      P    E P L
Sbjct: 295 PDKRISAAEALAHPYLSVYHDPEDEPEYPPL 325

>CAGL0J04290g complement(400939..402012) similar to sp|P16892
           Saccharomyces cerevisiae YBL016w FUS3 or sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1, start by
           similarity
          Length = 357

 Score =  135 bits (341), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 135/266 (50%), Gaps = 22/266 (8%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQS-----NLNLVLEFLPADLEMIIKDNSILFTQ 55
           +  +RE+K L+  +H N+I + D+   +S      + ++ E +  DL  +I   ++  T 
Sbjct: 54  LRTLREIKILRRFQHENIISIFDIQKPESFEKFNEVYIIQELMQTDLHRVIATQTL--TD 111

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDM--- 112
             I+ ++  TLR +   H + ++HRDLKP+N+L+  +  LK+ DFGLAR + S ++    
Sbjct: 112 DHIQYFIYQTLRAIKTLHGSNVIHRDLKPSNILINSNCDLKVCDFGLARIIDSGENGDNE 171

Query: 113 -----LTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQID 167
                +T  V TRWYRAPE++     Y+ A+D+WS G I  EL L+ P  PGKD   Q+ 
Sbjct: 172 VDKIGMTEYVATRWYRAPEVMLTNAKYSRAMDIWSCGCILGELFLKRPLFPGKDYRHQLL 231

Query: 168 VTFRALGTP--TDKDWPEISTFGTYNKI---QFYPPPSREEMRRRFIAATENALNLMDGM 222
           + F  +GTP  +DK    I +      I   Q YPP     +++ F       ++L+  M
Sbjct: 232 LIFGLIGTPDSSDKSMECIESRRARQYIASLQKYPPV--RPLQKAFPGVNPVGVDLLSRM 289

Query: 223 LTMNPHKRWDPIQCLTSEYFVELPVP 248
           L  +P +R      L   Y     VP
Sbjct: 290 LVFDPRERISADDALAHPYLSTYHVP 315

>YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine
           protein kinase involved in the filamentous and invasive
           growth pathway, member of the MAP kinase family [1107
           bp, 368 aa]
          Length = 368

 Score =  136 bits (342), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 137/273 (50%), Gaps = 18/273 (6%)

Query: 3   AIREVKYLQEI-RHVNVIELIDVYMAQS--NLN---LVLEFLPADLEMIIKD-NSILFTQ 55
            IRE+K L+    H N+I ++D     S   LN   LV E +  DL+ +I + NS   T 
Sbjct: 56  TIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTL 115

Query: 56  AD--IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQD-- 111
           +D  ++ +    LR +   H   ++HRD+KP+NLLL  +  LK+ DFGLAR + S  D  
Sbjct: 116 SDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSR 175

Query: 112 -----MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQI 166
                 +T  V TRWYRAPE++   + YT A+D+WS G I AE++   P  PG+D   Q+
Sbjct: 176 ETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQL 235

Query: 167 DVTFRALGTPTDKDWPEISTFGTYNKIQFYP--PPSREEMRRRFIAATENALNLMDGMLT 224
            +    LGTP+ +D+ +I +      I   P  PP   E          + ++L+D ML 
Sbjct: 236 WLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQ 295

Query: 225 MNPHKRWDPIQCLTSEYFVELPVPTTPSELPQL 257
            NP KR    + L   Y      P+   E P L
Sbjct: 296 FNPDKRISAAEALRHPYLAMYHDPSDEPEYPPL 328

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score =  136 bits (342), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 88/261 (33%), Positives = 130/261 (49%), Gaps = 27/261 (10%)

Query: 3   AIREVKYLQEIR-HVNVIELIDV-----YMAQSNLNLVLEFLPADLEMIIKDNSILFTQA 56
            +RE+K L+    H N+I ++D+     Y     + LV E +  DL+ II   +   +  
Sbjct: 56  TLRELKLLKFFHSHENIISVLDIVRPTSYQDFEAVYLVQELMETDLQRIISQPNSFLSDD 115

Query: 57  DIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQ------ 110
            I+ +    LR +   H   ++HRDLKP+NLLL     LKL DFGL+R + S        
Sbjct: 116 HIQYFTYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENM 175

Query: 111 -DMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVT 169
              +T  V TRWYRAPE++   + YT A+D+WS G I AE++   P  PG+D   Q+ + 
Sbjct: 176 VGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMISGKPLFPGRDYHHQLWII 235

Query: 170 FRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRF---IAATEN-----ALNLMDG 221
              LGTP+ +D+ +I +      I   P      MR +    +A + N     A++L+D 
Sbjct: 236 LEILGTPSFEDFEQIKSKRAKAYIANLP------MRPKIPWNVALSTNDINPLAMDLLDK 289

Query: 222 MLTMNPHKRWDPIQCLTSEYF 242
           MLT NP KR      L   Y 
Sbjct: 290 MLTFNPDKRISAADALKHPYL 310

>Kwal_27.12559
          Length = 414

 Score =  136 bits (343), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 138/270 (51%), Gaps = 23/270 (8%)

Query: 3   AIREVKYLQEIR-HVNVIELIDVYMAQS----NLNLVLEFLPADLEMIIKDNSILFTQAD 57
           AIRE+K+L   + H N++ L+D+ +        L    E +  DL  +I  +++ F++  
Sbjct: 113 AIRELKFLNFFKGHKNIVSLVDLEIVSEKPYDGLYCYQELVDYDLARVIH-STVQFSEFH 171

Query: 58  IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMG-------SPQ 110
           IK +L   L G+ + H   ++HRDLKP N+L +  G LK+ DFGLAR +        S +
Sbjct: 172 IKHFLYQILCGLKYIHSADVIHRDLKPGNILCSIGGNLKICDFGLARGIAPQYFEQKSDE 231

Query: 111 DMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTF 170
             +TS V TRWYRAPEL+   + YT AID+W+VG I AE   R P   G D + Q+    
Sbjct: 232 IHITSYVATRWYRAPELILSHRRYTKAIDIWAVGCILAEFYGRKPIFMGHDSLHQVSEIL 291

Query: 171 RALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRR-----FIAATENALNLMDGMLTM 225
           + LG+P  +    ++ + +    + +    R E+++      +  +  +A  L+D +LT 
Sbjct: 292 KVLGSPCRET---VAKYCSARSWEIF--SGRSEVKKMPWSSVYPKSCSDAQALLDMLLTW 346

Query: 226 NPHKRWDPIQCLTSEYFVELPVPTTPSELP 255
           +P KR      L   +F ++  P      P
Sbjct: 347 DPDKRPGVEVALCHPFFEDVSNPYDEPSCP 376

>YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine protein
           kinase required for cell cycle arrest and for cell
           fusion during mating, member of the MAP kinase family of
           protein kinases [1062 bp, 353 aa]
          Length = 353

 Score =  135 bits (339), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 132/258 (51%), Gaps = 18/258 (6%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQS--NLN---LVLEFLPADLEMIIKDNSILFTQ 55
           +  +RE+K L+  +H N+I + ++    S  N N   ++ E +  DL  +I  ++ + + 
Sbjct: 54  LRTLREIKILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVI--STQMLSD 111

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP------ 109
             I+ ++  TLR V   H + ++HRDLKP+NLL+  +  LK+ DFGLAR +         
Sbjct: 112 DHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSE 171

Query: 110 ----QDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQ 165
               Q  +T  V TRWYRAPE++  +  Y+ A+D+WS G I AEL LR P  PG+D   Q
Sbjct: 172 PTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQ 231

Query: 166 IDVTFRALGTP-TDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLT 224
           + + F  +GTP +D D   I +      I+  P      + + F       ++L+  ML 
Sbjct: 232 LLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLV 291

Query: 225 MNPHKRWDPIQCLTSEYF 242
            +P KR    + L   Y 
Sbjct: 292 FDPAKRITAKEALEHPYL 309

>KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1
           Kluyveromyces lactis CTD kinase largest subunit,
           hypothetical start
          Length = 455

 Score =  137 bits (344), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 133/263 (50%), Gaps = 26/263 (9%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSN-LNLVLEFLPADLEMIIKDNSILFTQADIK 59
           +++IRE+K LQ++ H N+  + ++ ++  N +++  +++  DL  ++ D SI F+ ++IK
Sbjct: 171 ITSIREIKLLQQLNHPNISLIHEIIVSDKNTISMGFQYMENDLSGMLMDKSIQFSDSNIK 230

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR---NMGSPQDMLTSN 116
             +     G+ + H+  I+HRD+K +NLL+   G LK+ DFGLA+   ++ SP    T+ 
Sbjct: 231 HLMKQLFVGLQYLHQQQIVHRDIKGSNLLIDNRGNLKITDFGLAKKLTDVSSPASN-TNR 289

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
           V+T WYR PELL GA  Y   +D W  G +  EL       PG +++DQ       +G+P
Sbjct: 290 VITLWYRPPELLLGATDYKYEVDCWGCGCLLVELFAGAAIFPGSNEVDQFQRILSIMGSP 349

Query: 177 TDKDWPEI-----------STFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTM 225
           T + WP++               TY  + F            F    ++AL+L   +L  
Sbjct: 350 TLEQWPKMLDMPWWFMLVPQISKTYKNVFF----------DEFSKVPQDALDLASKLLRY 399

Query: 226 NPHKRWDPIQCLTSEYFVELPVP 248
           +   R+   + L   YF   P P
Sbjct: 400 DQDTRFTTTEALQHHYFTNEPKP 422

>Scas_713.38
          Length = 432

 Score =  136 bits (342), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 137/251 (54%), Gaps = 16/251 (6%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQ-SNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           RE+K L+ +RH N+I L D++++   ++  V E    DL  +++   +   +  ++ +L 
Sbjct: 69  RELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLY 126

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             LRG+ + H   ++HRDLKP+N+L+  +  LK+ DFGLAR +  PQ  +T  V TR+YR
Sbjct: 127 QILRGLKYVHSVGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYR 183

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPE 183
           APE++   + Y   +D+WS G IFAE++   P  PGKD + Q  +    LG+P     PE
Sbjct: 184 APEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSP-----PE 238

Query: 184 --ISTFGTYNKIQFYPP-PSREEM--RRRFIAATENALNLMDGMLTMNPHKRWDPIQCLT 238
             I+T  + N ++F    P R+ +    RF     +A++L+  ML  +P KR    + L 
Sbjct: 239 DVINTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRVTAAEALA 298

Query: 239 SEYFVELPVPT 249
             Y      PT
Sbjct: 299 HPYLAPYHDPT 309

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score =  137 bits (346), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 91/264 (34%), Positives = 136/264 (51%), Gaps = 15/264 (5%)

Query: 3   AIREVKYLQEIR-HVNVIELIDVYM------AQSNLNLVLEFLPADLEMIIKDNSILFTQ 55
           ++RE+K L+  R H N+  L D+ +      + + L+L  E +  D+  IIK    L T 
Sbjct: 69  SLRELKLLRHFRGHKNITCLYDMDIVLLPDGSFNGLDLYEELMEWDMHQIIKSGQPL-TD 127

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP----QD 111
           A  +S++   L G+ + H   +LHRDLKP NLL+  D QLK+ DFGLAR           
Sbjct: 128 AHYQSFVYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPIENDQ 187

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFR 171
            LT  V TRWYRAPE++   + YT AID+WS G + AEL+   P   GKD +DQ++   +
Sbjct: 188 FLTEYVATRWYRAPEIMLSYQGYTRAIDVWSCGCVLAELLGGRPIFKGKDYVDQLNRILQ 247

Query: 172 ALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRW 231
            LGTP ++    I +    + I       +    R +  A  +A +L++ ML ++P  R 
Sbjct: 248 VLGTPPEETLKRIGSKNVQDYIHQLGYIPKVPFERLYPNANPDAADLLERMLALDPKTRI 307

Query: 232 DPIQCLTSEYFVELPVPTTPSELP 255
              + L   Y   L +   PS+ P
Sbjct: 308 TVDEALEHPY---LSIWHDPSDEP 328

>Kwal_47.17868
          Length = 365

 Score =  134 bits (336), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 140/253 (55%), Gaps = 18/253 (7%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSN------LNLVLEFLPADLEMIIK---DNSILFTQ 55
           RE++ +++++H  V++L   Y  +++      LNL+LE++P  L   ++          +
Sbjct: 76  RELEIMKQLQHPQVVDL-KYYFYETDPQGEVYLNLILEYMPQSLYQRLRHFVSQRSNMPR 134

Query: 56  ADIKSWLLMTLRGVHHCHRNF-ILHRDLKPNNLLLAPDG-QLKLADFGLARNMGSPQDML 113
            +IK ++    + +++ H N  + HRD+KP NLL+ P    LKL DFG A+ +  P +  
Sbjct: 135 IEIKLYMYQLAKSLNYLHTNARVCHRDIKPQNLLVDPQTFALKLCDFGSAKQL-KPSEPN 193

Query: 114 TSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRAL 173
            S + +R+YRAPEL+FGA +YT  ID+WS G + AEL+L  P  PG+  IDQ+    + L
Sbjct: 194 VSYICSRYYRAPELIFGASNYTVQIDIWSSGCVMAELILGQPMFPGESGIDQLVEIIKIL 253

Query: 174 GTPTDKDWPEISTFGTYNKI-QFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWD 232
           GTPT ++   ++     +K  Q  P P    + + F    +  +  +  +L  +P +R+ 
Sbjct: 254 GTPTKQEICSMNPNYMEHKFPQIRPIP----LAKVFKREDDETIRFLFDVLRYDPTERYT 309

Query: 233 PIQCLTSEYFVEL 245
            +QCL + YF EL
Sbjct: 310 ALQCLCAPYFDEL 322

>Scas_683.6
          Length = 377

 Score =  134 bits (336), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 89/272 (32%), Positives = 136/272 (50%), Gaps = 17/272 (6%)

Query: 3   AIREVKYLQEIR-HVNVIELID----VYMAQ-SNLNLVLEFLPADLEMIIKDNSI--LFT 54
            +RE+K L     H N+I ++D    + M +   + LV E +  DL+ +I +N+     T
Sbjct: 56  TLREIKLLTYFNNHENIISILDKIKPISMDKFQAVYLVQELMETDLQRVISNNNTNKSLT 115

Query: 55  QADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQD--- 111
              I+ +    LR +   H   ++HRDLKP+NLLL  +  LK+ DFGL+R + S  D   
Sbjct: 116 DDHIQYFTYQILRALKSIHSAKVIHRDLKPSNLLLNSNCDLKICDFGLSRCLTSSNDSKK 175

Query: 112 ----MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQID 167
                +T  V TRWYRAPE++   + YT A+D+WSVG I AE++   P  PG+D   Q+ 
Sbjct: 176 TLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSVGCILAEMVTGRPLFPGRDYHHQLW 235

Query: 168 VTFRALGTPTDKDWPEISTFGTYNKIQFYP--PPSREEMRRRFIAATENALNLMDGMLTM 225
           +    LGTP+ +D+ +I +      I   P  PP   ++         + ++L+  ML  
Sbjct: 236 LILEVLGTPSLEDFEQIKSKRAREYIANLPLKPPMAWDIVLSNTNLNPDLIDLLTKMLMF 295

Query: 226 NPHKRWDPIQCLTSEYFVELPVPTTPSELPQL 257
           NP+KR    + L   Y      P    E P L
Sbjct: 296 NPNKRISAAEALQHPYLSTYHDPQDEPEYPPL 327

>Scas_623.11
          Length = 378

 Score =  133 bits (335), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 140/253 (55%), Gaps = 18/253 (7%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSN------LNLVLEFLPADLEMIIKD---NSILFTQ 55
           RE++ ++ I+H NVI L   Y  + +      LNL+L+++P  L   ++         ++
Sbjct: 87  RELEIMKLIQHPNVINL-KYYFYEKDVDDEVYLNLILDYMPQSLYQRLRHFVHQRQSMSR 145

Query: 56  ADIKSWLLMTLRGVHHCHR-NFILHRDLKPNNLLLAPDG-QLKLADFGLARNMGSPQDML 113
            +IK ++    + +++ H    + HRD+KP N+L+ P+   LKL DFG A+ +  P +  
Sbjct: 146 LEIKFYMFQLFKSLNYLHNAKNVCHRDIKPQNILVDPNSWNLKLCDFGSAKQL-KPTEPN 204

Query: 114 TSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRAL 173
            S + +R+YRAPEL+FGA +Y+  ID+WS G + AEL+L  P  PG+  IDQ+    + L
Sbjct: 205 VSYICSRYYRAPELIFGATNYSNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKIL 264

Query: 174 GTPTDKDWPEISTFGTYNKI-QFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWD 232
           GTP+ ++   ++     +K  Q  P P    + + F    E  ++ +   L  +P +R++
Sbjct: 265 GTPSKQEICAMNPNYMEHKFPQIKPIP----LAKVFKKEDELTVDFLINTLKYDPMERFN 320

Query: 233 PIQCLTSEYFVEL 245
            +QCL S YF EL
Sbjct: 321 SLQCLCSTYFDEL 333

>YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK),
           principal component of the high-osmolarity signal
           transduction pathway [1308 bp, 435 aa]
          Length = 435

 Score =  134 bits (338), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/249 (34%), Positives = 137/249 (55%), Gaps = 12/249 (4%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQ-SNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           RE+K L+ +RH N+I L D++++   ++  V E    DL  +++   +   +  ++ +L 
Sbjct: 69  RELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLY 126

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             LRG+ + H   ++HRDLKP+N+L+  +  LK+ DFGLAR +  PQ  +T  V TR+YR
Sbjct: 127 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYR 183

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPE 183
           APE++   + Y   +D+WS G IFAE++   P  PGKD + Q  +    LG+P  KD   
Sbjct: 184 APEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPP-KDV-- 240

Query: 184 ISTFGTYNKIQFYPP-PSREEM--RRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240
           I+T  + N ++F    P R+ +    RF     +A++L++ ML  +P KR      L   
Sbjct: 241 INTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHP 300

Query: 241 YFVELPVPT 249
           Y      PT
Sbjct: 301 YSAPYHDPT 309

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score =  134 bits (338), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/249 (34%), Positives = 137/249 (55%), Gaps = 12/249 (4%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQ-SNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           RE+K L+ +RH N+I L D++++   ++  V E    DL  +++   +   +  ++ +L 
Sbjct: 75  RELKLLKHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFLQYFLY 132

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             LRG+ + H   ++HRDLKP+N+L+  +  LK+ DFGLAR +  PQ  +T  V TR+YR
Sbjct: 133 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYR 189

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPE 183
           APE++   + Y   +D+WS G IFAE++   P  PGKD + Q  +    LG+P  KD   
Sbjct: 190 APEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPP-KDV-- 246

Query: 184 ISTFGTYNKIQFYPP-PSREEM--RRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240
           I T  + N ++F    P R+ +    RF     +A++L++ ML  +P KR      LT  
Sbjct: 247 IDTICSENTLKFVTSLPHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAGDALTHP 306

Query: 241 YFVELPVPT 249
           Y      PT
Sbjct: 307 YLAPYHDPT 315

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score =  134 bits (337), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/249 (34%), Positives = 136/249 (54%), Gaps = 12/249 (4%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQ-SNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           RE+K L+ +RH N+I L D++++   ++  V E    DL  +++   +   +  ++ +L 
Sbjct: 68  RELKLLKHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLY 125

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             LRG+ + H   ++HRDLKP+N+L+  +  LK+ DFGLAR +  PQ  +T  V TR+YR
Sbjct: 126 QILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYR 182

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPE 183
           APE++   + Y   +D+WS G IFAE++   P  PGKD + Q  +    LG+P  KD   
Sbjct: 183 APEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPP-KDV-- 239

Query: 184 ISTFGTYNKIQFYPP-PSREEM--RRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240
           I T  + N ++F    P R+ +    RF     +A++L++ ML  +P KR      L   
Sbjct: 240 IDTICSENTLKFVTSLPHRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRITAADALAHP 299

Query: 241 YFVELPVPT 249
           Y      PT
Sbjct: 300 YLSPYHDPT 308

>CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces
           cerevisiae YGR040w KSS1, start by similarity
          Length = 398

 Score =  133 bits (334), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 131/273 (47%), Gaps = 17/273 (6%)

Query: 1   MSAIREVKYLQEIR-HVNVIELIDVYMAQSNLN-----LVLEFLPADLEMIIKDNSILFT 54
           +  IRE+K L     H N+I + +      ++N     LV E +  DL  I+  ++ L T
Sbjct: 76  IRTIREIKILSHFNNHENIITIFEKIKPMQSINFKEIYLVQELMETDLSRILASSNTL-T 134

Query: 55  QADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNM-------- 106
              I+ +L   LR +   H   ++HRDLKP+N+LL  +  LK+ DFGLAR          
Sbjct: 135 VDHIQYFLYQILRALKAIHSAKVIHRDLKPSNILLNSNCDLKICDFGLARTYDPDDDAST 194

Query: 107 --GSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDID 164
             G+    LT  V TRWYRAPE++   + Y+ AID+WS G + AE++ R P  PGKD   
Sbjct: 195 MNGNNVGFLTEYVATRWYRAPEIMLNFQDYSTAIDIWSCGCVLAEMLFRKPIFPGKDYHH 254

Query: 165 QIDVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLT 224
           Q+ +    LGTP+ +D   I+       I   P   +++  +      E  L+++D ++ 
Sbjct: 255 QLLLILDTLGTPSPEDIEAINYGRAKEYILSLPHFPKKDWSQLLGTDNEMLLDILDKLMI 314

Query: 225 MNPHKRWDPIQCLTSEYFVELPVPTTPSELPQL 257
            NP +R    Q L   +      P      P L
Sbjct: 315 FNPKRRITAEQALEHPFLATYHDPKDEPNFPPL 347

>AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH]
           (234347..236092) [1746 bp, 581 aa]
          Length = 581

 Score =  134 bits (338), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 92/271 (33%), Positives = 147/271 (54%), Gaps = 22/271 (8%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNS----ILFTQA 56
            SA RE+   +E+ + ++ +L+++++ + ++ +V EF   DL  II  +S     L    
Sbjct: 214 QSACREMSLCRELDNKHLTKLVEIFLERKSIYMVSEFAEHDLLQIIHFHSHPEKRLIAPR 273

Query: 57  DIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGS-PQDMLTS 115
            +KS +   L GV + H+N+ILHRDLKP N+++  DG +K+ D GLAR   +  Q + T 
Sbjct: 274 MLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFYNLVQTLYTG 333

Query: 116 N--VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKD-----------D 162
           +  VVT WYRAPELL GA+HY+ AID+W+VG IF+EL+   P   G++            
Sbjct: 334 DKVVVTIWYRAPELLLGARHYSPAIDLWAVGCIFSELIGLRPIFKGEEAKMDSKKSVPFQ 393

Query: 163 IDQIDVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAAT---ENALNLM 219
            +Q+      LGTPT   WP I  +  Y ++  +    R+ +   + ++    + AL+L+
Sbjct: 394 GNQLQRILEVLGTPTHHTWPNIHKYPEYEQLSKF-SKYRDNLSVWYHSSGGRDKAALSLL 452

Query: 220 DGMLTMNPHKRWDPIQCLTSEYFVELPVPTT 250
             +L  +P  R D I  L  EYF     P +
Sbjct: 453 YSLLKYDPITRIDAIDALEHEYFTNNDPPVS 483

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score =  132 bits (332), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 82/249 (32%), Positives = 133/249 (53%), Gaps = 12/249 (4%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQ-SNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           RE+K L+ +RH N+I L D++++   ++  V E    DL  +++   +   +  ++ +  
Sbjct: 69  RELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFHY 126

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             LRG+ + H   ++HRDLKP+N+L+  +  LK+ DFGLAR +  PQ  +T  V TR+YR
Sbjct: 127 QILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYR 183

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPE 183
           APE++   + Y   +D+WS G IFAE++   P  PGKD + Q  +    LG+P       
Sbjct: 184 APEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSD---V 240

Query: 184 ISTFGTYNKIQFYPP-PSREEM--RRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240
           I T  + N ++F    P R+ +    RF     +A++L++ ML  +P KR      L   
Sbjct: 241 IDTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHP 300

Query: 241 YFVELPVPT 249
           Y      PT
Sbjct: 301 YLAPYHDPT 309

>ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C
           (MRK1) - SH] complement(1141943..1143085) [1143 bp, 380
           aa]
          Length = 380

 Score =  130 bits (327), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 83/253 (32%), Positives = 143/253 (56%), Gaps = 17/253 (6%)

Query: 5   REVKYLQEIRHVNVIEL-IDVYMA--QSN---LNLVLEFLPADLEMIIKD---NSILFTQ 55
           RE++ ++ ++H NV++L    Y +  Q+N   LNL+LE++P  L   ++      +L  +
Sbjct: 72  RELEIMKLLQHPNVVDLRYHFYESEPQTNEVYLNLILEYMPQSLYQRLRHFVTGRLLMPR 131

Query: 56  ADIKSWLLMTLRGVHHCHR-NFILHRDLKPNNLLL-APDGQLKLADFGLARNMGSPQDML 113
            +IK ++    + +++ HR   + HRD+KP NLL+ A   QLKL DFG A+ +  P +  
Sbjct: 132 DEIKVYMFQLFKSLNYLHRVARVCHRDIKPQNLLVDAGTLQLKLCDFGSAKQL-RPTEPN 190

Query: 114 TSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRAL 173
            S + +R+YRAPEL+FGA +YT  ID+WS G + AEL+L  P  PG+  I Q+    + L
Sbjct: 191 VSYICSRYYRAPELIFGATNYTTQIDIWSTGCVMAELLLGQPMFPGEFVIVQLAEIIKIL 250

Query: 174 GTPTDKDWPEIS-TFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWD 232
           GTPT ++   ++  +  +   Q  P P    + + F     + + L+  +L  +P +R++
Sbjct: 251 GTPTRQEICAMNENYSDHKFPQIKPIP----LSKVFKREDAHTVQLLSDVLQYDPTRRFN 306

Query: 233 PIQCLTSEYFVEL 245
            +  + S YF E+
Sbjct: 307 ALMAMCSSYFDEI 319

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score =  129 bits (325), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 138/253 (54%), Gaps = 18/253 (7%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSN------LNLVLEFLPADLEMIIKD---NSILFTQ 55
           RE++ ++ ++H N+I+L   Y  + +      LNL+L+++P  L   ++          +
Sbjct: 77  RELEIMKMLQHRNIIDL-KYYFYEIDEREDVFLNLILDYMPQSLYQRLRHFVHQRTPMPR 135

Query: 56  ADIKSWLLMTLRGVHHCHRNF-ILHRDLKPNNLLLAPDG-QLKLADFGLARNMGSPQDML 113
            +IK ++    + +++ H    + HRD+KP NLL+ P+   L+L DFG A+ +  P +  
Sbjct: 136 LEIKIYMYQLFKALNYLHHTANVCHRDIKPQNLLVDPNSWCLRLCDFGSAKQL-KPTEPN 194

Query: 114 TSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRAL 173
            S + +R+YRAPEL+FGA +YT  ID+WS G + AEL+L  P  PG+  IDQ+    + L
Sbjct: 195 VSYICSRYYRAPELIFGATNYTNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKIL 254

Query: 174 GTPTDKDWPEISTFGTYNKI-QFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWD 232
           GTPT ++   ++     +K  Q  P P    + + F    E  ++ +      +P +R+ 
Sbjct: 255 GTPTKQEICVMNPNYMEHKFPQIKPIP----LAKVFKKEDEVTVDFLSNTFKYDPTQRYH 310

Query: 233 PIQCLTSEYFVEL 245
            +QCL + YF E+
Sbjct: 311 SLQCLCTPYFDEI 323

>YKL161C (YKL161C) [3109] chr11 complement(149391..150692)
           Serine/threonine protein kinase with similarity to MAP
           kinases [1302 bp, 433 aa]
          Length = 433

 Score =  128 bits (322), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 84/240 (35%), Positives = 122/240 (50%), Gaps = 14/240 (5%)

Query: 3   AIREVKYLQEIR-HVNVIELID---VYMAQSNLNLVL---EFLPADLEMIIKDNSILFTQ 55
            +RE+K L+ +R H N++ L D   V+     LN V    E +  DL  II+    L   
Sbjct: 69  TLRELKLLRHLRGHPNIVWLFDTDIVFYPNGALNGVYLYEELMECDLSQIIRSEQRL-ED 127

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLA----RNMGSPQD 111
           A  +S++   L  + + H   +LH DLKP NLL+  D QLK+ +FGL+     N      
Sbjct: 128 AHFQSFIYQILCALKYIHSANVLHCDLKPKNLLVNSDCQLKICNFGLSCSYSENHKVNDG 187

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFR 171
            +   + + WY+APE+L   +  T A+D+WS G I AEL+ R P   GKD +D ++   +
Sbjct: 188 FIKGYITSIWYKAPEILLNYQECTKAVDIWSTGCILAELLGRKPMFEGKDYVDHLNHILQ 247

Query: 172 ALGTPTDKDWPEISTFGTYNKI-QFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
            LGTP ++   EI++   YN I QF   P R         A   AL L+  ML  +P KR
Sbjct: 248 ILGTPPEETLQEIASQKVYNYIFQFGNIPGR-SFESILPGANPEALELLKKMLEFDPKKR 306

>Scas_22.1
          Length = 248

 Score =  118 bits (295), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 122/236 (51%), Gaps = 31/236 (13%)

Query: 23  DVYMAQSNLNLVLEFLPADL-----EMIIKDNSILFTQADIKSW-LLMTLRGVHHCHRNF 76
           DVY     LNLVLE++P+ L       +   +++   +  +  + L  +L  +H C R  
Sbjct: 23  DVY-----LNLVLEYMPSSLYQRLRHFVTHRSNMPAIEVKLYMYQLFKSLNYLHTCAR-- 75

Query: 77  ILHRDLKPNNLLLAPDG-QLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYT 135
           + HRD+KP NLL+ P    LKL DFG A+ +  P +   S + +R+YRAPEL+FGA +YT
Sbjct: 76  VCHRDIKPQNLLVDPTTFSLKLCDFGSAKQL-KPTEPNVSYICSRYYRAPELIFGATNYT 134

Query: 136 GAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEIS-TFGTYNKIQ 194
             ID+WS G + AEL+L  P  PG+  IDQ+    + LGTP  ++   ++  +  +   Q
Sbjct: 135 TQIDVWSSGCVMAELILGQPMFPGESGIDQLVEIIKILGTPNKREICAMNPNYMDHKFPQ 194

Query: 195 FYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYFVELPVPTT 250
             P P  +  +R      ++               ++  +QCL + YF EL  P++
Sbjct: 195 IVPIPLNKVFKREQEETVQS---------------KFTALQCLCASYFDELRQPSS 235

>YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..314748)
           Member of the GSK-3 subfamily of protein kinases [1506
           bp, 501 aa]
          Length = 501

 Score =  117 bits (294), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 128/250 (51%), Gaps = 14/250 (5%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSN-----LNLVLEFLPADLEMIIKDNSILFTQ---A 56
           RE++ ++ + H N + L   +  +       LNLVL+++P  L   ++    L  Q    
Sbjct: 204 RELETMKMLCHPNTVGLQYYFYEKDEEDEVYLNLVLDYMPQSLYQRLRHFVNLKMQMPRV 263

Query: 57  DIKSWLLMTLRGVHHCHRN-FILHRDLKPNNLLLAPDG-QLKLADFGLARNMGSPQDMLT 114
           +IK +     + +++ H    I HRD+KP NLL+ P     K+ DFG A+ +  P     
Sbjct: 264 EIKFYAYQLFKALNYLHNVPRICHRDIKPQNLLVDPTTFSFKICDFGSAKCL-KPDQPNV 322

Query: 115 SNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALG 174
           S + +R+YRAPEL+FGA +Y+  +D+WS   + AEL+L  P   G+  IDQ+    + +G
Sbjct: 323 SYICSRYYRAPELMFGATNYSNQVDVWSSACVIAELLLGKPLFSGESGIDQLVEIIKIMG 382

Query: 175 TPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPI 234
            PT KD  EIS      +   +P      +   F A   + L+L+   L  +P +R  P+
Sbjct: 383 IPT-KD--EISGMNPNYEDHVFPNIKPITLAEIFKAEDPDTLDLLTKTLKYHPCERLVPL 439

Query: 235 QCLTSEYFVE 244
           QCL S YF E
Sbjct: 440 QCLLSSYFDE 449

>Scas_678.13
          Length = 462

 Score =  110 bits (275), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 123/256 (48%), Gaps = 22/256 (8%)

Query: 3   AIREVKYLQEIR-HVNVIELID---VYMAQSNLNLVL---EFLPADLEMIIKDNSILFTQ 55
           A+RE+K LQ    H N+I L D   V+     LN +    E +  D+E IIK    L T+
Sbjct: 69  ALRELKLLQAFNGHKNIISLYDMDIVFYPTGILNGIYIYEELMECDMEQIIKSRQPL-TE 127

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR---------NM 106
              + ++   L G+ + H   I+ R+++P+NLL+  D +LK+  F LA+         N 
Sbjct: 128 YHYQFFIYQILCGLRYIHSADIIMRNVRPSNLLINSDCKLKICGFSLAQKASNGVANNNQ 187

Query: 107 GSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQI 166
            SP+ +      TRWY APELL     YT +ID+WS G +  EL+ + P     D ++Q+
Sbjct: 188 FSPEYL-----TTRWYHAPELLLNHHIYTTSIDVWSTGCVLGELITKEPIFHENDFVNQL 242

Query: 167 DVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMN 226
           +  F+ LGT + +    I +    N +   P   +  M   F  AT    +L++ ML  +
Sbjct: 243 NKIFQILGTHSKEALDNIGSKTIKNHVSQLPYIPKPPMENIFPGATTECQDLLNKMLKFD 302

Query: 227 PHKRWDPIQCLTSEYF 242
             +R      L   YF
Sbjct: 303 SEQRITVDMALRHPYF 318

>YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine
           protein kinase and positive regulator of early, middle,
           and late meiotic genes, may act as a meiosis-specific
           regulator of the anaphase promoting complex [1938 bp,
           645 aa]
          Length = 645

 Score =  110 bits (276), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 136/281 (48%), Gaps = 42/281 (14%)

Query: 2   SAIREVKYLQEI-RHVNVIELIDVYMAQSN--LNLVLEFLPADL-EMIIKDNSILFTQAD 57
           + +RE+K++  I  + ++I++ +V++   N  L++V+E +  +L +M+      +F+   
Sbjct: 110 TRVREIKFILAIPANDHLIQIFEVFIDSENYQLHIVMECMEQNLYQMMKHRRRRVFSIPS 169

Query: 58  IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-----------------LKLADF 100
           +KS L   L G+ H H +   HRDLKP N+L+ P  Q                 +KLADF
Sbjct: 170 LKSILSQILAGLKHIHEHNFFHRDLKPENILITPSTQYFEKEYMNQIGYQDNYVIKLADF 229

Query: 101 GLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGK 160
           GLAR++ + ++  T+ V TRWYR+PE+L  + +Y+  +D+W+ G +  E+ +     PG 
Sbjct: 230 GLARHVEN-KNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAVEVTVFRALFPGA 288

Query: 161 DDIDQIDVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMD 220
           ++IDQI      LGTP  +     S F   N I   PP    +     +      L  ++
Sbjct: 289 NEIDQIWKILEVLGTPIKR-----SDFVNTNHITAPPPGGFWDDASNLVHKLNLKLPYVE 343

Query: 221 GMLTMNPHK---------------RWDPIQCLTSEYFVELP 246
           G    +                  RWDP +  T++   E+P
Sbjct: 344 GSSLDHLLSSSQLSDLSEVVKKCLRWDPNERATAQELCEMP 384

>Scas_711.15
          Length = 727

 Score =  110 bits (275), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 113/196 (57%), Gaps = 22/196 (11%)

Query: 2   SAIREVKYLQEI-RHVNVIELIDVYMAQSN--LNLVLEFLPADL-EMIIKDNSILFTQAD 57
           + +REVK++  +  + ++I++ +++   SN  L++V+E +  +L +M++     +F+   
Sbjct: 110 TRVREVKFILALPTNKHLIQIFEIFADTSNYQLHIVMECMEQNLYQMMLHRKKRVFSIPS 169

Query: 58  IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-----------------LKLADF 100
           +KS L   L G+ H H +   HRD+KP N+L++P+ +                 +KLADF
Sbjct: 170 LKSILAQILAGIKHIHDHNFFHRDIKPENILVSPNKRYFDKERLELGFYPDNYVVKLADF 229

Query: 101 GLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGK 160
           GLAR++ + ++  T+ V TRWYR+PE+L    +Y+  +D+W+ G +  E  +  P  PG 
Sbjct: 230 GLARHVEN-KNTYTAYVSTRWYRSPEILLRNGYYSTPLDIWAFGCVAVEATIFKPLFPGS 288

Query: 161 DDIDQIDVTFRALGTP 176
           +++DQI      LGTP
Sbjct: 289 NELDQIWRILEVLGTP 304

>Kwal_26.7276
          Length = 646

 Score =  108 bits (271), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 135/277 (48%), Gaps = 39/277 (14%)

Query: 4   IREVKYLQEI-RHVNVIELIDVYMAQSN--LNLVLEFLPADLEMIIKDN-SILFTQADIK 59
           +REVK++  +  H N++++ ++++   N  L++V+E +  +L  +++     +F+   +K
Sbjct: 127 VREVKFILSMPAHRNLVQIWELFIDDVNYQLHIVMECMEQNLYQLMRARRKRVFSLPSLK 186

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-----------------LKLADFGL 102
           S L   + G+ H H +   HRDLKP N+L++P                    +K+AD+GL
Sbjct: 187 SILTQLITGIRHIHSHNFFHRDLKPENILISPSNHYFSKDWILNGNYSDNYVVKIADYGL 246

Query: 103 ARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDD 162
           AR++ + +   T+ V TRWYR+PE+L     Y+  +D+W+ G +  E+    P  PG D+
Sbjct: 247 ARHVTN-KSPYTAYVSTRWYRSPEILLRKGSYSRPLDIWAFGCVVVEVATFRPLFPGSDE 305

Query: 163 IDQIDVTFRALGTPTDKDWPEISTF----GTYNKIQFYPPPSREEMRRRFIAAT------ 212
           +DQI      LGTP       IS +    G++ K +     SR  ++  ++  T      
Sbjct: 306 MDQIWKILEVLGTPHTMSESAISGYQPHGGSWEKAEVL--ASRLNLKFPYVEGTSIESIV 363

Query: 213 -----ENALNLMDGMLTMNPHKRWDPIQCLTSEYFVE 244
                +    ++   LT +P KR    +     YF E
Sbjct: 364 ANPHLQELCEVVKECLTWDPKKRATVDEICAMPYFAE 400

>CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces
           cerevisiae YJL106w IME2 ser/thr protein kinase,
           hypothetical start
          Length = 751

 Score =  108 bits (271), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 107/194 (55%), Gaps = 22/194 (11%)

Query: 4   IREVKYLQEI---RHVNVIELIDVYMAQSNLNLVLEFLPADL-EMIIKDNSILFTQADIK 59
           +REVK++  +   +H+  +  I V   +  L++ +E++  +L +M+ +    +F+   +K
Sbjct: 126 VREVKFILSMTANKHLIQVYEIFVDSEKYQLHIAMEYMEQNLYQMMRRRKKRVFSIPSLK 185

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-----------------LKLADFGL 102
           S L   L G+ H H     HRDLKP N+L+ P  +                 +KLADFGL
Sbjct: 186 SILAQVLAGLRHIHDQNFFHRDLKPENILITPSTRYFDSSWLEKGNYPDNYVVKLADFGL 245

Query: 103 ARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDD 162
           AR++ + ++  T+ V TRWYR+PE+L  + +Y+  +D+W+ G +  E+ +  P  PG ++
Sbjct: 246 ARHVEN-KNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAMEVTVFKPLFPGSNE 304

Query: 163 IDQIDVTFRALGTP 176
           IDQI      LGTP
Sbjct: 305 IDQIWKILEVLGTP 318

>Kwal_55.22001
          Length = 363

 Score =  105 bits (261), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 132/275 (48%), Gaps = 25/275 (9%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQS------NLNLVLEFLPADLEMII---KDNSILFTQ 55
           RE++ L+   H NV++L   +   S        +L +E LP  L++ I     N +    
Sbjct: 70  RELEILRIADHPNVVKLEYFFTHTSPQDNKLYQHLAMECLPETLQLEIHRYASNKLELPL 129

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPD-GQLKLADFGLARNMGSPQDMLT 114
              K +     RG+ + H   I HRD+KP+N+L+ P+ G LK+ DFG A+ +   Q  + 
Sbjct: 130 KHTKLYTYQIARGMLYLHALGICHRDIKPSNVLVDPNTGVLKICDFGSAKKLEQNQPSI- 188

Query: 115 SNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALG 174
           S + +R+YRAPEL+ G   YT  ID+W +G +  E+++      G++ + Q+    + LG
Sbjct: 189 SYICSRFYRAPELIVGCTQYTTQIDIWGLGCVMGEMLIGKAVFQGQEPLLQLREISKLLG 248

Query: 175 TPTDKDWPEISTFGTYNKIQFYPP----PSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
            P DK +   S   +Y+   F  P      +E   + F  A    ++L+  +LT  P +R
Sbjct: 249 -PPDKKFLFFSN-PSYDGPLFSKPLFTGSVQERFEKHFGQAGPEGIDLLMKILTYEPERR 306

Query: 231 WDPIQCLTSEYFVELPVP--------TTPSELPQL 257
             P + L   +F +L           T P  LP+L
Sbjct: 307 LSPRRILAHPFFEDLKKERYFFPRGHTQPKYLPEL 341

>KLLA0E07414g complement(672690..673787) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 365

 Score =  104 bits (260), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 78/255 (30%), Positives = 125/255 (49%), Gaps = 17/255 (6%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLN------LVLEFLPADLEMII---KDNSILFTQ 55
           RE++ L+   H NV++L   Y   S  +      L +E LP  L+  I   K N++    
Sbjct: 71  RELEILRIADHPNVVKLEYFYTHISPTDHKLYQHLAMECLPEMLQNEILRYKKNNLELPL 130

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPD-GQLKLADFGLARNMGSPQDMLT 114
             +K +     RG+ + H   I HRD+KP+N+L+ P  G LK+ DFG A+ + S Q  + 
Sbjct: 131 KHVKLYAYQIARGMLYLHALGICHRDIKPSNVLVDPQTGILKICDFGSAKKLESNQPSI- 189

Query: 115 SNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALG 174
           S + +R+YRAPEL+ G   YT  ID+W +G +  E++L      G   + Q+    + LG
Sbjct: 190 SYICSRYYRAPELIVGCTQYTTKIDIWGLGCVLGEMLLGKAVFQGHQPLLQLHEITKLLG 249

Query: 175 TPTDKDWPEISTFGTYNKIQFYPP----PSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
            P DK +   S   +YN   F  P      +    + F  A  + ++L+  +L   P +R
Sbjct: 250 -PPDKRFIFFSN-PSYNGPLFSKPLFEGAPKARFEKYFGYAGPDGVDLLMSVLVYEPERR 307

Query: 231 WDPIQCLTSEYFVEL 245
             P + L   +F +L
Sbjct: 308 ASPRRILAHPFFDDL 322

>KLLA0F02838g 264329..266596 some similarities with sp|P32581
           Saccharomyces cerevisiae YJL106w IME2 ser/thr protein
           kinase, hypothetical start
          Length = 755

 Score =  106 bits (265), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 109/194 (56%), Gaps = 22/194 (11%)

Query: 4   IREVKYLQEI-RHVNVIELIDVYMAQS--NLNLVLEFLPADLEMIIKDNSI-LFTQADIK 59
           +RE+K++ +I  H N++ + ++++  S  +L++V+E +  ++  ++K     +F+   ++
Sbjct: 111 VREIKFILQIPAHKNLVTIYEMFIDDSLYHLHIVMECMEQNIYQLMKHRKRRVFSLPTLR 170

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-----------------LKLADFGL 102
           S L   L G+ H H +   HRD+KP N+L++P  +                 +KLAD+GL
Sbjct: 171 SILFQILAGIKHIHDHDFFHRDIKPENILISPSHRYFSKKWLEDDNYSDNYVVKLADYGL 230

Query: 103 ARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDD 162
           AR++ + +   T+ V TRWYR+PE+L    +Y+  +D+W+ G +  EL    P  PG D+
Sbjct: 231 ARHVNN-RSPYTTYVSTRWYRSPEILLRKGYYSKPLDIWAYGCVVVELATFSPLFPGSDE 289

Query: 163 IDQIDVTFRALGTP 176
            DQI      LG+P
Sbjct: 290 TDQIWRILDLLGSP 303

>AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH]
           complement(564252..566714) [2463 bp, 820 aa]
          Length = 820

 Score =  104 bits (260), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 113/205 (55%), Gaps = 22/205 (10%)

Query: 4   IREVKYLQEI-RHVNVIELIDVYMAQS--NLNLVLEFLPADLEMIIK-DNSILFTQADIK 59
           +RE+K++ +I  H +++++ ++++  S   L++V+E +  ++  ++K     +F+   ++
Sbjct: 111 VREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMKCRKRRVFSLPTLR 170

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-----------------LKLADFGL 102
           S L   L G+ H H +   HRD+KP N+L++P  +                 +K+AD+GL
Sbjct: 171 SILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHYPDNYVVKIADYGL 230

Query: 103 ARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDD 162
           AR++ + +   T+ V TRWYR+PE+L     Y+  +D+W+ G +  E+    P  PG D+
Sbjct: 231 ARHVTN-KSPYTAYVSTRWYRSPEILLRQGSYSRPLDIWAFGCVAVEVATFKPLFPGADE 289

Query: 163 IDQIDVTFRALGTPTDKDWPEISTF 187
           +DQI      LGTP      +IS +
Sbjct: 290 MDQIWKILELLGTPHPCHESKISGY 314

>CAGL0E01683g complement(166584..167711) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 or sp|Q12222
           Saccharomyces cerevisiae YOL128c, start by similarity
          Length = 375

 Score =  102 bits (255), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 125/254 (49%), Gaps = 15/254 (5%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQS------NLNLVLEFLPADLEMIIK---DNSILFTQ 55
           RE++ L+   H N+++L   +   S        +L +E LP  L++ I     N++    
Sbjct: 79  RELQILRLTDHPNIVKLEYFFTHTSPKDNKVYQHLAMECLPETLQIEINRYTSNNLQLAI 138

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPD-GQLKLADFGLARNMGSPQDMLT 114
             +K +     RG+ + H   I HRD+KP+N+L+ P  G LK+ DFG A+ +  P     
Sbjct: 139 KHVKLYSYQIARGMLYLHALGICHRDIKPSNILVDPKTGVLKICDFGSAKRL-EPNQPSI 197

Query: 115 SNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALG 174
           S + +R+YRAPEL+ G+  YT  +D+W +G +  E+++      G+D + Q+    + LG
Sbjct: 198 SYICSRFYRAPELILGSTQYTTQVDIWGLGCVIGEMLIGRAIFQGQDPLLQLREIAKLLG 257

Query: 175 TPTDKDWPEIST---FGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRW 231
            P DK +   S     G       +   S E  ++ F  A  + ++L+  +L   P  R+
Sbjct: 258 -PPDKKFIFFSNPRYTGPLYSTPLFNGTSLERFQKYFGHAGPDGIDLLMKVLKYEPELRF 316

Query: 232 DPIQCLTSEYFVEL 245
            P + +   +F +L
Sbjct: 317 SPRRIMAHPFFDDL 330

>YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of the
           GSK3 subfamily of protein kinases, positive regulator of
           meiosis and spore formation [1128 bp, 375 aa]
          Length = 375

 Score =  102 bits (253), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 129/255 (50%), Gaps = 17/255 (6%)

Query: 5   REVKYLQEIRHVNVIELIDVYM---AQSN---LNLVLEFLPADLEMIIK---DNSILFTQ 55
           RE++ L+   H N+++L   +     Q N    +L +E LP  L++ I     N +    
Sbjct: 79  RELQILRIADHPNIVKLQYFFTHLSPQDNKVYQHLAMECLPETLQIEINRYVTNKLEMPL 138

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPD-GQLKLADFGLARNMGSPQDMLT 114
             I+ +     RG+ + H   + HRD+KP+N+L+ P+ G LK+ DFG A+ +   Q  + 
Sbjct: 139 KHIRLYTYQIARGMLYLHGLGVCHRDIKPSNVLVDPETGVLKICDFGSAKKLEHNQPSI- 197

Query: 115 SNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALG 174
           S + +R+YRAPEL+ G   YT  ID+W +G +  E+++      G++ + Q+    + LG
Sbjct: 198 SYICSRFYRAPELIIGCTQYTTQIDIWGLGCVMGEMLIGKAIFQGQEPLLQLREIAKLLG 257

Query: 175 TPTDKDWPEISTFGTYNKIQFYPP----PSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
            P DK +   S    Y+   F  P     S++   + F  +  + ++L+  +L   P +R
Sbjct: 258 -PPDKRFIFFSN-PAYDGPLFSKPLFSGSSQQRFEKYFGHSGPDGIDLLMKILVYEPQQR 315

Query: 231 WDPIQCLTSEYFVEL 245
             P + L  ++F EL
Sbjct: 316 LSPRRILAHQFFNEL 330

>ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -
           SH] (398519..399607) [1089 bp, 362 aa]
          Length = 362

 Score =  102 bits (253), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 78/275 (28%), Positives = 135/275 (49%), Gaps = 25/275 (9%)

Query: 5   REVKYLQEIRHVNVIELIDVYM------AQSNLNLVLEFLPADLEMII---KDNSILFTQ 55
           RE+  L+   H NV++L   +        +   +L +E LP  L+  I     N +    
Sbjct: 69  RELAILRIADHPNVVKLEYFFTHVSPSDGKVYQHLAMECLPETLQHEILRYTQNKLELPL 128

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAP-DGQLKLADFGLARNMGSPQDMLT 114
             IK +     RG+ + H   I HRD+KP+N+L+ P  G LK+ DFG A+ +   Q  + 
Sbjct: 129 KHIKMYTYQIARGMLYLHALGICHRDIKPSNILVDPKSGVLKICDFGSAKKLEQNQPSI- 187

Query: 115 SNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALG 174
           S + +R+YRAPEL+ G   YT  ID+W +G +  E+++      G++ + Q+    + LG
Sbjct: 188 SYICSRFYRAPELIVGCTQYTTQIDIWGLGCVIGEMLIGKAVFQGQEPLLQLHEIAKLLG 247

Query: 175 TPTDKDWPEIS--TFGT--YNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
            P DK +   S  ++G   ++K  F   P ++   + F  A    ++L+  +L  +P +R
Sbjct: 248 -PPDKKFIFFSNPSYGGPLFSKPLFNGTP-QQRFEKYFGHAGPEGIDLLMKVLCYSPERR 305

Query: 231 WDPIQCLTSEYFVEL-------PVPTT-PSELPQL 257
             P + L   +  EL       P  ++ P ++P+L
Sbjct: 306 LSPRRVLCHAFLDELRNDRYFFPAGSSQPKQMPEL 340

>Scas_635.1
          Length = 378

 Score = 99.8 bits (247), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 125/255 (49%), Gaps = 17/255 (6%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQS------NLNLVLEFLPADLEMIIK---DNSILFTQ 55
           RE++ L+   H N+++L   +   S        +L +E LP  L++ I     N +    
Sbjct: 83  RELEILRITNHPNIVKLEYFFTHVSPQDHKVYQHLAMECLPETLQIEISRYAHNKMELAL 142

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPD-GQLKLADFGLARNMGSPQDMLT 114
             +K +     RG+ + H   I HRD+KP+N+L+ P+ G LK+ DFG A+ +   Q  + 
Sbjct: 143 KHVKLYSYQIARGMLYLHALGICHRDIKPSNILVDPNTGVLKICDFGSAKRLEINQPSI- 201

Query: 115 SNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALG 174
           S + +R+YRAPEL+ G   YT  +D+W +G +  E++L      G++ + Q+    + LG
Sbjct: 202 SYICSRFYRAPELILGCTQYTTQVDIWGLGCVIGEMLLGKAIFQGQEPLLQLREIAKLLG 261

Query: 175 TPTDKDWPEISTFGT----YNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
            P DK +   S  G     Y+K   +   S+    + F  A    ++L+  +L   P  R
Sbjct: 262 -PPDKKFIFFSNPGYDGPLYSK-PLFSGTSQSRFEKYFGHAGVEGIDLLMKVLVYEPEIR 319

Query: 231 WDPIQCLTSEYFVEL 245
             P + L   +F +L
Sbjct: 320 LSPRRILAHPFFDDL 334

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  100 bits (250), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 130/255 (50%), Gaps = 38/255 (14%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADL-EMIIKDNSILFTQADIKSWLL 63
           RE+ YL+ +RH ++I+L DV  ++  + +V+E+   +L + I++ N +  ++ + + +  
Sbjct: 86  REISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRNKM--SEQEARRFFQ 143

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             +  V +CHR+ I+HRDLKP NLLL     +K+ADFGL+ N+ +  + L ++  +  Y 
Sbjct: 144 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-NIMTDGNFLKTSCGSPNYA 202

Query: 124 APELLFGAKHYTGAIDMWSVGVI-FAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
           APE++ G  +    +D+WS GVI +  L  R+P+     D + I V F+ +         
Sbjct: 203 APEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF-----DDESIPVLFKNISN------- 250

Query: 183 EISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYF 242
                G Y   +F  P + + ++R               ML +NP  R    + +  E+F
Sbjct: 251 -----GVYTLPKFLSPGASDLIKR---------------MLIVNPLNRISIHEIMQDEWF 290

Query: 243 -VELPVPTTPSELPQ 256
            V+L     P +L Q
Sbjct: 291 KVDLAEYLVPQDLKQ 305

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 98.2 bits (243), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 131/253 (51%), Gaps = 38/253 (15%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADL-EMIIKDNSILFTQADIKSWLL 63
           RE+ YL+ +RH ++I+L DV  ++  + +V+E+   +L + I++ + +  ++ + + +  
Sbjct: 86  REISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKM--SENEARRFFQ 143

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             +  V +CHR+ I+HRDLKP NLLL     +K+ADFGL+ N+ +  + L ++  +  Y 
Sbjct: 144 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-NIMTDGNFLKTSCGSPNYA 202

Query: 124 APELLFGAKHYTGAIDMWSVGVI-FAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
           APE++ G  +    +D+WS GVI +  L  R+P+     D + I V F+ +         
Sbjct: 203 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF-----DDESIPVLFKNISN------- 250

Query: 183 EISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYF 242
                G Y+  +F                ++ A NL+  ML +NP  R    + +  E+F
Sbjct: 251 -----GVYSIPKFL---------------SQGAANLIKRMLIVNPLNRITIHEIMEDEWF 290

Query: 243 -VELPVPTTPSEL 254
            V+LP    P ++
Sbjct: 291 KVDLPDYLVPVDM 303

>Scas_660.28
          Length = 623

 Score = 97.4 bits (241), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 128/255 (50%), Gaps = 38/255 (14%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADL-EMIIKDNSILFTQADIKSWLL 63
           RE+ YL+ +RH ++I+L DV  ++  + +V+E+   +L + I++ + +  ++ + + +  
Sbjct: 93  REISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYAGNELFDYIVQRDKM--SEDEARRFFQ 150

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             +  V +CHR+ I+HRDLKP NLLL     +K+ADFGL+ N+ +  + L ++  +  Y 
Sbjct: 151 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-NIMTDGNFLKTSCGSPNYA 209

Query: 124 APELLFGAKHYTGAIDMWSVGVI-FAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
           APE++ G  +    +D+WS GVI +  L  R+P+     D + I V F+ +         
Sbjct: 210 APEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF-----DDESIPVLFKNINN------- 257

Query: 183 EISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYF 242
                G Y   +F                ++ A  L+  ML +NP  R    + +  E+F
Sbjct: 258 -----GVYTIPKFL---------------SQGASTLIKKMLIVNPLNRISIQEIMQDEWF 297

Query: 243 -VELPVPTTPSELPQ 256
              LP    P +L Q
Sbjct: 298 KAGLPEYLIPQDLKQ 312

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 97.4 bits (241), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 128/253 (50%), Gaps = 38/253 (15%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADL-EMIIKDNSILFTQADIKSWLL 63
           RE+ YL+ +RH ++I+L DV  ++  + +V+E+   +L + I++ + +  ++ + + +  
Sbjct: 102 REISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKM--SEQEARRFFQ 159

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             +  V +CHR+ I+HRDLKP NLLL     +K+ADFGL+ N+ +  + L ++  +  Y 
Sbjct: 160 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-NIMTDGNFLKTSCGSPNYA 218

Query: 124 APELLFGAKHYTGAIDMWSVGVI-FAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
           APE++ G  +    +D+WS GVI +  L  R+P+     D + I V F+ +         
Sbjct: 219 APEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF-----DDESIPVLFKNISN------- 266

Query: 183 EISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYF 242
                G Y   +F  P                A  L+  ML +NP  R    + +  ++F
Sbjct: 267 -----GVYTLPKFLSP---------------GAAGLIKRMLIVNPLNRISIHEIMQDDWF 306

Query: 243 -VELPVPTTPSEL 254
            V+LP    P +L
Sbjct: 307 KVDLPEYLLPPDL 319

>Kwal_47.18233
          Length = 598

 Score = 96.7 bits (239), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 122/240 (50%), Gaps = 37/240 (15%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADL-EMIIKDNSILFTQADIKSWLL 63
           RE+ YL+ +RH ++I+L DV  ++  + +V+E+   +L + I++ + +  ++ + + +  
Sbjct: 78  REISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYAGNELFDYIVQRDKM--SENEARRFFQ 135

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             +  V +CHR+ I+HRDLKP NLLL     +K+ADFGL+ N+ +  + L ++  +  Y 
Sbjct: 136 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-NIMTDGNFLRTSCGSPNYA 194

Query: 124 APELLFGAKHYTGAIDMWSVGVI-FAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
           APE++ G  +    +D+WS GVI +  L  R+P+     D + I V F+ +         
Sbjct: 195 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF-----DDESIPVLFKNISN------- 242

Query: 183 EISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYF 242
                G Y   +F  P                A NL+  ML +NP  R    + +  E+F
Sbjct: 243 -----GIYTLPKFLSP---------------GAANLIKRMLIVNPLNRITIHEIMQDEWF 282

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 95.9 bits (237), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/252 (28%), Positives = 128/252 (50%), Gaps = 38/252 (15%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADL-EMIIKDNSILFTQADIKSWLL 63
           RE+ YL+ +RH ++I+L DV  ++  + +V+E+   +L + I++ + +   +A  + +  
Sbjct: 82  REISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMPEQEA--RRFFQ 139

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             +  V +CHR+ I+HRDLKP NLLL     +K+ADFGL+ N+ +  + L ++  +  Y 
Sbjct: 140 QIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-NIMTDGNFLKTSCGSPNYA 198

Query: 124 APELLFGAKHYTGAIDMWSVGVI-FAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
           APE++ G  +    +D+WS GVI +  L  R+P+     D + I V F+ +         
Sbjct: 199 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF-----DDESIPVLFKNISN------- 246

Query: 183 EISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYF 242
                G Y    F                ++ A +L+  ML +NP  R    + +  E+F
Sbjct: 247 -----GVYTIPNFL---------------SQGAASLIKKMLIVNPVNRITVHEIMQDEWF 286

Query: 243 -VELPVPTTPSE 253
            V+LP    P+E
Sbjct: 287 KVDLPDYLVPAE 298

>YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of the
           GSK-3 subfamily of protein kinases, has strong
           similarity to Mck1p [1128 bp, 375 aa]
          Length = 375

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 89/182 (48%), Gaps = 14/182 (7%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNL---------NLVLEFLPADLEMIIK---DNSILF 53
           E++ LQ IRH N++ L   + +             N V+E++P  L   I    DN    
Sbjct: 86  ELEILQNIRHPNLVTLEFFFESHCTTKDGGHLYQKNFVMEYIPQTLSSEIHEYFDNGSKM 145

Query: 54  TQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPD-GQLKLADFGLARNMGSPQDM 112
               IK +    LR +   H   I H DLKP+N+L+ P  G  K+ DFG A+ +    ++
Sbjct: 146 PTKHIKLYTFQILRALLTLHSMSICHGDLKPSNILIIPSSGIAKVCDFGSAQRLDDNTEL 205

Query: 113 LTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRA 172
            T    +R+YRAPELL  +K YT  ID+WS+G I  E++   P   G     Q++   + 
Sbjct: 206 KTY-FCSRFYRAPELLLNSKDYTTQIDIWSLGCIIGEMIKGQPLFKGDSANSQLEEIAKL 264

Query: 173 LG 174
           LG
Sbjct: 265 LG 266

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 92.4 bits (228), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 99/189 (52%), Gaps = 17/189 (8%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           I E+  ++  RH N++  ID Y+ + +L +++E++       +  + IL T+  I +   
Sbjct: 726 INEILVMKGSRHNNIVNFIDSYLLKGDLWVIMEYMEGGSLTDVVTHCIL-TEGQIAAVSR 784

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
            TLRG+H  H   ++HRD+K +N+LL+ DG +KL DFG    +       T+ V T ++ 
Sbjct: 785 ETLRGLHFLHSKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWM 844

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRAL------GTP 176
           APE++   K Y   +D+WS+G++  E++    PYL         +   RAL      GTP
Sbjct: 845 APEVV-SRKEYGPKVDIWSLGIMIIEMIEGEPPYL--------NETPLRALYLIATNGTP 895

Query: 177 TDKDWPEIS 185
             KD   +S
Sbjct: 896 KLKDADSLS 904

>CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces
           cerevisiae YFL029c CAK1 cdk-activating protein kinase,
           hypothetical start
          Length = 360

 Score = 89.7 bits (221), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 103/225 (45%), Gaps = 51/225 (22%)

Query: 16  VNVIELIDVYMAQSNLNLVLEFLPADLEMIIKD----------------------NSILF 53
            +VI+LI+     SN+ L  +F P DLE  ++                        S   
Sbjct: 59  AHVIKLIEDQCKNSNIELWFKFYPIDLEDYLRSCFKPQNKFNPYYTLGEVLETSLRSSYV 118

Query: 54  TQADI----KSWLLMTLRGVHHCHRNFILHRDLKPNNLLLA--PDGQLKLA--DFGLA-- 103
            + D+    K + L  ++G++  H++ I+HRD+KP N++L     G+  L   DFG++  
Sbjct: 119 NEFDVNEFAKDFFLQIVKGLNFIHQSGIIHRDIKPRNIVLEKLSTGKFNLVLIDFGISYD 178

Query: 104 ---RNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELM--------- 151
               N+    D   ++V T  Y+APELLFG K+Y+ A+D+W++ VI +            
Sbjct: 179 ITETNIDERPDSKITDVSTSIYKAPELLFGVKNYSSAVDIWAMLVILSNFFSLASDCKNY 238

Query: 152 ----LRIPYLPGKDDIDQIDV---TFRALGTPTDKDWPEISTFGT 189
                   Y PG++D   I +    F   G PT  +WPE+   G+
Sbjct: 239 LSSCFDDGYRPGEEDGSDIKLIFSIFEKFGVPTANEWPEVINHGS 283

>Scas_493.2
          Length = 1117

 Score = 89.0 bits (219), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 69/228 (30%), Positives = 115/228 (50%), Gaps = 32/228 (14%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFL-PADLEMIIKDNSILFTQADIKSWLL 63
           RE+  ++ +RH NV+ L DV+   SNL ++LE+    +L  ++ +   L  +  ++ +  
Sbjct: 83  REIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR-FFR 141

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             + G+ +CH   I+HRDLKP NLLL     +K+ADFG+A  + +   +L ++  +  Y 
Sbjct: 142 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSPHYA 200

Query: 124 APELLFGAKHYTGAIDMWSVGVI-FAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
           APE++ G  ++    D+WS GVI FA L  R+P+       D+ D   R L         
Sbjct: 201 APEIVSGIPYHGFESDVWSCGVILFALLTGRLPF-------DEEDGNIRNLLLKVQSGQF 253

Query: 183 EISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
           E+              P  +EM R       +A +L+  +LT++P KR
Sbjct: 254 EM--------------PDDDEMSR-------DAQDLISRILTVDPTKR 280

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 91/154 (59%), Gaps = 4/154 (2%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFL-PADLEMIIKDNSILFTQADIKSWLL 63
           RE+  ++ + H NV+ L DV+   +NL L+LE+    +L  ++ D+  L  +  I  +  
Sbjct: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
           + + G+ +CH   I+HRDLKP NLLL     +K+ADFG+A  + +  D+L ++  +  Y 
Sbjct: 136 III-GISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYA 193

Query: 124 APELLFGAKHYTGAIDMWSVGVI-FAELMLRIPY 156
           APE++ G  +   A D+WS GVI FA L  R+P+
Sbjct: 194 APEIVSGLPYEGFASDVWSCGVILFALLTGRLPF 227

>ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH]
           (503670..504788) [1119 bp, 372 aa]
          Length = 372

 Score = 86.7 bits (213), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 121/249 (48%), Gaps = 34/249 (13%)

Query: 15  HVNVIELIDVYM--AQSNLNLVLEFLP-ADLEMIIKDNSILFTQADIKSWLLMTLRGVHH 71
           H N+I L+DV          LV E++   D  ++       F+  DI+ ++   L+ + +
Sbjct: 129 HENIIHLLDVIKDPISRTPALVFEYVDNVDFRILYP----TFSDMDIRYYMFELLKALDY 184

Query: 72  CHRNFILHRDLKPNNLLL-APDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFG 130
           CH   I+HRD+KP+N+++     +L+L D+GLA  +  P++   + V +R+++ PELL  
Sbjct: 185 CHSMGIMHRDVKPHNVMIDHKQRKLRLIDWGLA-ELYHPKEEYNARVASRFFKGPELLVD 243

Query: 131 AKHYTGAIDMWSVGVIFAELM-LRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTFGT 189
            + Y  ++D+WS+G + A ++ ++ P+  G+ + DQ+    R LG+           F  
Sbjct: 244 YRMYDYSLDLWSLGTMLASMVFMKEPFFHGRSNTDQLVKIVRVLGS---------EDFEK 294

Query: 190 Y-NKIQFYPPPSREEM----RR----------RFIAATENALNLMDGMLTMNPHKRWDPI 234
           Y  K Q   P    +M    RR          R +   E  ++L+D +L  + H+R    
Sbjct: 295 YLVKYQITLPREFMDMDQYIRRPWKRFINDANRHLCDNEEIIDLIDNILKYDHHERLTAR 354

Query: 235 QCLTSEYFV 243
           + +   +F 
Sbjct: 355 EAMQHPWFA 363

>KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces
           cerevisiae YJL141c YAK1 ser/thr protein kinase, start by
           similarity
          Length = 704

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 122/276 (44%), Gaps = 52/276 (18%)

Query: 19  IELIDVYMAQSNLNLVLEFLPADLEMIIKDNSIL-FTQADIKSWLLMTLRGVHHCHRNFI 77
           + L D ++ + +L LV E L  +L  ++K N     +   IK++    L  +     + +
Sbjct: 396 LRLHDTFVHKHHLCLVFELLSNNLYELLKLNEFHGLSMTLIKTFSKQLLDSLCVLKDSKL 455

Query: 78  LHRDLKPNNLLLAPDGQ--LKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYT 135
           +H DLKP N+LL  + +  LK+ DFG A         + + + +R+YRAPE+L G  + T
Sbjct: 456 IHCDLKPENILLVSNDRPDLKVIDFGSA---CEETRTIYTYIQSRFYRAPEVLLGIPYST 512

Query: 136 GAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP----------TDKDWPEIS 185
           G IDMWS G I AEL L IP  PG  + DQ+     +LG P          + K + +++
Sbjct: 513 G-IDMWSFGCIVAELFLGIPIFPGNSEFDQVTRIVESLGMPPAWMCDMGKNSKKYFHKMN 571

Query: 186 T-------FGTYNKIQFYPPPSREEMRR----------------------------RFIA 210
           T         T ++       + E ++R                            R I 
Sbjct: 572 TTVEKKFRMKTIDEFNLEFAANEESVKRYVKHILFDDIIRNARISKRISGNPALVEREIK 631

Query: 211 ATENALNLMDGMLTMNPHKRWDPIQCLTSEYFVELP 246
             +  L+ + G+L +NP +RW P Q +   +  E P
Sbjct: 632 NRDCLLHFLRGVLNLNPLERWTPQQAILHPFITEEP 667

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 87.0 bits (214), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 124/274 (45%), Gaps = 62/274 (22%)

Query: 19  IELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQAD-IKSWLLMTLRGVHHCHRNFI 77
           + + D ++ +++L LV E L  +L  ++K N         I+++    L  +     + +
Sbjct: 433 LRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESKL 492

Query: 78  LHRDLKPNNLLL-APDG-QLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYT 135
           +H DLKP N+LL APD  +LK+ DFG +         + + + +R+YRAPE++ G   Y+
Sbjct: 493 IHCDLKPENILLCAPDKPELKIIDFGSSCEEAR---TVYTYIQSRFYRAPEIILGIP-YS 548

Query: 136 GAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTD--------------KDW 181
            +IDMWS+G I AEL L IP  PG  + +Q+      LG P                K  
Sbjct: 549 TSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNSGKFMKKLA 608

Query: 182 PEISTFGT--------------YNKIQFYPPPSREEMR----------RRFIAATENALN 217
           PE S+  T              YN ++    PS++  +           R+  + +N+  
Sbjct: 609 PEESSSSTQKHRMKTIEEFCREYNIVE---KPSKQYFKWRKLPDIIRNYRYPKSIQNSQE 665

Query: 218 LMD--------------GMLTMNPHKRWDPIQCL 237
           L+D              G+L +NP +RW P Q +
Sbjct: 666 LIDQEMQNRECLIHFLGGVLNLNPLERWTPQQAM 699

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 129/291 (44%), Gaps = 61/291 (20%)

Query: 8   KYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQAD-IKSWLLMTL 66
           K +  +   + + L D ++ +++L LV E L  +L  ++K N       + IK++    L
Sbjct: 326 KRIDPLNQHHFLRLHDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSMNLIKNFCKQLL 385

Query: 67  RGVHHCHRNFILHRDLKPNNLLL-APDG-QLKLADFGLARNMGSPQDMLTSNVVTRWYRA 124
             +     + ++H DLKP N+LL +PD  +LK+ DFG A         + + + +R+YRA
Sbjct: 386 DSLCVLKESKLIHCDLKPENVLLVSPDRPELKVIDFGSACEEAR---TVYTYIQSRFYRA 442

Query: 125 PELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGT--------- 175
           PE+L G   Y+ +IDMWS G I AEL L IP  PG  + +Q+      LG          
Sbjct: 443 PEVLMGIP-YSTSIDMWSFGCIVAELFLGIPVFPGASEFNQMTRIVEMLGVPPPWMCEMG 501

Query: 176 -----------PTDKDWPEISTFGTYNKIQFYPPPSREEMRRRF---------------- 208
                      P +K W  + T   YN ++F    + EE+ +++                
Sbjct: 502 KNTYNFFRKLHPQEKAW-ALKTVDEYN-VEFN---ASEEVGKQYFKWTKLDDVIRNYRIS 556

Query: 209 --IAATENAL-----------NLMDGMLTMNPHKRWDPIQCLTSEYFVELP 246
             I A+   L           + + G+L +NP +RW P Q L   +    P
Sbjct: 557 KKIGASSQLLEREMQDRQCLTHFLFGVLNLNPLERWTPQQALLHPFITGQP 607

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 86.7 bits (213), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 71/228 (31%), Positives = 114/228 (50%), Gaps = 32/228 (14%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFL-PADLEMIIKDNSILFTQADIKSWLL 63
           RE+  ++ + H NV+ L DV+   ++L LVLE+    +L  ++ +   L     I+ +  
Sbjct: 80  REIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR-FFR 138

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             + GV +CH   I+HRDLKP NLLL     +K+ADFG+A  + +   +L ++  +  Y 
Sbjct: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYA 197

Query: 124 APELLFGAKHYTGAIDMWSVGVI-FAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
           APE++ G  +   A D+WS GVI FA L  R+P+       D+ D   R L     K   
Sbjct: 198 APEIVSGIPYQGFASDVWSCGVILFALLTGRLPF-------DEEDGNIRTLLLKVQKGEF 250

Query: 183 EISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
           E+              PS +E+ R        A +L+  +LT++P +R
Sbjct: 251 EM--------------PSDDEISRE-------AQDLIRKILTVDPERR 277

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 85.9 bits (211), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 52/161 (32%), Positives = 91/161 (56%), Gaps = 8/161 (4%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWL 62
           RE+  ++ I H NV+ L++V+  +S L LVLE++      + ++    +  ++ +   + 
Sbjct: 175 REIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKL--SEPEAVHYF 232

Query: 63  LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-LKLADFGLARNMGSPQDMLTSNVVTRW 121
              ++GV +CH   I HRDLKP NLLL    + +K+ADFG+A  +  P  +L ++  +  
Sbjct: 233 TQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAA-LELPNKLLETSCGSPH 291

Query: 122 YRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDD 162
           Y +PE++ G  ++ G  D+WS G+I   L+    +LP  DD
Sbjct: 292 YASPEIVMGKPYHGGPSDVWSCGIILFALL--TGHLPFNDD 330

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 85.5 bits (210), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 100/190 (52%), Gaps = 10/190 (5%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSW 61
           + E++  + + H N+++ ID +    N+ ++LE  P    +E+I K  +I  T+ +++ +
Sbjct: 126 LSEIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTI--TEPEVRFF 183

Query: 62  LLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRW 121
           +     G+ + H N ++HRDLK  N+       LK+ DFGLA  + + ++   +   T  
Sbjct: 184 MTQICGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPN 243

Query: 122 YRAPELLFGAKH--YTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQI--DVTFRALGTPT 177
           Y APE+L G KH  ++  +D+WS+GV+   L++  P    K D++ I   +  R    P 
Sbjct: 244 YIAPEVLMG-KHSGHSYEVDIWSIGVMLYALLIGKPPFQAK-DVNTIYERIKQRNFAYPK 301

Query: 178 DKDWPEISTF 187
           DK   + + +
Sbjct: 302 DKKISQDAKY 311

>Kwal_26.7861
          Length = 955

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 98/189 (51%), Gaps = 17/189 (8%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           I E+  ++  +H N++  ID Y+ + +L +V+E++       +  + IL T+  I +   
Sbjct: 710 INEILVMKASKHANIVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTHCIL-TEGQIGAVSR 768

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
            TL+G+   H   ++HRD+K +N+LL+  G++KL DFG    +       T+ V T ++ 
Sbjct: 769 ETLKGLQFLHSKGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQINEINLKRTTMVGTPYWM 828

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRAL------GTP 176
           APE++   K Y   +D+WS+G++  E++    PYL         +   RAL      GTP
Sbjct: 829 APEVV-SRKEYGPKVDIWSLGIMIIEMIEGEPPYL--------NETPLRALYLIATNGTP 879

Query: 177 TDKDWPEIS 185
             KD   +S
Sbjct: 880 ELKDADSLS 888

>Kwal_33.13984
          Length = 649

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 88/161 (54%), Gaps = 7/161 (4%)

Query: 19  IELIDVYMAQSNLNLVLEFLPADLEMIIKDNSIL-FTQADIKSWLLMTLRGVHHCHRNFI 77
           + + + ++ +++L LV E L ++L  ++K N     + + I+++    L  +     + +
Sbjct: 342 LRMHETFVHKNHLCLVFELLSSNLYELLKQNQFHGLSISLIRTFARQLLDSLCVLKEHKL 401

Query: 78  LHRDLKPNNLLLAP--DGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYT 135
           +H DLKP N+LL      +LK+ DFG A         L + + +R+YRAPE++ G  + T
Sbjct: 402 IHCDLKPENILLVSLDRPELKVIDFGSA---CEETRTLYTYIQSRFYRAPEVILGIPYST 458

Query: 136 GAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
           G IDMWS+G I AEL L IP  PG  + +QI      LG P
Sbjct: 459 G-IDMWSLGCIIAELFLGIPIFPGSSEFNQITRIVDTLGLP 498

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 48/156 (30%), Positives = 88/156 (56%), Gaps = 5/156 (3%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPA-DLEMIIKDNSILFTQADIKSWL 62
           + E+  ++E +H N++  ID Y+A+ +L +V+E++    L  ++     L ++  I +  
Sbjct: 663 LNEILVMRESKHSNIVNFIDSYLAKGDLWIVMEYMEGGSLTDVV--THCLLSEGQIGAVC 720

Query: 63  LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWY 122
             TL+G+   H   +LHRD+K +N+LL+  G +KL DFG    +       T+ V T ++
Sbjct: 721 RETLKGLQFLHSKGVLHRDIKSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYW 780

Query: 123 RAPELLFGAKHYTGAIDMWSVGVIFAELML-RIPYL 157
            APE++   K Y   +D+WS+G++  E++    PYL
Sbjct: 781 MAPEVV-SRKEYGPKVDIWSLGIMIIEMIEGEPPYL 815

>Scas_616.10
          Length = 1461

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 52/161 (32%), Positives = 90/161 (55%), Gaps = 8/161 (4%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWL 62
           RE+  ++ I H NV+ L +V+  +S L LVLE++      + ++    +  ++ +   + 
Sbjct: 185 REIVIMKLISHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKL--SEKEAVHYF 242

Query: 63  LMTLRGVHHCHRNFILHRDLKPNNLLL-APDGQLKLADFGLARNMGSPQDMLTSNVVTRW 121
              ++GV +CH   I HRDLKP NLLL   +  +K+ADFG+A  +  P  +L ++  +  
Sbjct: 243 KQIIQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMAA-LELPNKLLQTSCGSPH 301

Query: 122 YRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDD 162
           Y +PE++ G  ++ G  D+WS G+I   L+    +LP  DD
Sbjct: 302 YASPEIVMGKSYHGGPSDVWSCGIILFALL--TGHLPFNDD 340

>Kwal_47.18098
          Length = 374

 Score = 83.6 bits (205), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 121/253 (47%), Gaps = 24/253 (9%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLM 64
           +EV  L    H N+I+L+DV     +    L F   D  +  +     F   DI+ ++  
Sbjct: 120 QEVYELAHDGHKNIIQLLDVVKDHVSKTPALVFEHVD-NIDFRTLYPTFQDLDIRYYMFE 178

Query: 65  TLRGVHHCHRNFILHRDLKPNNLLL-APDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
            L+ + +CH   I+HRD+KP+N+++     +L+L D+GLA     P       V +R+++
Sbjct: 179 LLKALDYCHSMGIMHRDVKPHNVMIDHKRKKLRLIDWGLAE-FYHPNMEYNVRVASRFFK 237

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRALGTPTDKDW- 181
            PELL   + Y  ++D+WS G + A ++  + P+  G  + DQ+    R LG+   +++ 
Sbjct: 238 GPELLVDYRMYDYSLDLWSFGTMLASMIFQKEPFFHGTSNTDQLVKIVRVLGSDDFENYL 297

Query: 182 --PEISTFGTYNKIQFYPPPSREEMRR---RFI-------AATENALNLMDGMLTMNPHK 229
              +I+    ++ I  Y       +RR   RF+       +  E  LNL+D +L  +  +
Sbjct: 298 RKYQITLPQEFHDIDQY-------IRRPWHRFVNDANSHLSGNEEILNLIDNLLRYDHQE 350

Query: 230 RWDPIQCLTSEYF 242
           R    + +   +F
Sbjct: 351 RLTAREAMQHPWF 363

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 84.3 bits (207), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 68/228 (29%), Positives = 116/228 (50%), Gaps = 32/228 (14%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFL-PADLEMIIKDNSILFTQADIKSWLL 63
           +E+  ++ + H NV+ L DV+   S+L LVLE+    +L  ++ +   L     ++++  
Sbjct: 78  QEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQ 137

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
           + + G+ +CH   ++HRDLKP NLLL     +K+ADFG+A  + S   +L ++  +  Y 
Sbjct: 138 III-GISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAA-LESEDKLLETSCGSPHYA 195

Query: 124 APELLFGAKHYTGAIDMWSVGVI-FAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
           APE++ G  +   + D+WS GVI FA L  R+P+       D+ D   R L     K   
Sbjct: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPF-------DEEDGNIRNLLLKVQKGEF 248

Query: 183 EISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
           E+              P  +E+       T+ A +L+  +LT++P KR
Sbjct: 249 EM--------------PDDDEI-------TKEAQDLLARLLTVDPSKR 275

>Scas_651.3
          Length = 793

 Score = 84.0 bits (206), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 101/195 (51%), Gaps = 36/195 (18%)

Query: 3   AIREVKYLQ--------EIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSI--- 51
           +I E K L+        E +H + + + D ++ +++L LV E L  +L  ++K N     
Sbjct: 421 SITEAKILELINNKIDPENKH-HFLRMYDSFIHKNHLCLVFELLSNNLYELLKQNQFHGL 479

Query: 52  ------LFTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLL-APDG-QLKLADFGLA 103
                 +FT+  ++S  ++    + HC        DLKP N+LL +PD   LK+ DFG  
Sbjct: 480 SIQLIRIFTKQMLESLCVLKDSKLIHC--------DLKPENILLCSPDKPALKIIDFG-- 529

Query: 104 RNMGSPQDMLT--SNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKD 161
               S ++  T  + + +R+YRAPE++ G   Y+ +IDMWS+G I AEL L IP  PG  
Sbjct: 530 ---SSCEETRTVYTYIQSRFYRAPEIILGIP-YSTSIDMWSLGCIVAELFLGIPIFPGSS 585

Query: 162 DIDQIDVTFRALGTP 176
           + +Q+      LG P
Sbjct: 586 EYNQLTRIVDTLGYP 600

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 83.6 bits (205), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 87/155 (56%), Gaps = 3/155 (1%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           + E+  ++  +H N++  ID Y+ + +L +V+E++       +  + IL T+  I +   
Sbjct: 741 VNEILVMKGSKHNNIVNFIDSYLFRGDLWVVMEYMEGGSLTDVVTHCIL-TEGQIGAVSR 799

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
            TL+G+   H   ++HRD+K +N+LL+ +G +KL DFG    +       T+ V T ++ 
Sbjct: 800 ETLKGLQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWM 859

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELML-RIPYL 157
           APE++   K Y   +D+WS+G++  E++    PYL
Sbjct: 860 APEVV-SRKEYGPKVDIWSLGIMIIEMIEGEPPYL 893

>YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activating
           kinase (serine/threonine protein kinase) responsible for
           in vivo activation of Cdc28p, also involved in spore
           wall formation [1107 bp, 368 aa]
          Length = 368

 Score = 82.8 bits (203), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 81/158 (51%), Gaps = 28/158 (17%)

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDG-----QLKLADFGLARNMGS------ 108
           S+    + G+   H N I+HRD+KP N++L  +      +L + DFG++ +M +      
Sbjct: 135 SFFRQMVEGIAFLHENKIIHRDIKPQNIMLTNNTSTVSPKLYIIDFGISYDMANNSQTSA 194

Query: 109 -PQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVI----FAELMLRIPYLP----- 158
            P D   +++ T  Y+APE+LFG K Y G +D+WS+ +I    F     R+ ++P     
Sbjct: 195 EPMDSKVTDISTGIYKAPEVLFGVKCYDGGVDVWSLLIIISQWFQRETSRMGHVPAMIDD 254

Query: 159 GKDDIDQIDVTFR-------ALGTPTDKDWPEISTFGT 189
           G DD++     FR        LG P+ + W E++  G+
Sbjct: 255 GSDDMNSDGSDFRLICSIFEKLGIPSIQKWEEVAQHGS 292

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 83.6 bits (205), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 51/161 (31%), Positives = 89/161 (55%), Gaps = 8/161 (4%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWL 62
           RE+  ++ I H NV+ L +V+  +S L LVLE++      + ++    +   + +   + 
Sbjct: 163 REIVIMKLISHTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKL--PEREAIHYF 220

Query: 63  LMTLRGVHHCHRNFILHRDLKPNNLLL-APDGQLKLADFGLARNMGSPQDMLTSNVVTRW 121
              + GV +CH   I HRDLKP NLLL   + ++K+ADFG+A  +  P  +L ++  +  
Sbjct: 221 KQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAA-LELPNKLLKTSCGSPH 279

Query: 122 YRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDD 162
           Y +PE++ G  ++ G  D+WS G++   L+    +LP  DD
Sbjct: 280 YASPEIVMGRPYHGGPSDVWSCGIVLFALL--TGHLPFNDD 318

>Scas_707.7
          Length = 376

 Score = 82.4 bits (202), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 102/221 (46%), Gaps = 49/221 (22%)

Query: 68  GVHHCHRNFILHRDLKPNNLLLA--PDGQLKL--ADFGLARNMGSPQDML-------TSN 116
           G++  H   I+HRD+KP N++L    DG + L   DFG++ +  +P D L        ++
Sbjct: 151 GINSIHEQKIIHRDIKPQNVMLEIHDDGSISLLITDFGISYDHEAPADKLREPPLQKITD 210

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLR-------IP--------YLPGKD 161
           V T +Y++PELLFG K+Y   +D+W++ V+ ++   +       +P         L    
Sbjct: 211 VSTSFYKSPELLFGIKNYEFEVDIWALLVLLSQFFQKETNIENFVPSMFDDGSGVLDSGS 270

Query: 162 DIDQIDVTFRALGTPTDKDWPEISTFGTYNKI----------QFYPPPSREEMRRRFIA- 210
           DI  I   F  +GTP  KDWP++  +G+ +            ++    S E  +RR +  
Sbjct: 271 DIRLIFSIFEMVGTPGVKDWPKVIEYGSKDAFVGMFGEKGDGRYILHESFENQKRRVLND 330

Query: 211 --------ATENALN-LMDGMLTMNP---HKRWDPIQCLTS 239
                     E   N L+D +L M P    +RW   Q L S
Sbjct: 331 WMPRLYELNNETQKNTLIDCILGMVPFASEQRWSSKQLLES 371

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 83.2 bits (204), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 92/164 (56%), Gaps = 13/164 (7%)

Query: 19  IELIDVYMAQSNLNLVLEFLPADLEMIIKDNSI--LFTQADIKSWLLMTLRGVHHCHRNF 76
           + + D ++ +++L LV E L  +L  ++K N    L  Q  I+++ +  L  +     + 
Sbjct: 425 LRMHDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQL-IRTFTIQILDSLCVLKDSK 483

Query: 77  ILHRDLKPNNLLL-APDG-QLKLADFGLARNMGSPQDMLT--SNVVTRWYRAPELLFGAK 132
           ++H DLKP N+LL +PD   LK+ DFG      S ++  T  + + +R+YRAPE++ G  
Sbjct: 484 LIHCDLKPENILLCSPDKPDLKVIDFG-----SSCEETRTVYTYIQSRFYRAPEIILGIP 538

Query: 133 HYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
            Y+ +IDMWS+G I AEL L IP  PG  + +Q+      LG P
Sbjct: 539 -YSTSIDMWSLGCIVAELFLGIPIFPGSSEFNQLTRIITTLGYP 581

 Score = 31.2 bits (69), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 5/63 (7%)

Query: 184 ISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYFV 243
           I  +  +  IQ  P    +EM+ R     E  ++ + G+L +NP +RW P Q     +  
Sbjct: 668 IRNYRIHKNIQKSPELIEQEMKNR-----ECLIHFLKGILNLNPLERWTPQQAAMHPFIT 722

Query: 244 ELP 246
           + P
Sbjct: 723 QQP 725

>KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1
           Kluyveromyces lactis cyclin-dependent kinase activating
           kinase 1, start by similarity
          Length = 321

 Score = 81.6 bits (200), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 74/139 (53%), Gaps = 14/139 (10%)

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAP 125
           + G+ + H N I+HRD+KP N++L    ++ L DFG++ N     +  T +  T  Y+AP
Sbjct: 122 IEGLVYIHGNGIIHRDVKPQNIMLNSYNEVVLGDFGISYNRNLDNEAKTCDCSTSIYKAP 181

Query: 126 ELLFGAKHYTGAIDMWSVGVIFAEL-------------MLRIPYLPGKDDIDQIDVTFRA 172
           ELLF   +Y   ID+W++ V+ ++L             ++ I +     DI  +   F  
Sbjct: 182 ELLFSVSNYKFEIDIWALAVLISQLWNDKTQSKSKSSKVIDIDF-DECSDIKLVLTLFDK 240

Query: 173 LGTPTDKDWPEISTFGTYN 191
            G P+++DWP+++   ++N
Sbjct: 241 FGKPSNEDWPQVTKNESFN 259

>Kwal_14.1249
          Length = 344

 Score = 81.6 bits (200), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 110/233 (47%), Gaps = 44/233 (18%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADL-EMIIK-------DNSIL 52
           M  +  ++ LQ  R  ++IEL+   +A+  + L   F   ++ + ++K       +  +L
Sbjct: 40  MCELAILRKLQVGRSAHIIELVSFEVARGVVTLQFPFYKQNMYQYVLKYYQKRRWNPYLL 99

Query: 53  FTQADIKSWLLMTLR-------------GVHHCHRNFILHRDLKPNNLLLAPDG-----Q 94
             Q D  S L+  L+              + + H + I+HRD+K  N+++  DG     Q
Sbjct: 100 TEQGDSGSKLVNNLKIDYALDFFRQLADALSNLHEHKIIHRDVKLQNVMVDEDGPHDIPQ 159

Query: 95  LKLADFGLARNMGSPQ---DMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELM 151
           L L DFG+A +  + Q   D   ++V T  Y+APELLF  K+Y+ A D+WS+ V+ ++L 
Sbjct: 160 LVLIDFGIAYDPETSQEAADSKITDVSTSIYKAPELLFSVKNYSSAADIWSLMVLVSQLF 219

Query: 152 LR-------IP--------YLPGKDDIDQIDVTFRALGTPTDKDWPEISTFGT 189
                    IP         L    DI  +   F  LG P+ ++WPE+   G+
Sbjct: 220 QTESSSDRFIPAFVSDGSEVLEQGSDIRLVSSIFEKLGIPSLQEWPEVRDHGS 272

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 89/161 (55%), Gaps = 8/161 (4%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWL 62
           RE+  ++ I H N++ L +V+  +S L LVLE++      + +I    +   +A    + 
Sbjct: 113 REIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEA--IHYF 170

Query: 63  LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-LKLADFGLARNMGSPQDMLTSNVVTRW 121
              ++GV +CH   I HRDLKP NLLL    + +K+ADFG+A  + +   +L ++  +  
Sbjct: 171 KQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAA-LETTNRLLETSCGSPH 229

Query: 122 YRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDD 162
           Y +PE++ G K++    D+WS G+I   L+    +LP  DD
Sbjct: 230 YASPEIVMGQKYHGSPSDVWSCGIILFALL--TGHLPFNDD 268

>Scas_668.22
          Length = 893

 Score = 81.6 bits (200), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 48/155 (30%), Positives = 84/155 (54%), Gaps = 3/155 (1%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           I E+  ++  RH N++  ID Y+   +L +++E++       +  + IL T+  I +   
Sbjct: 654 INEILVMKGSRHPNIVNFIDSYLLDGDLWVIMEYMEGGSLTDVVTHCIL-TEGQIGAVCR 712

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
            TL G+   H   +LHRD+K +N+LL+  G +KL DFG    +       T+ V T ++ 
Sbjct: 713 ETLSGLQFLHSKGVLHRDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWM 772

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELML-RIPYL 157
           APE++   K Y   +D+WS+G++  E++    PYL
Sbjct: 773 APEVV-SRKEYGPKVDIWSLGIMIIEMIEGEPPYL 806

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 81.6 bits (200), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 88/154 (57%), Gaps = 4/154 (2%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFL-PADLEMIIKDNSILFTQADIKSWLL 63
           RE+  ++ + H NV+ L DV+    +L +VLE++   +L  ++ +   L     ++ +  
Sbjct: 75  REIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVR-FFR 133

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             + G+ +CH   I+HRDLKP NLLL     +KLADFG+A  + S   +L ++  +  Y 
Sbjct: 134 QIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAA-LESKDKLLETSCGSPHYA 192

Query: 124 APELLFGAKHYTGAIDMWSVGVI-FAELMLRIPY 156
           APE++ G  ++    D+WS GVI +A L  R+P+
Sbjct: 193 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 226

>Scas_648.17
          Length = 340

 Score = 80.1 bits (196), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 89/174 (51%), Gaps = 5/174 (2%)

Query: 5   REVKYLQEIRHV-NVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           RE+K L  +    NVIEL+D+     +    L F      M  +     FT  DI+ +  
Sbjct: 91  RELKILTNLTGGPNVIELLDIVQDPGSKIPALIFEEVK-NMDFRQLYPTFTLPDIQFYFT 149

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAP-DGQLKLADFGLARNMGSPQDMLTSNVVTRWY 122
             L  +++CH   I+HRD+KP N+++ P + +L+L D+GLA     P       V +R++
Sbjct: 150 QLLIALNYCHSMGIMHRDVKPQNVMIDPKERKLRLIDWGLA-EFYHPGVDYNVRVASRYH 208

Query: 123 RAPELLFGAKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRALGT 175
           + PELL     Y  ++D+WSVG + A ++  R P+  G  + DQ+      LGT
Sbjct: 209 KGPELLVNLNQYDYSLDLWSVGCMLAAIVFKREPFFKGSSNPDQLVRIAAVLGT 262

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 81.3 bits (199), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 87/155 (56%), Gaps = 6/155 (3%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWL 62
           RE+  ++ + H NV+ L DV+    +L +VLE++       ++++   +   +A    + 
Sbjct: 77  REIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEA--VRFF 134

Query: 63  LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWY 122
              + G+ +CH   I+HRDLKP NLLL     +KLADFG+A  + S   +L ++  +  Y
Sbjct: 135 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCGSPHY 193

Query: 123 RAPELLFGAKHYTGAIDMWSVGVI-FAELMLRIPY 156
            APE++ G  ++    D+WS GVI +A L  R+P+
Sbjct: 194 AAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 228

>Kwal_55.21709
          Length = 340

 Score = 79.7 bits (195), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 70/125 (56%), Gaps = 3/125 (2%)

Query: 53  FTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAP-DGQLKLADFGLARNMGSPQD 111
           FT  DI+ +    L  + +CH   I+HRD+KP N+++ P + +L+L D+GLA     P  
Sbjct: 139 FTLPDIQYYFSQLLIALDYCHSMGIMHRDVKPQNVMIDPVERKLRLIDWGLA-EFYHPGV 197

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRI-PYLPGKDDIDQIDVTF 170
                V +R+++ PELL     Y  ++D+WSVG + A ++ +  P+  G  + DQ+    
Sbjct: 198 DYNVRVASRYHKGPELLVNLNQYDYSLDLWSVGCMLAAIVFKKEPFFKGSTNPDQLVKIA 257

Query: 171 RALGT 175
           R LGT
Sbjct: 258 RVLGT 262

>KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces
           cerevisiae YIL035c CKA1 casein kinase II, catalytic
           alpha chain, start by similarity
          Length = 373

 Score = 79.3 bits (194), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 72/125 (57%), Gaps = 3/125 (2%)

Query: 53  FTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLL-APDGQLKLADFGLARNMGSPQD 111
           F+  DI+ ++   L+ + +CH   I+HRD+KP+N+++     +L+L D+GLA     P  
Sbjct: 167 FSDLDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQHKLRLIDWGLAE-FYHPSM 225

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELM-LRIPYLPGKDDIDQIDVTF 170
                V +R+++ PELL   + Y  ++D+WS G + A ++ L+ P+  G  + DQ+    
Sbjct: 226 EYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGAMLASMVFLKEPFFYGSSNTDQLVKIV 285

Query: 171 RALGT 175
           R LG+
Sbjct: 286 RVLGS 290

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 80.1 bits (196), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 47/155 (30%), Positives = 86/155 (55%), Gaps = 3/155 (1%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           I E+  ++  +H N++  ID Y+ + +L +++E++       +  + IL T+  I +   
Sbjct: 663 INEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCIL-TEGQIGAVCR 721

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
            TL G+   H   +LHRD+K +N+LL+ +G +KL DFG    +       T+ V T ++ 
Sbjct: 722 ETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWM 781

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELML-RIPYL 157
           APE++   K Y   +D+WS+G++  E++    PYL
Sbjct: 782 APEVV-SRKEYGPKVDIWSLGIMIIEMIEGEPPYL 815

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 78.6 bits (192), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 70/125 (56%), Gaps = 3/125 (2%)

Query: 53  FTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAP-DGQLKLADFGLARNMGSPQD 111
           FT +D + +    L  + +CH   I+HRD+KP N+++ P + +L+L D+GLA     P  
Sbjct: 139 FTLSDTQHYFKQLLIALDYCHSMGIMHRDVKPQNVMIDPTERKLRLIDWGLAE-FYHPGV 197

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRI-PYLPGKDDIDQIDVTF 170
                V +R+++ PELL     Y  ++D+WSVG + A ++ +  P+  G  + DQ+    
Sbjct: 198 DYNVRVASRYHKGPELLVNLNQYDYSLDLWSVGCMLAAIVFKKEPFFKGSTNPDQLVKIA 257

Query: 171 RALGT 175
           R LGT
Sbjct: 258 RVLGT 262

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 78.6 bits (192), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 91/177 (51%), Gaps = 11/177 (6%)

Query: 5   REVKYLQEIRHV-NVIELIDVYMAQSNL--NLVLEFLP-ADLEMIIKDNSILFTQADIKS 60
           RE+K L  +    NVI L+D+   Q++    L+ E +  AD   +       FT  D++ 
Sbjct: 91  RELKILTNLTGGPNVIGLLDIVQDQASKIPALIFEEVKNADFRTLYPS----FTLQDLQY 146

Query: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAP-DGQLKLADFGLARNMGSPQDMLTSNVVT 119
           +    L  + +CH   I+HRD+KP N+++ P   +L+L D+GLA     P       V +
Sbjct: 147 YFTQLLIALDYCHSMGIMHRDVKPQNVMIDPAQKKLRLIDWGLA-EFYHPGVDYNVRVAS 205

Query: 120 RWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRI-PYLPGKDDIDQIDVTFRALGT 175
           R+++ PELL     Y  ++D+WSVG + A ++ +  P+  G  + DQ+      LGT
Sbjct: 206 RYHKGPELLVNLNQYDYSLDLWSVGCMLAAIIFKKEPFFKGSSNADQLVKIADVLGT 262

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 90/179 (50%), Gaps = 13/179 (7%)

Query: 10  LQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGV 69
           L +  H  +I+L   +  Q NL  V++  P    + +     +F++A  + ++   +  V
Sbjct: 65  LGQANHPGIIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTV 124

Query: 70  HHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLA-----RNMGSPQDM-LTSNVVTRWYR 123
            + H   ++HRDLKP N+LL  +G+L +ADFG A      + GS  D   TS V T  Y 
Sbjct: 125 EYIHSMGVIHRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTAEYV 184

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDID------QIDVTFRALGTP 176
           +PELL   K Y  + D+W++G +  + +   P   G+++++       +D T+R    P
Sbjct: 185 SPELLLENKSYYSS-DVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANP 242

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 89/161 (55%), Gaps = 8/161 (4%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWL 62
           RE+  ++ I H NV+ L +V+  +S L LVLE++      + ++    +  ++A    + 
Sbjct: 123 REIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEA--IHYF 180

Query: 63  LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-LKLADFGLARNMGSPQDMLTSNVVTRW 121
              ++ V +CH   I HRDLKP NLLL    + +K+ADFG+A  + +   +L ++  +  
Sbjct: 181 KQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAA-LETSDKLLETSCGSPH 239

Query: 122 YRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDD 162
           Y +PE++ G K++    D+WS G+I   L+    +LP  DD
Sbjct: 240 YASPEIVLGRKYHGSPSDVWSCGIILFALL--TGHLPFNDD 278

>Kwal_56.22476
          Length = 697

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 84/160 (52%), Gaps = 3/160 (1%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           + E++  + +RH N+++ +D +   +N+ ++LE  P    M +     + T+ +++ +  
Sbjct: 124 LSEIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTT 183

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             +  V + H   ++HRDLK  N+       LK+ DFGLA  + + ++   +   T  Y 
Sbjct: 184 QIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYI 243

Query: 124 APELLFGAKH--YTGAIDMWSVGVIFAELMLRIPYLPGKD 161
           APE+L G KH  ++  +D+WS GV+   L++  P    K+
Sbjct: 244 APEVLTG-KHTGHSYEVDIWSCGVMIYALLIGKPPFQAKE 282

>AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH]
           (707306..708355) [1050 bp, 349 aa]
          Length = 349

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 100/231 (43%), Gaps = 48/231 (20%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKD--------------NSI 51
           E++ LQ  +H N+I ++   +    + + + ++  DL   ++               +S 
Sbjct: 44  ELRILQACQHSNIIPVLSATVEGGIVKICMPYVKTDLYAFMRQHYGGKHLAYLMPCLDSE 103

Query: 52  LFTQADIKSWLLMTLRGVHHC----------HRNFILHRDLKPNNLLLAPDGQLKLADFG 101
              +   K+ L M  R +H C          H   ++HRD+KP N+L+  +  + + DFG
Sbjct: 104 ARGRRAQKNRLSMA-RTMHVCSQLADALAYLHGLGVIHRDIKPQNVLVDSNDHVYVIDFG 162

Query: 102 LA--------RNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLR 153
           +         R  G   D    +V T  Y+APEL+F  ++Y   +D+WS+ V F++L  R
Sbjct: 163 VCYDTAQRGPRRYGETDDSKIPDVSTSIYKAPELMFSVRNYGLPVDVWSLAVTFSQLFQR 222

Query: 154 IPYLPG---------------KDDIDQIDVTFRALGTPTDKDWPEISTFGT 189
                G                 DI  +   F+ LG P+ + WP++  +G+
Sbjct: 223 YETPQGGIAAFVDDGAEELETGTDIRAVMSIFQQLGIPSQEQWPQVVRYGS 273

>Scas_673.20*
          Length = 758

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 85/155 (54%), Gaps = 7/155 (4%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFT--QADIKSWLL 63
           E+  L+E +H N+I  I+ Y+    L +V+E++       + D    FT  +  + +   
Sbjct: 526 EMLVLKEYQHPNIINFINSYLLHDTLWIVMEYMDGGS---LADIVSFFTPTEEQMATICR 582

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
            TL G++  H   I+HRD+K +N+LL+ +G +K+ DFG    +       T+ V T ++ 
Sbjct: 583 ETLFGLNFLHSRGIVHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWM 642

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELML-RIPYL 157
           APE++  +K Y   +D+WS+G++  E++    PYL
Sbjct: 643 APEVI-ASKEYGPKVDVWSLGIMIIEMIEGEPPYL 676

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 77.8 bits (190), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 70/125 (56%), Gaps = 3/125 (2%)

Query: 53  FTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAP-DGQLKLADFGLARNMGSPQD 111
           FT +D + +    L  + +CH   I+HRD+KP N+++ P + +L+L D+GLA     P  
Sbjct: 140 FTLSDTQFYFTQLLTALDYCHSMGIMHRDVKPQNVMIDPNERKLRLIDWGLAE-FYHPGV 198

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRI-PYLPGKDDIDQIDVTF 170
                V +R+++ PELL     Y  ++D+W+VG + A ++ +  P+  G  + DQ+    
Sbjct: 199 DYNIRVASRYHKGPELLVSLNQYDYSLDLWAVGCMIAAIVFKKEPFFKGSTNADQLVKIA 258

Query: 171 RALGT 175
           + LGT
Sbjct: 259 KVLGT 263

>Scas_698.37
          Length = 347

 Score = 77.8 bits (190), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 118/242 (48%), Gaps = 27/242 (11%)

Query: 17  NVIELIDVYMAQSNLNLVLEFLPADLEMI-IKDNSILFTQADIKSWLLMTLRGVHHCHRN 75
           N++EL+DV         V  F+  D++ +  ++    F  +D++ +    L  +++ H  
Sbjct: 112 NIVELLDV--VHDEKTRVPAFIFEDVKNVDFRELYPTFKLSDVQYYFKQLLIALNYAHSM 169

Query: 76  FILHRDLKPNNLLLAP-DGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHY 134
            I+HRD+KP N+++ P   +L+L D+GLA     P       V +R+++ PELL     Y
Sbjct: 170 GIMHRDVKPQNVMIDPVQRKLRLIDWGLA-EFYHPGVDYNVRVASRYHKGPELLTDLNQY 228

Query: 135 TGAIDMWSVGVIFAELMLRI-PYLPGKDDIDQIDVTFRALGTPTDKDWPEISTFGTYNKI 193
             ++DMWSVG + A ++ +  P+  G  + DQ+    + LGT    ++  ++ +G     
Sbjct: 229 DYSLDMWSVGCMIAAIIFKKEPFFKGGSNPDQLVKIAKVLGTKQLINY--LARYG----- 281

Query: 194 QFYPPPSREEMRR--------RFIA-----ATENALNLMDGMLTMNPHKRWDPIQCLTSE 240
             + P   + + R         FI+     AT  A++L+D +L  +  +R    + +  +
Sbjct: 282 -LHLPSEHDNLIRTWARKPWSHFISIETPLATPEAVDLVDNLLRYDHQERLTAEEAMNHQ 340

Query: 241 YF 242
           +F
Sbjct: 341 FF 342

>Scas_704.50
          Length = 369

 Score = 77.8 bits (190), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 88/166 (53%), Gaps = 10/166 (6%)

Query: 15  HVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILF---TQADIKSWLLMTLRGVHH 71
           H N+I+L D+     +    L F   D      D  +L+   T  DI+ ++   L+ + +
Sbjct: 130 HKNIIQLFDIIKDPISKTPALVFEHVD----NIDFRVLYPKLTDMDIRYYMFELLKALDY 185

Query: 72  CHRNFILHRDLKPNNLLL-APDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFG 130
           CH   I+HRD+KP+N+++   + +L+L D+GLA    +  +     V +R+++ PELL  
Sbjct: 186 CHSMGIMHRDVKPHNVMIDHKNKKLRLIDWGLAEFYHANME-YNVRVASRFFKGPELLVD 244

Query: 131 AKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRALGT 175
            + Y  ++D+WS G + A ++  + P+  G  + DQ+    R LG+
Sbjct: 245 YRMYDYSLDLWSFGTMLASMVFQKEPFFHGTSNTDQLVKIVRVLGS 290

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 91/180 (50%), Gaps = 6/180 (3%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           + E++  + + H N+++ ID +   SN+ ++LE  P    M +     + T+ +++ +  
Sbjct: 127 LSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTT 186

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
                + + H   ++HRDLK  N+    +  LK+ DFGLA  + +  +   +   T  Y 
Sbjct: 187 QICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYI 246

Query: 124 APELLFGAKH--YTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQI--DVTFRALGTPTDK 179
           APE+L G KH  ++  +D+WS+GV+   L++  P    + D++ I   +  R    P DK
Sbjct: 247 APEVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQAR-DVNTIYERIKCRDFSFPRDK 304

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 45/155 (29%), Positives = 84/155 (54%), Gaps = 3/155 (1%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           + E+  +   +H N++  ID Y++  +L +V+E++       +    +L T+  I +   
Sbjct: 610 VNEIMVMSSSKHQNIVNYIDSYLSGLDLWVVMEYMEGGCLTDVVTYCVL-TEGQIGAVCR 668

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             L+G+   H   +LHRD+K +N+LL+ +G +KL DFG    +       T+ V T ++ 
Sbjct: 669 EVLQGLEFLHSKGVLHRDIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWM 728

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELML-RIPYL 157
           APE++   K Y   +D+WS+G++  E++    PYL
Sbjct: 729 APEIV-SRKEYGPKVDIWSLGIMIIEMIEGEPPYL 762

>Scas_644.15
          Length = 726

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 90/178 (50%), Gaps = 6/178 (3%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMT 65
           E++  + ++H N++  +D +   +N+ ++LE       M +       T+ +++ +    
Sbjct: 139 EIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQI 198

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAP 125
              V + H   ++HRDLK  N+    D  LK+ DFGLA  + + ++   +   T  Y AP
Sbjct: 199 CGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAP 258

Query: 126 ELLFGAKH--YTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRAL--GTPTDK 179
           E+L G KH  ++  +D+WS+GV+   L++  P    K D++ I    +A   G P DK
Sbjct: 259 EVLMG-KHAGHSFEVDIWSIGVMIYALLVGKPPFQAK-DVNVIYDRIKACQYGYPKDK 314

>YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II
           (Protein kinase CK2), catalytic (alpha-prime) subunit
           [1020 bp, 339 aa]
          Length = 339

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 92/205 (44%), Gaps = 24/205 (11%)

Query: 53  FTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAP-DGQLKLADFGLARNMGSPQD 111
           F   DI+ +    L  + +CH   I+HRD+KP N+++ P + +L+L D+GLA     P  
Sbjct: 139 FKLPDIQYYFTQLLIALDYCHSMGIMHRDVKPQNVMIDPTERKLRLIDWGLAE-FYHPGV 197

Query: 112 MLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRI-PYLPGKDDIDQIDVTF 170
                V +R+++ PELL     Y  ++D+WSVG + A ++ +  P+  G  + DQ+    
Sbjct: 198 DYNVRVASRYHKGPELLVNLNQYDYSLDLWSVGCMLAAIVFKKEPFFKGSSNPDQLVKIA 257

Query: 171 RALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIA-------------ATENALN 217
             LGT            G   K   + P   + + R F               A    ++
Sbjct: 258 TVLGTK--------ELLGYLGKYGLHLPSEYDNIMRDFTKKSWTHFITSETKLAVPEVVD 309

Query: 218 LMDGMLTMNPHKRWDPIQCLTSEYF 242
           L+D +L  +  +R    + +  ++F
Sbjct: 310 LIDNLLRYDHQERLTAKEAMDHKFF 334

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 80/151 (52%), Gaps = 3/151 (1%)

Query: 15  HVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHCHR 74
           H  +I+L   +    NL  VL+F P    + +      F +A  K ++   +  + + H 
Sbjct: 70  HPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALEYIHG 129

Query: 75  NFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSN--VVTRWYRAPELLFGAK 132
             ++HRDLKP NLLL+ +G+L + DFG+A N+ +  ++ +++  V T  Y +PELL   K
Sbjct: 130 CKVVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFVGTAEYVSPELLLQNK 189

Query: 133 HYTGAIDMWSVGVIFAELMLRIPYLPGKDDI 163
               + D+W+VG +  +     P   G++++
Sbjct: 190 SNFCS-DIWAVGCMLYQFTQGTPPFRGENEL 219

>Kwal_26.8941
          Length = 661

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 92/189 (48%), Gaps = 14/189 (7%)

Query: 13  IRHVNVIELIDVY--MAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVH 70
           + H NVIE +D++    Q+    V+E+ P D   ++   ++  ++ +I   L     GV 
Sbjct: 188 LHHPNVIETLDIFSDAKQNKYYEVMEYCPIDFFAVVMSGNM--SRGEINCCLRQLSEGVR 245

Query: 71  HCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQD----MLTSNVVTRWYRAPE 126
           + H   + HRDLK +N ++  DG LKL DFG A     P D    M    V +  Y APE
Sbjct: 246 YLHNMGLAHRDLKLDNCVMTCDGILKLIDFGSAVVFKYPFDSSVTMAHGIVGSDPYLAPE 305

Query: 127 LLFGAKHYTGA-IDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRALGTPTDKDWPEI 184
           ++   K Y    +D+WS+G+I+  +ML R P+   K+  D     FR    P D +   +
Sbjct: 306 VMTSTKRYDPQFVDIWSIGIIYCCMMLKRFPWKTPKESDDN----FRLFCLPDDVEHDYV 361

Query: 185 STFGTYNKI 193
            +   + K+
Sbjct: 362 KSAREHEKL 370

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 77.4 bits (189), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 74/160 (46%), Gaps = 6/160 (3%)

Query: 15  HVNVIELIDVYMAQSNLNLVLEFLP-ADLEMIIKDNSILFT-QADIKSWLLMTLRGVHHC 72
           H N+ +L+D Y        VLE+    DL   IK      T + +  S+L      + +C
Sbjct: 68  HRNICQLLDFYEDADTYVFVLEYCAYGDLYDFIKAIRERPTMRINFHSFLFQLCSAISYC 127

Query: 73  HRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFGAK 132
           H   + HRD+KP N+L+   GQ+KL DFGL++     +D     + T  Y APE      
Sbjct: 128 HSKDVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKDYC---IGTEKYLAPETFLREY 184

Query: 133 HYTGAIDMWSVGV-IFAELMLRIPYLPGKDDIDQIDVTFR 171
           H T A D WS+G+ IF  +    P+     D  +    F+
Sbjct: 185 HNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQ 224

>CAGL0L07810g complement(857656..859446) similar to sp|P25333
           Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, start by
           similarity
          Length = 596

 Score = 77.4 bits (189), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 110/244 (45%), Gaps = 37/244 (15%)

Query: 13  IRHVNVIELIDVYM-AQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLLMTLRGV 69
           + H N+++ +D++  A  +   V+E+        +II    + + +AD   +    LRGV
Sbjct: 355 LHHTNIVDTLDLFQDANGDYCEVMEYCAGGDLFTLIIAAGKLEYMEADC--FFKQLLRGV 412

Query: 70  HHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR--NMGSPQDMLTSNVV--TRWYRAP 125
            + H   + HRDLKP NL+L  DG LK+ DFG +    M   +D+  S  V  +  Y AP
Sbjct: 413 VYMHDMGVCHRDLKPENLILTHDGVLKITDFGNSECFKMAWEEDIHLSGGVCGSSPYIAP 472

Query: 126 ELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEIS 185
           E     +     +D+W+ GVI+  + +R               T R L T   KD P  +
Sbjct: 473 EEYVLEEFDPRPVDIWACGVIY--MAMR---------------TGRQLWTAAKKDDPFYN 515

Query: 186 TF--GTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYFV 243
            +  G   K  + P  S +  R R         N++  ML   PH+R +  Q L SE+  
Sbjct: 516 KYLQGRRQKSGYEPIESLKRARCR---------NVIYSMLDPAPHRRINGKQILNSEWGR 566

Query: 244 ELPV 247
           E+ V
Sbjct: 567 EIKV 570

>YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kinase
           II (protein kinase CK2), catalytic (alpha) subunit [1119
           bp, 372 aa]
          Length = 372

 Score = 76.6 bits (187), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 87/168 (51%), Gaps = 14/168 (8%)

Query: 15  HVNVIELIDVYM--AQSNLNLVLEFLPADLEMIIKDNSILF---TQADIKSWLLMTLRGV 69
           H N+I L D+          LV E++         D  IL+   T  +I+ ++   L+ +
Sbjct: 130 HANIIHLFDIIKDPISKTPALVFEYVDN------VDFRILYPKLTDLEIRFYMFELLKAL 183

Query: 70  HHCHRNFILHRDLKPNNLLL-APDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELL 128
            +CH   I+HRD+KP+N+++   + +L+L D+GLA       +     V +R+++ PELL
Sbjct: 184 DYCHSMGIMHRDVKPHNVMIDHKNKKLRLIDWGLAEFYHVNME-YNVRVASRFFKGPELL 242

Query: 129 FGAKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRALGT 175
              + Y  ++D+WS G + A ++  R P+  G  + DQ+    + LGT
Sbjct: 243 VDYRMYDYSLDLWSFGTMLASMIFKREPFFHGTSNTDQLVKIVKVLGT 290

>Scas_477.5
          Length = 703

 Score = 77.4 bits (189), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 89/179 (49%), Gaps = 7/179 (3%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMT 65
           E+  L+E+ H N++          NLN+ LE++P      + +N   F ++ I +++   
Sbjct: 491 EMNLLKELHHENIVTYYGSSQEGPNLNIFLEYVPGGSVSSMLNNYGPFEESLIVNFIRQV 550

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMG--SPQDMLTSNVVTRWYR 123
           L GV + H   I+HRD+K  N+L+   G +K+ DFG+++ +   S QD   S   + ++ 
Sbjct: 551 LIGVAYLHNKNIIHRDIKGANILIDTKGCVKITDFGISKKLSPLSKQDKRASLQGSVYWM 610

Query: 124 APELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
           APE++      T   D+WS G +  E+       P   D  Q+   F+ +GT T  + P
Sbjct: 611 APEVV-KQTATTEKADIWSTGCVVIEMFTGKHPFP---DFSQMQTIFK-IGTNTTPEVP 664

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 77.0 bits (188), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 79/156 (50%), Gaps = 7/156 (4%)

Query: 13  IRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHC 72
           +RH N+IE +D+        +V+E+ P D   ++  N +  T+ ++  +     RGV + 
Sbjct: 320 LRHQNIIETLDMLQEGELFLVVMEYCPYDFFNLVMSNQM--TKHEVWCYFKQICRGVDYL 377

Query: 73  HRNFILHRDLKPNNLLLAPDGQLKLADFGLA----RNMGSPQDMLTSNVVTRWYRAPELL 128
           H   + HRDLK +N ++  DG LKL DFG A     N  S  +     V +  Y APELL
Sbjct: 378 HSQGLAHRDLKLDNCVVTADGILKLIDFGSAIIFRYNFNSKLEPAKGIVGSDPYLAPELL 437

Query: 129 FGAKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDI 163
               +   A D+WS+ V+F  + L R P+    +D+
Sbjct: 438 TQLYYDPSAADVWSIAVMFYCMSLRRFPWKKPSEDV 473

>ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)
           [2016 bp, 671 aa]
          Length = 671

 Score = 76.6 bits (187), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 77/148 (52%), Gaps = 9/148 (6%)

Query: 13  IRHVNVIELIDVYM--AQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVH 70
           + H NVIE +DV+    Q+    V+E+ P D   ++    +  ++ +I       + GV+
Sbjct: 174 LHHPNVIETLDVFSNSKQNQYYEVMEYCPVDFFAVVMSGQM--SRGEINCCFKQLVEGVN 231

Query: 71  HCHRNFILHRDLKPNNLLLAPDGQLKLADFGLA----RNMGSPQDMLTSNVVTRWYRAPE 126
           + H     HRDLK +N ++  DG LKL DFG A        + + M    V +  Y APE
Sbjct: 232 YLHSKGYAHRDLKLDNCVMTRDGILKLIDFGSAFVFKYTYEADEKMAHGVVGSDPYLAPE 291

Query: 127 LLFGAKHYTGA-IDMWSVGVIFAELMLR 153
           +L   K Y+   +D+WS+G+I+  ++L+
Sbjct: 292 VLTSTKSYSAPLVDIWSIGIIYCCMILK 319

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 76.6 bits (187), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 84/160 (52%), Gaps = 3/160 (1%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           + E++  + ++H N+++  D +   +N+ ++LE  P    M +       T+ +++  ++
Sbjct: 135 LSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMI 194

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             +  + + H   ++HRDLK  N+    +  LK+ DFGLA  + + ++   +   T  Y 
Sbjct: 195 QIIGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYI 254

Query: 124 APELLFGAKH--YTGAIDMWSVGVIFAELMLRIPYLPGKD 161
           APE+L G KH  ++  +D+WS+GV+   L+   P    K+
Sbjct: 255 APEVLTG-KHTGHSYEVDIWSIGVMLYALLFGKPPFQAKE 293

>Scas_692.24
          Length = 718

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 86/174 (49%), Gaps = 14/174 (8%)

Query: 13  IRHVNVIELIDVYM--AQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVH 70
           + H NVIE +D++    Q+    V+++ P D   ++    +  ++ +I   L   L GV 
Sbjct: 271 LHHPNVIETVDIFSDSKQNKYFEVMQYCPVDFFAVVMTGKM--SRGEINCCLKQLLEGVK 328

Query: 71  HCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQD----MLTSNVVTRWYRAPE 126
           + H   + HRDLK +N ++  DG LKL DFG A     P +    M    V +  Y APE
Sbjct: 329 YLHSMGLAHRDLKLDNCVMNEDGILKLIDFGSAVVFRYPYEDDIAMAHGIVGSDPYLAPE 388

Query: 127 LLFGAKHYT-GAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRALGTPTD 178
           ++   K Y    +D+WSVG+I+  +ML R P+   ++  D     FR    P D
Sbjct: 389 VITSTKSYDPQCVDIWSVGIIYCCMMLKRFPWKAPRESDD----NFRLYSMPDD 438

>Scas_201.1*
          Length = 274

 Score = 74.7 bits (182), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 77/151 (50%), Gaps = 8/151 (5%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLL 63
           E+  LQ + H N++   D + ++    +V +        + IIK     FT+ D  + ++
Sbjct: 84  ELSILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGK--FTEVDAVNIMV 141

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLL---APDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
             L  V + H   I+HRDLKP N+L    + + QL +ADFG+A+ + S  D++     + 
Sbjct: 142 QLLDAVKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSL 201

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELM 151
            Y APE+L    H     D+WS+GVI   L+
Sbjct: 202 GYVAPEVLTKEGH-GKPCDIWSLGVITYTLL 231

>Scas_711.25
          Length = 1515

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 80/149 (53%), Gaps = 5/149 (3%)

Query: 6    EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMT 65
            EV  L+++ H+N+++ +      +  +L LE++       +      F +  I+      
Sbjct: 1267 EVSTLKDLDHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIRHLNTQV 1326

Query: 66   LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR---NMGSPQDMLTSNVVTRWY 122
            LRG+ + H   ILHRD+K +NLLL  DG  K++DFG++R   ++ S  DM     V  ++
Sbjct: 1327 LRGLAYLHSRGILHRDMKADNLLLDQDGVCKISDFGISRKSKDIYSNSDMTMRGTV--FW 1384

Query: 123  RAPELLFGAKHYTGAIDMWSVGVIFAELM 151
             APE++   + Y+  +D+WS+G I  E+ 
Sbjct: 1385 MAPEMVDTKQGYSAKVDIWSLGCIVLEMF 1413

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 91/182 (50%), Gaps = 8/182 (4%)

Query: 10  LQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGV 69
           L+E+ H N++          NLN+ LE++P      + ++   F +  +K++   TL G+
Sbjct: 491 LKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLVKNFTRQTLVGL 550

Query: 70  HHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMG---SPQDMLTSNVVTRWYRAPE 126
            + HR  I+HRD+K  NLL+   G +K+ DFG+++ +      Q+   S   + ++ APE
Sbjct: 551 TYLHRKNIIHRDIKGANLLIDIKGSVKITDFGISKKLSPLNKKQNKRASLQGSVYWMAPE 610

Query: 127 LLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEIST 186
           ++      T   D+WSVG +  E+       P   D  Q+   F+ +GT T  + P  ++
Sbjct: 611 VVKQVV-TTEKADIWSVGCVVVEMFTGKHPFP---DFSQMQAIFK-IGTNTIPELPSWAS 665

Query: 187 FG 188
            G
Sbjct: 666 DG 667

>Kwal_26.7788
          Length = 1267

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 85/168 (50%), Gaps = 22/168 (13%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFT---------Q 55
           RE+  ++ I H NV+ L +V+  +  L LVLE++         D   LF          +
Sbjct: 106 REIIIMKLISHPNVMGLYEVWENKLELFLVLEYV---------DGGELFDYLVSRGRLPE 156

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLL-APDGQLKLADFGLARNMGSPQDMLT 114
            +   +    + G  +CH   I HRDLKP NLLL   + ++K+ADFG+A  + +   +L 
Sbjct: 157 KEAIHYFRQIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAA-LQTSNKLLE 215

Query: 115 SNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDD 162
           ++  +  Y +PE++ G  +  G  D+WS G+I   L+    +LP  DD
Sbjct: 216 TSCGSPHYASPEIVMGKNYNGGPSDVWSCGIILFALL--TGHLPFNDD 261

>Scas_613.5
          Length = 517

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 82/176 (46%), Gaps = 30/176 (17%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD-------LEMIIKDNSILFTQADI 58
           E   L  I H N++ L+D ++   + + + ++L  D        E I+K   +   Q + 
Sbjct: 252 ETNILMRIHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCL--RQDET 309

Query: 59  KSWLLMTLRGVHHCHRNFILHRDLKPNNLL-------------LAP------DGQLKLAD 99
           K+     L G+ H H+  I+HRD+KP N+L             L P      D Q+K+AD
Sbjct: 310 KAIFNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIAD 369

Query: 100 FGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIP 155
           FGLA+  G  Q    +   T  Y APE+L   K YT  +DMWS GVI    +   P
Sbjct: 370 FGLAKFTGEMQ-FTNTLCGTPSYVAPEVL-TKKGYTSKVDMWSAGVILYVCLCGFP 423

>YOR267C (HRK1) [5054] chr15 complement(822585..824864)
           Serine/threonine protein kinase involved in regulation
           of plasma membrane ATPase (Pma1p) activity, has
           similarity to members of the NPR1 subfamily [2280 bp,
           759 aa]
          Length = 759

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 102/209 (48%), Gaps = 18/209 (8%)

Query: 13  IRHVNVIELIDVYM--AQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVH 70
           + H NVIE +DV+    Q+    V+E+ P D   ++    +  ++ +I   L     GV 
Sbjct: 272 LHHPNVIETVDVFSDSKQNKYYEVMEYCPIDFFAVVMTGKM--SRGEINCCLKQLTEGVK 329

Query: 71  HCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP-QDMLT---SNVVTRWYRAPE 126
           + H   + HRDLK +N ++   G LKL DFG A     P +D +T     V +  Y APE
Sbjct: 330 YLHSMGLAHRDLKLDNCVMTSQGILKLIDFGSAVVFRYPFEDGVTMAHGIVGSDPYLAPE 389

Query: 127 LLFGAKHYT-GAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRALGTPTDKDWPEI 184
           ++   K Y    +D+WS+G+I+  ++L R P+   +D  D     FR    P D +   +
Sbjct: 390 VITSTKSYDPQCVDIWSIGIIYCCMVLKRFPWKAPRDSDD----NFRLYCMPDDIEHDYV 445

Query: 185 STFGTYNKIQFYPPPSREEMRRRFIAATE 213
            +   + ++       R+E R+RF+  ++
Sbjct: 446 ESARHHEELL----KERKEKRQRFLNHSD 470

>Kwal_33.14192
          Length = 577

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 99/197 (50%), Gaps = 19/197 (9%)

Query: 13  IRHVNVIELIDVYMAQSNLNLVLEFLPADL-EMIIKDNSILFTQADIKSWLLMTLRGVHH 71
           + H N+IE +D+    +N  +V+E+ P D   +++ D   L ++ +I  +      GV +
Sbjct: 277 LHHCNIIETLDMLQEGTNFLVVMEYCPYDFFNLVMSD---LMSKNEISCYFKQICNGVDY 333

Query: 72  CHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP--QDMLTSN--VVTRWYRAPEL 127
            HR  + HRDLK +N ++   G LKL DFG A     P  +++L +   V +  Y APEL
Sbjct: 334 LHRMGLAHRDLKLDNCVVTKQGILKLIDFGSAVVFQYPYEKEILRAKGIVGSDPYLAPEL 393

Query: 128 LFGAKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRAL--GTPTDKDWPEI 184
           L    +    +D+WS+ ++F  + L R P+   +D       +FR    G  +++D    
Sbjct: 394 LSHPSYDPRPVDVWSIAIMFYCITLKRFPWKAPRDKYQ----SFRLFCEGADSERD---- 445

Query: 185 STFGTYNKIQFYPPPSR 201
           ST G +  ++  P  SR
Sbjct: 446 STRGPFRLLKLLPRHSR 462

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/253 (29%), Positives = 111/253 (43%), Gaps = 56/253 (22%)

Query: 6   EVKYLQEIRHVNVIELIDVYM-----AQSNLNLVLEFLPAD--LEMIIKDNSILFTQADI 58
           E   L +I H N++ L+D ++      Q    LVLE +      + I+K  S+   Q + 
Sbjct: 241 ETTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSL--PQEES 298

Query: 59  KSWLLMTLRGVHHCHRNFILHRDLKPNNLLL------APDG-------------QLKLAD 99
           K+     L G+ + H   I+HRD+KP N+LL      +PD              Q+K+AD
Sbjct: 299 KAIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIAD 358

Query: 100 FGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPG 159
           FGLA+  G  Q    +   T  Y APE+L   K YT  +D+WS GVI    +   P  P 
Sbjct: 359 FGLAKFTGEMQ-FTNTLCGTPSYVAPEVLV-KKGYTSKVDLWSAGVILYVCLCGFP--PF 414

Query: 160 KDDIDQIDVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLM 219
            D           LG P+ K+    + +       FY P   E          + AL+L+
Sbjct: 415 SD----------QLGPPSLKEQIMSAKYA------FYSPYWDE--------IDDAALHLI 450

Query: 220 DGMLTMNPHKRWD 232
             +L ++P  R+D
Sbjct: 451 SNLLVLDPENRYD 463

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 102/209 (48%), Gaps = 24/209 (11%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMT 65
           E+  L+E++H N++          NLN+ LE++P      +  N   F +  I ++    
Sbjct: 462 EMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYGPFEEPLIVNFTRQI 521

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP-----QDMLTSNVVTR 120
           L GV + HR  I+HRD+K  N+L+   G +K+ DFG+++ + SP     QD  TS   + 
Sbjct: 522 LIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGISKKL-SPLNQENQDKRTSLQGSV 580

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRALGTPTDK 179
           ++ +PE++      T   D+WS G +  E+   + PY     D  Q+   F+ +GT    
Sbjct: 581 YWMSPEVV-KQTATTSKADIWSTGCVVIEMFTGKHPY----PDFSQMQALFK-IGTNV-- 632

Query: 180 DWPEISTFGTYNKIQFYPPPSREEMRRRF 208
             PEI ++ +        P  R+ +R+ F
Sbjct: 633 -TPEIPSWAS--------PQGRDFIRKTF 652

>Kwal_26.7355
          Length = 1446

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 61/235 (25%), Positives = 106/235 (45%), Gaps = 33/235 (14%)

Query: 1    MSAIR-EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIK 59
            + A+R EV  L+++ H N+++ +         +L LE++       +      F +  I+
Sbjct: 1193 LEALRSEVATLKDLDHTNIVQYLGFENKNYVYSLFLEYVAGGSVGSLIRLYGKFDENLIR 1252

Query: 60   SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR---NMGSPQDMLTSN 116
               +  LRG+ + H   ILHRD+K +NLLL  DG  K++DFG+++   N+ S  DM    
Sbjct: 1253 FLAVQVLRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGISKKSNNIYSNSDMTMRG 1312

Query: 117  VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTP 176
             V  ++ APE++   + Y+  +D+WS+G +  E+        GK                
Sbjct: 1313 TV--FWMAPEMVDTKQGYSAKVDIWSLGCVVLEM------FAGK---------------- 1348

Query: 177  TDKDWPEISTFGTYNKI-QFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
              + W  +       KI +F   P   E  ++ I+A       +D    +NP KR
Sbjct: 1349 --RPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISA--EGKEFLDACFEINPEKR 1399

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 74.7 bits (182), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 80/151 (52%), Gaps = 8/151 (5%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLL 63
           E+  +Q + H N+++  D +  +S   +V +        + I+ D    +T+ D  + ++
Sbjct: 113 ELNIIQHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGK--YTEEDAVNIVV 170

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLL---APDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
             L+ V + H   I+HRDLKP NLL    + D ++ LADFG+AR + +  D++     + 
Sbjct: 171 QILKAVEYLHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSL 230

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELM 151
            Y APE +F +  +    D+WSVGVI   L+
Sbjct: 231 GYVAPE-VFTSDGHGKPSDIWSVGVITYTLL 260

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 75.1 bits (183), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 83/160 (51%), Gaps = 3/160 (1%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           + E++  + ++H N+++  D +   +N+ ++LE  P    M +       T+ +++ +  
Sbjct: 118 LSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTT 177

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
             +  + + H   I+HRDLK  N+       LK+ DFGLA  + + ++   +   T  Y 
Sbjct: 178 QIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYI 237

Query: 124 APELLFGAKH--YTGAIDMWSVGVIFAELMLRIPYLPGKD 161
           APE+L G KH  ++  +D+WS+GV+   L++  P    K+
Sbjct: 238 APEVLTG-KHTGHSFEVDIWSIGVMIYALLIGKPPFQAKE 276

>Kwal_0.96
          Length = 427

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 78/151 (51%), Gaps = 8/151 (5%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLL 63
           E+  LQ++ H N+++  D + ++    +V +        + I+K     FT+ D    + 
Sbjct: 95  ELSILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGK--FTEEDAVRIVY 152

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLL---APDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
             L+ V + H   I+HRDLKP NLL    A D QL L DFG+A+ + +  +++     + 
Sbjct: 153 QILKAVEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSM 212

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELM 151
            Y APE++  + H     D+WS+GV+   L+
Sbjct: 213 GYVAPEVVTTSGH-GKPCDIWSLGVVTYTLL 242

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 75.1 bits (183), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 85/156 (54%), Gaps = 6/156 (3%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSW 61
           +RE    Q + H NV +L ++    ++  +  EF+     L+ II+  S+    A   S 
Sbjct: 139 VREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLLDYIIQHGSLKENHARKVSR 198

Query: 62  LLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRW 121
            +++   + + H N I+HRDLK  N++L+  G++KL DFGL+ NM  P+  L +   + +
Sbjct: 199 GILS--ALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLS-NMYDPRKSLQTFCGSLY 255

Query: 122 YRAPELLFGAKHYTGAIDMWSVGVIFAELML-RIPY 156
           + APELL    +    +D+WS GV+   L+  ++P+
Sbjct: 256 FAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPF 291

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 75.1 bits (183), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 84/150 (56%), Gaps = 7/150 (4%)

Query: 7   VKYLQEIRHVNVIELIDVYMAQSNLNLVLEF-LPADLEMIIKDNSILFTQADIKSWLLMT 65
           +  L+ ++H N+++      +   L ++LE+ +   L  +IK  ++  ++A  K+++  T
Sbjct: 65  IDLLKNLKHENIVKYHGFIQSSHELYILLEYCIRGSLRDLIKKEAL--SEAKAKTYVRQT 122

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAP 125
           LRG+ + H   ++HRD+K  NLLL  +G +KLADFG++  +    +M  +   +  + AP
Sbjct: 123 LRGLQYLHDQGVIHRDIKAANLLLTENGVVKLADFGVSTRV---NNMAMTYAGSPNWMAP 179

Query: 126 ELLFGAKHYTGAIDMWSVGVIFAELMLRIP 155
           E++ G K  +   D+WS+G    EL+   P
Sbjct: 180 EVMLG-KGASTVSDIWSLGATVVELLTGNP 208

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 76/155 (49%), Gaps = 7/155 (4%)

Query: 14  RHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTL-RGVHHC 72
           +H NV+ +ID  +    L ++LE      ++  K    +    D+  +    L R +++ 
Sbjct: 73  KHANVLRVIDCNVGGEYLWIMLEMADGG-DLFDKIEPDVGVDPDVAQFYFQQLIRALNYL 131

Query: 73  HRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRW---YRAPELLF 129
           H   + HRD+KP N+LL   G LKLADFGLA         L  +   R    Y APE+L 
Sbjct: 132 HDVGVAHRDIKPENILLDKKGNLKLADFGLASQFRRKDGTLRVSTDQRGSPPYMAPEILS 191

Query: 130 GAKHYTGAIDMWSVGV-IFAELMLRIPY-LPGKDD 162
              +Y    D+WS GV +F  L   IP+ +P K+D
Sbjct: 192 SQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKED 226

>Scas_700.34
          Length = 864

 Score = 74.7 bits (182), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 73/164 (44%), Gaps = 3/164 (1%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLM 64
           RE+  L+ + H N+++L +V      + +VLE+                 +         
Sbjct: 106 REINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPACRLFAQ 165

Query: 65  TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRA 124
            + GVH+ H   ++HRDLK  NLLL     L + DFG      S  +++ ++  +  Y A
Sbjct: 166 LINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTSCGSPCYAA 225

Query: 125 PELLFGAKHYTG-AIDMWSVGVIFAELMLRIPYLPGKDDIDQID 167
           PEL+   K Y     D+WS GVI   ++    YLP  DD    D
Sbjct: 226 PELVVSTKPYEAKKADIWSCGVILYAMLAG--YLPWDDDAGNPD 267

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 74.7 bits (182), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 93/193 (48%), Gaps = 11/193 (5%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMT 65
           E+  L+E+ H N++          NLN+ LE++P      + +N   F ++ I ++    
Sbjct: 504 EMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQI 563

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMG---SPQDMLTSNVVTRWY 122
           L GV + H+  I+HRD+K  N+L+   G +K+ DFG+++ +      Q+   S   + ++
Sbjct: 564 LIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFW 623

Query: 123 RAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
            +PE++      T   D+WS G +  E+       P   D  Q+   F+ +GT T    P
Sbjct: 624 MSPEVV-KQTATTAKADIWSTGCVVIEMFTGKHPFP---DFSQMQAIFK-IGTNT---TP 675

Query: 183 EISTFGTYNKIQF 195
           EI ++ T     F
Sbjct: 676 EIPSWATSEGKNF 688

>CAGL0I05192g complement(493635..494756) highly similar to sp|P15790
           Saccharomyces cerevisiae YIL035c CKA1 casein kinase II,
           start by similarity
          Length = 373

 Score = 73.9 bits (180), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 98/200 (49%), Gaps = 15/200 (7%)

Query: 54  TQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLL-APDGQLKLADFGLARNMGSPQDM 112
           +  DI+ ++   L+ + +CH   I+HRD+KP+N+++     +L+L D+GLA       + 
Sbjct: 168 SDIDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQRKLRLIDWGLAEFYHVNME- 226

Query: 113 LTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFR 171
               V +R+++ PELL   + Y  ++D+WS G + A ++  + P+  G  + DQ+    R
Sbjct: 227 YNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFQKEPFFHGTSNTDQLVKIVR 286

Query: 172 ALGTPTDKDW---------PEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGM 222
            LG+   + +          E      Y +  +Y   + +    R ++  E+ ++L+D +
Sbjct: 287 VLGSDDFEKYLIKYQITLPREFHDMDQYIRRPWYRFVNDQN---RHLSDNEDVIDLLDNL 343

Query: 223 LTMNPHKRWDPIQCLTSEYF 242
           L  +  +R    + +   +F
Sbjct: 344 LRYDHQERLTAKEAMGHPWF 363

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 73.9 bits (180), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 76/151 (50%), Gaps = 8/151 (5%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLL 63
           E+  LQ ++H N++E  D + ++    +V +        + I+      FT+ D  S  +
Sbjct: 94  ELSILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGK--FTERDAVSITM 151

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLL---APDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
             L  V + H   ++HRDLKP N+L    + D QL +ADFG+A+ +    D++     + 
Sbjct: 152 QILSAVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSL 211

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELM 151
            Y APE+L    H     D+WS+GVI   L+
Sbjct: 212 GYVAPEVLTNNGH-GKPCDIWSIGVIVYTLL 241

>Kwal_55.20326
          Length = 750

 Score = 73.9 bits (180), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 92/184 (50%), Gaps = 8/184 (4%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMT 65
           E+  L+E++H N++          NLN+ LE++P      + ++   F +  I+++    
Sbjct: 537 EMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLIRNFTRQI 596

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMG---SPQDMLTSNVVTRWY 122
           L G+ + HR  I+HRD+K  N+L+   G +K+ DFG+++ +      Q+   S   + ++
Sbjct: 597 LIGLSYLHRKDIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQQQNKRASLQGSVYW 656

Query: 123 RAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWP 182
            APE++      T   D+WSVG +  E+       P   D  Q+   F+ +GT T  D P
Sbjct: 657 MAPEVVKQVV-TTKKADIWSVGCVIIEMFTGKHPFP---DFSQMQAIFK-IGTNTFPDSP 711

Query: 183 EIST 186
             S+
Sbjct: 712 SWSS 715

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 73.9 bits (180), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 92/175 (52%), Gaps = 24/175 (13%)

Query: 5   REVKYLQEIRHVNVIELIDVYM--AQSNLNLVLEFLPA---------DLEMIIKDNSILF 53
           +E++ ++   H NV+EL ++      + + LVLE+             +E+     SIL 
Sbjct: 103 QEIEVMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSILT 162

Query: 54  TQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMG------ 107
            Q   K  +L  + G+ + H   I HRD+KP+NLL++ +G +K++DFG+A +        
Sbjct: 163 FQQSRK-VVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNI 221

Query: 108 --SPQDMLTSNVV-TRWYRAPELLFGAKHY--TGAIDMWSVGV-IFAELMLRIPY 156
             S + +L S  + T  + APEL    K Y  + AID+WS+GV I+  L  ++P+
Sbjct: 222 QSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPF 276

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 123/279 (44%), Gaps = 57/279 (20%)

Query: 6   EVKYLQEIRHVNVIELIDVYM-----AQSNLNLVLEFLPAD--LEMIIKDNSILFTQADI 58
           E   L  ++H N++ L+D ++     +Q    LVLE +      E I++       Q + 
Sbjct: 248 ETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVR--KTCLRQDES 305

Query: 59  KSWLLMTLRGVHHCHRNFILHRDLKPNNLL-------------LAP------DGQLKLAD 99
           K+     L G+ + H   I+HRD+KP N+L             L P      D Q+K+AD
Sbjct: 306 KALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIAD 365

Query: 100 FGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPG 159
           FGLA+  G  Q    +   T  Y APE+L   K YT  +D+WS GVI    +   P  P 
Sbjct: 366 FGLAKFTGEMQ-FTNTLCGTPSYVAPEVL-TKKGYTSKVDLWSAGVILYVCLCGFP--PF 421

Query: 160 KDDIDQIDVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLM 219
            D           LG P+ K+    + +       FY P         +    ++ L+L+
Sbjct: 422 SD----------QLGPPSLKEQILQAKYA------FYSP--------YWDKIDDSVLHLI 457

Query: 220 DGMLTMNPHKRWDPIQCLTSEYFVELPVPTTPS-ELPQL 257
             +L +NP +R++  + L   +F ++   ++ S EL +L
Sbjct: 458 SNLLVLNPDERYNIDEALNHPWFNDIQQQSSVSLELQRL 496

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 46/148 (31%), Positives = 77/148 (52%), Gaps = 5/148 (3%)

Query: 6    EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMT 65
            EV  L+++ HVN+++ +         +L LE++       +      F    I+      
Sbjct: 1091 EVSTLKDLNHVNIVQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGRFDDQLIRHLTKQV 1150

Query: 66   LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR---NMGSPQDMLTSNVVTRWY 122
            L G+ + H   ILHRD+K +NLLL  DG  K++DFG++R   N+ S  DM     V  ++
Sbjct: 1151 LEGLAYLHSKGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSDMTMRGTV--FW 1208

Query: 123  RAPELLFGAKHYTGAIDMWSVGVIFAEL 150
             APE++  A  Y+  +D+WS+G +  E+
Sbjct: 1209 MAPEMVDTAHGYSAKVDIWSLGCVVLEM 1236

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 73.6 bits (179), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 75/145 (51%), Gaps = 6/145 (4%)

Query: 13  IRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHC 72
           + H N++E +D+        LV+E+ P D   ++  N  L TQ ++  +      GV++ 
Sbjct: 364 LHHENIVETLDMLTEGDTYLLVMEYAPYDFFNLVMSN--LMTQDEVNCYFKQLCHGVNYL 421

Query: 73  HRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP-QDMLTSN---VVTRWYRAPELL 128
           H   + HRDLK +N ++  DG LKL DFG A     P +D +  +   V +  Y APELL
Sbjct: 422 HSMGLAHRDLKLDNCVVTKDGILKLIDFGSAVVFQYPYEDTIVKSHGIVGSDPYLAPELL 481

Query: 129 FGAKHYTGAIDMWSVGVIFAELMLR 153
               +     D+WS+ +IF  ++L+
Sbjct: 482 KQTSYDPRVADVWSIAIIFYCMVLK 506

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 83/154 (53%), Gaps = 13/154 (8%)

Query: 4    IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPA-DLEMIIKDNSILFTQAD---IK 59
            I EV  L+++ H+N+++ +         +L LE++    +  +I+    L+   D   I+
Sbjct: 1175 ISEVSTLKDLDHLNIVQYLGFENKNCIYSLFLEYVAGGSVGSLIR----LYGHFDEQLIR 1230

Query: 60   SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR---NMGSPQDMLTSN 116
                  L G+ + H   ILHRD+K +NLLL  DG  K++DFG++R   N+ S  +M    
Sbjct: 1231 FLTTQVLEGLAYLHLRGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSEMTMRG 1290

Query: 117  VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAEL 150
             V  ++ APE++   + Y+  +D+WS+G +  E+
Sbjct: 1291 TV--FWMAPEMVDTTQGYSAKVDIWSLGCVVLEM 1322

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 47/154 (30%), Positives = 84/154 (54%), Gaps = 6/154 (3%)

Query: 1    MSAIR-EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIK 59
            + A+R EV  L+++ H+N+++ +      +  +L LE++       +      F +  IK
Sbjct: 1222 VEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIK 1281

Query: 60   SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR---NMGSPQDMLTSN 116
                  L+G+ + H   ILHRD+K +NLLL  DG  K++DFG++R   ++ S  DM    
Sbjct: 1282 HLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMRG 1341

Query: 117  VVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAEL 150
             V  ++ APE++   + Y+  +D+WS+G I  E+
Sbjct: 1342 TV--FWMAPEMVDTKQGYSAKVDIWSLGCIVLEM 1373

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 86/178 (48%), Gaps = 34/178 (19%)

Query: 6   EVKYLQEIRHVNVIELID-----VYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADI 58
           E K L  I+H N+++LID     V   Q    LVLE +      E I++ N++   + + 
Sbjct: 149 ETKILLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNL--REDET 206

Query: 59  KSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAP-------------------DGQLKLAD 99
           K+     L G+ + H   I+HRD+KP N+LL+                    D Q+K+AD
Sbjct: 207 KALFRQLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIAD 266

Query: 100 FGLARNMGSPQDMLTSNVV--TRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIP 155
           FGLA+  G   +M  +N +  T  Y APE+L     YT  +DMWS GV+    +   P
Sbjct: 267 FGLAKFTG---EMKFTNTLCGTPSYVAPEVLVKT-GYTSRVDMWSAGVLLYVCLCGFP 320

>Kwal_33.14434
          Length = 759

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 78/145 (53%), Gaps = 6/145 (4%)

Query: 13  IRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHC 72
           +RH N+IE +++    + +  V+EF   DL  I+  N + + +  I       L GV + 
Sbjct: 461 LRHPNIIETVEIVYDNNRILQVMEFCDYDLFAIVMSNKMSYEE--ICCCFKQILTGVQYL 518

Query: 73  HRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP--QDMLTSN--VVTRWYRAPELL 128
           H   + HRDLK +N ++   G +KL DFG A     P  + ++ S+  V +  Y APE+ 
Sbjct: 519 HSMGLAHRDLKLDNCVINKHGVVKLIDFGAAAVFSYPFSKTLVESSGIVGSDPYLAPEVC 578

Query: 129 FGAKHYTGAIDMWSVGVIFAELMLR 153
             +K+    +D+WSV +IFA ++L+
Sbjct: 579 IFSKYDPRPVDVWSVAIIFACMVLK 603

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 111/244 (45%), Gaps = 37/244 (15%)

Query: 2   SAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIK 59
           + +REV Y ++     + +L +V + +S + +VLE+       E ++K+  +   ++  K
Sbjct: 74  NVVREVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEES--K 131

Query: 60  SWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVT 119
                    V++ H    +HRDLK  N+LL  +G  KL DFG  R M + +  L +   T
Sbjct: 132 KLFSQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMAT-RSQLETICGT 190

Query: 120 RWYRAPELLFGAKHYTG-AIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTD 178
             Y APEL+   K Y G  +D+WS+G+I   ++    Y+P  +D D I    + +    D
Sbjct: 191 TVYMAPELI-ERKCYDGFKVDIWSLGIILYTMI--NGYMPFDED-DDIKTKLKIVNDELD 246

Query: 179 KDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLT 238
            +   IS                           ++A++L+ GML  NP++R    Q L+
Sbjct: 247 FNQEWIS---------------------------DDAIDLIQGMLRKNPNERISLAQVLS 279

Query: 239 SEYF 242
             + 
Sbjct: 280 HPFL 283

>Scas_598.6
          Length = 790

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 89/163 (54%), Gaps = 10/163 (6%)

Query: 4   IREVKYLQEIRHVNVIELIDVYM-AQSNLNLVLEFLPA-DLEMIIKDN------SILFTQ 55
           + E+  +++ RH N++  ++ Y+  + +L +V+EF+    L  II+++      S   T+
Sbjct: 556 VNEILVMKDSRHKNIVNFLEAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLTE 615

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTS 115
             I   +  T +G+   H   I+HRD+K +N+LL  + ++K+ DFG    +   +    +
Sbjct: 616 PQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNNARVKITDFGFCAKLTDQRSKRAT 675

Query: 116 NVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELM-LRIPYL 157
            V T ++ APE++   + Y   +D+WS+G++  E++    PYL
Sbjct: 676 MVGTPYWMAPEVV-KQREYDEKVDVWSLGIMTIEMLESEPPYL 717

>Scas_678.24
          Length = 1610

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 69/130 (53%), Gaps = 17/130 (13%)

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDM------------- 112
           L  + + H   I+HRDLKP N+ +     +K+ DFGLA+N+    D+             
Sbjct: 772 LEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLAKNVHRSLDILKLDSQSVVGSTE 831

Query: 113 -LTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQI-DVTF 170
            LTS + T  Y A E+L G  +Y   IDM+S+G+IF E++   P+  G + ++ + D+  
Sbjct: 832 NLTSAIGTALYVATEVLNGKGNYNEKIDMYSLGIIFFEMIY--PFGTGMERVNSLKDLRL 889

Query: 171 RALGTPTDKD 180
            ++  PTD D
Sbjct: 890 ASIKFPTDFD 899

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 87/166 (52%), Gaps = 14/166 (8%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSN--LNLVLEFLPA-DLEMIIKDNSILFTQADIKS 60
           +RE+++ +  +   ++    ++  + N  + + +E++    LE I K+  +L     I  
Sbjct: 225 LRELQFNKSFKSEYIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKE--LLSRGGRISE 282

Query: 61  WLL-----MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTS 115
            +L       LRG+ + H   ++HRD+KP N+LL  DGQ+KL DFG++    +   + T+
Sbjct: 283 KVLGKISEAVLRGLSYLHEKKVIHRDIKPQNILLNEDGQVKLCDFGVSGE--AVNSLATT 340

Query: 116 NVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELML-RIPYLPGK 160
              T +Y APE + G + Y+   D+WS+G+   E+     P+ P K
Sbjct: 341 FTGTSYYMAPERIQG-QPYSVTCDVWSLGLTILEVAQGHFPFGPDK 385

>CAGL0C02893g complement(286017..287966) similar to tr|Q08732
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 649

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 76/148 (51%), Gaps = 9/148 (6%)

Query: 13  IRHVNVIELIDVYM--AQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVH 70
           + H NVIE +DV+    Q+    V+++ P D   ++    +  ++ +I   L     GV 
Sbjct: 272 LHHPNVIETVDVFSDSKQNKYYEVMQYCPIDFFAVVMTGKM--SRGEINCCLKQLTEGVR 329

Query: 71  HCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQD----MLTSNVVTRWYRAPE 126
           + H   + HRDLK +N ++  DG +KL DFG A     P +    M    V +  Y APE
Sbjct: 330 YLHSMGLAHRDLKLDNCVMTADGIIKLIDFGSAVVFRYPFEDDVTMAHGIVGSDPYLAPE 389

Query: 127 LLFGAKHYT-GAIDMWSVGVIFAELMLR 153
           ++   K Y    +D+WS+G+I+  +ML+
Sbjct: 390 VITSTKSYDPQCVDIWSIGIIYCCMMLK 417

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 87/163 (53%), Gaps = 10/163 (6%)

Query: 4   IREVKYLQEIRHVNVIELIDVYM-AQSNLNLVLEFLPADLEMIIKDNSIL-------FTQ 55
           + E+  +++ +H N++  ++ Y+  + +L +V+E++       + +NSI         T+
Sbjct: 559 VNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTE 618

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTS 115
             I   +  T +G+   H   I+HRD+K +N+LL   G++K+ DFG    +   +    +
Sbjct: 619 PQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRAT 678

Query: 116 NVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELML-RIPYL 157
            V T ++ APE++   + Y   +D+WS+G++  E++    PYL
Sbjct: 679 MVGTPYWMAPEVV-KQREYDEKVDVWSLGIMTIEMLEGEPPYL 720

>Kwal_23.6325
          Length = 1542

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 83/159 (52%), Gaps = 13/159 (8%)

Query: 6    EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMT 65
            E+  L+ + H NV++   V + +  +NL +E+        + ++  +  +   + + L  
Sbjct: 1298 EMSVLEMLNHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQM 1357

Query: 66   LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGS------------PQDML 113
            L G+ + H++ ++HRD+KP N+LL  +G +K  DFG AR++ +              D +
Sbjct: 1358 LEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGV 1417

Query: 114  TSNVVTRWYRAPELLFGAKHYT-GAIDMWSVGVIFAELM 151
             S + T  Y +PE + GAK    G+ D+WS+G +  E++
Sbjct: 1418 NSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMV 1456

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 72.4 bits (176), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 80/151 (52%), Gaps = 5/151 (3%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLP-ADLEMIIKDNSILFTQADIKSWLLM 64
           E+  L+ + H N+++          L ++LE+     L  +I  +S   ++ + K+++  
Sbjct: 70  EISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQ 129

Query: 65  TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRA 124
           TL G+ + H   ++HRD+K  N+LL+ D  +KLADFG++  + S    L     T  + A
Sbjct: 130 TLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAG---TLNWMA 186

Query: 125 PELLFGAKHYTGAIDMWSVGVIFAELMLRIP 155
           PE+L G +  +   D+WS+G    E++ + P
Sbjct: 187 PEIL-GNRGASTLSDIWSLGATVVEMLTKNP 216

>YDR283C (GCN2) [1112] chr4 complement(1025062..1030041)
           Serine/threonine protein kinase that regulates
           initiation of translation by phosphorylation of
           eIF2alpha (Sui2p), involved in general amino acid
           control response and salt tolerance [4980 bp, 1659 aa]
          Length = 1659

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 88/180 (48%), Gaps = 26/180 (14%)

Query: 5   REVKYLQEI-RHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSW 61
           +E K +Q + R  N ++ +     +S L + +E+       ++I  +N     Q   + W
Sbjct: 757 KESKSIQNVPRRRNFVKPMTAVKKKSTLFIQMEYCENRTLYDLIHSEN---LNQQRDEYW 813

Query: 62  LLM--TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNM------------- 106
            L    L  + + H   I+HRDLKP N+ +     +K+ DFGLA+N+             
Sbjct: 814 RLFRQILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLAKNVHRSLDILKLDSQN 873

Query: 107 --GSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDID 164
             GS  D LTS + T  Y A E+L G  HY   IDM+S+G+IF E++   P+  G + ++
Sbjct: 874 LPGSS-DNLTSAIGTAMYVATEVLDGTGHYNEKIDMYSLGIIFFEMIY--PFSTGMERVN 930

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 51/113 (45%), Gaps = 22/113 (19%)

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFG--LARNMGSPQDML 113
           A  + W++  L G+   H+  I+H+ +    ++L  D     ADFG  + + + S     
Sbjct: 368 ATARIWMIRLLEGLEAIHKLGIVHKCINLETVILVKD-----ADFGSTIPKLVHSTYGYT 422

Query: 114 TSNVVTRW--------------YRAPELL-FGAKHYTGAIDMWSVGVIFAELM 151
             N+++R+              + APELL F         D+W +GV+F +++
Sbjct: 423 VLNMLSRYPNKNGSSVELSPSTWIAPELLKFNNAKPQRLTDIWQLGVLFIQII 475

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 78/151 (51%), Gaps = 8/151 (5%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLL 63
           E+  LQ++ H N+++  D + ++    +V +        + I+K     FT+ D    ++
Sbjct: 103 ELSILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGK--FTETDAVKIVV 160

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLL---APDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
             L  V + H   ++HRDLKP N+L    + + QL ++DFG+A+ + S   ++     + 
Sbjct: 161 QMLTAVEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSM 220

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELM 151
            Y APE+L  + H     D+WS+GVI   L+
Sbjct: 221 GYVAPEVLTTSGH-GKPCDIWSLGVITYTLL 250

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 86/173 (49%), Gaps = 8/173 (4%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMT 65
           E+  L+E+ H N++          NLN+ LE++P      + +N   F +  +K++    
Sbjct: 518 EMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNNYGPFDEPLVKNFTRQI 577

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMG---SPQDMLTSNVVTRWY 122
           L G+ + H+  I+HRD+K  N+L+   G +K+ DFG+++ +      Q+   S   + ++
Sbjct: 578 LIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGISKKLSPLNKQQNKRASLQGSVYW 637

Query: 123 RAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGT 175
            APE++      T   D+WSVG +  E+       P   D  Q+   F+ +GT
Sbjct: 638 MAPEVVKQVV-TTEKADIWSVGCVIVEMFTGKHPFP---DFSQMQAIFK-IGT 685

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 72.4 bits (176), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 84/153 (54%), Gaps = 6/153 (3%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLP-ADLEMIIKDNSILFTQADIKSWL 62
           + E+  L+ + H+N+++       Q NL ++LE+     L+ +I  N  + ++ + K ++
Sbjct: 65  MSEIDLLKNLNHINIVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPM-SEHEAKPYV 123

Query: 63  LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWY 122
             TL G+++ H   ++HRD+K  N+LL  +  +KLADFG++  + +    L  ++   W 
Sbjct: 124 RQTLNGLNYLHEQGVIHRDIKAANILLDSENVVKLADFGVSTKVNNTAMTLAGSL--NWM 181

Query: 123 RAPELLFGAKHYTGAIDMWSVGVIFAELMLRIP 155
            APE++ G +  +   D+WS+G    EL+   P
Sbjct: 182 -APEII-GNRGASTLSDIWSLGATVVELLTGNP 212

>KLLA0C07535g 658746..660620 some similarities with sgd|S0005793
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 624

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 84/174 (48%), Gaps = 14/174 (8%)

Query: 13  IRHVNVIELIDVY--MAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVH 70
           + H N+IE +D++    Q+    V+E+ P D   ++    +  ++ +I       +  V+
Sbjct: 273 LHHPNIIETLDIFSDAKQTQYYQVMEYCPVDFFAVVMSGEM--SRGEINCCFKQLVEAVN 330

Query: 71  HCHRNFILHRDLKPNNLLLAPDGQLKLADFGLA---RNMGSPQDMLTSNVV-TRWYRAPE 126
           + H     HRDLK +N ++  +G LKL DFG A   +        L   +V +  Y APE
Sbjct: 331 YLHSKGYAHRDLKLDNCVMTKEGILKLIDFGSAFVYKYTYENDTKLAHGIVGSDPYLAPE 390

Query: 127 LLFGAKHYTGA-IDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRALGTPTD 178
           +L  +  Y    +D+WS+G+IF  +ML R P+   KD     DV F     P D
Sbjct: 391 VLVHSNGYDAPMVDIWSMGIIFCCMMLKRFPWKVPKDS----DVNFSLYCMPDD 440

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 71.6 bits (174), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 43/148 (29%), Positives = 80/148 (54%), Gaps = 5/148 (3%)

Query: 6    EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMT 65
            EV  L+++ H+N+++ +   +  +  +L LE++       +      F +  I+      
Sbjct: 1204 EVATLKDLDHLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGRFDEKLIRHLNTQV 1263

Query: 66   LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGL---ARNMGSPQDMLTSNVVTRWY 122
            L G+ + H   ILHRD+K +NLLL  DG  K++DFG+   ++N+ S  DM     V  ++
Sbjct: 1264 LSGLKYLHSKGILHRDMKADNLLLDEDGICKISDFGISKKSKNIYSNSDMTMRGTV--FW 1321

Query: 123  RAPELLFGAKHYTGAIDMWSVGVIFAEL 150
             APE++   + Y+  +D+WS+G +  E+
Sbjct: 1322 MAPEMVDTKQGYSAKVDIWSLGCVVLEM 1349

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 71.6 bits (174), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 121/276 (43%), Gaps = 52/276 (18%)

Query: 7   VKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLP-ADLEMIIKDNSILFTQADIKSWLLMT 65
           ++ L   R   VI+L   +  ++NL  +LE+ P  D   ++K    L ++   K +    
Sbjct: 252 LQRLNSSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTL-SEECTKYYGAQI 310

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMG-----SPQDMLT---SNV 117
           L  +HH H+  I+HRD+KP N+LL    ++KL DFG A+ +G      P D+ T   S V
Sbjct: 311 LDAIHHLHKQGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFV 370

Query: 118 VTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPT 177
            T  Y +PELL    +     D+W+ G I  +++                      G P 
Sbjct: 371 GTAEYVSPELL-NDNYVDSRCDIWAFGCILFQMV---------------------AGKPP 408

Query: 178 DKDWPEISTFGTYNKIQF-----YPPPSREEMRRRFIAATE--------------NALNL 218
            K   E  TF    ++Q+     +P   R+ +++  +   E              N +N 
Sbjct: 409 FKATNEYLTFQKVMRVQYAFTAGFPMILRDLIKQLLVKKPEQRLTILQIEKHHFFNDINF 468

Query: 219 MDGMLTMNPHKRWDPIQCLTSEYFVELPVPTTPSEL 254
            +G +  NP  +  P + +T++    +PV +T S+L
Sbjct: 469 RNGSVWSNPAPQIAPYK-VTAKAMQSVPVKSTKSQL 503

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 79/151 (52%), Gaps = 7/151 (4%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLP-ADLEMIIKDNSILFTQADIKSWLLM 64
           E+  L+ +RH N++E          L ++LE+     L  I+K   +L  + D  +++  
Sbjct: 55  EIDLLKNLRHQNIVEYRGFIQKAHELYIILEYCARGSLRDILKHGPLL--EDDTVNYVTQ 112

Query: 65  TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRA 124
           TL G+ + H   ++HRD+K  NLLL  +G +KLADFG++  +     M  +   +  + A
Sbjct: 113 TLYGLQYLHEQGVIHRDIKAANLLLTEEGIVKLADFGVSTRINR---MAMTYAGSPNWMA 169

Query: 125 PELLFGAKHYTGAIDMWSVGVIFAELMLRIP 155
           PE++ G    T + D+WS+G    EL+   P
Sbjct: 170 PEVMTGQGASTVS-DIWSLGATVVELLTGNP 199

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 71.2 bits (173), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 86/163 (52%), Gaps = 10/163 (6%)

Query: 4   IREVKYLQEIRHVNVIELIDVYM-AQSNLNLVLEFLPADLEMIIKDNSIL-------FTQ 55
           + E+  +++ +H N++  ++ Y+  + +L +V+E++       I +NS          T+
Sbjct: 645 VNEILVMKDSKHNNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLTE 704

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTS 115
             I   +  T +G+   H   I+HRD+K +N+LL   G++K+ DFG    +   +    +
Sbjct: 705 PQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLTDKRSKRAT 764

Query: 116 NVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELM-LRIPYL 157
            V T ++ APE++   + Y   +D+WS+G++  E++    PYL
Sbjct: 765 MVGTPYWMAPEVV-KQREYDEKVDVWSLGIMTIEMLESEPPYL 806

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 70.9 bits (172), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 67/136 (49%), Gaps = 3/136 (2%)

Query: 53  FTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDM 112
           FT+   K ++   +  + H H N I++RDLKP N+LL  +G + L DFGL++     +D 
Sbjct: 438 FTEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSK--ADLKDR 495

Query: 113 LTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLR-IPYLPGKDDIDQIDVTFR 171
             +   T  Y APELL     YT  +D WS+GV+  E+     P+    +      + F 
Sbjct: 496 TNTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFG 555

Query: 172 ALGTPTDKDWPEISTF 187
            +  P D   PE  +F
Sbjct: 556 KVKFPRDILSPEGRSF 571

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 70.9 bits (172), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 84/163 (51%), Gaps = 10/163 (6%)

Query: 4   IREVKYLQEIRHVNVIELIDVYM-AQSNLNLVLEFLPADLEMIIKDNSIL-------FTQ 55
           + E+  +++ RH N++  ++ Y+    +L +V+EF+       I +NS          T+
Sbjct: 608 VNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTE 667

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTS 115
             I   +  T +G+   H   I+HRD+K +N+LL    ++K+ DFG    +   +    +
Sbjct: 668 PQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRAT 727

Query: 116 NVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELML-RIPYL 157
            V T ++ APE++   + Y   ID+WS+G++  E++    PYL
Sbjct: 728 MVGTPYWMAPEVV-KQREYDEKIDVWSLGIMTIEMLEGEPPYL 769

>Scas_693.17
          Length = 1049

 Score = 70.9 bits (172), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 86/157 (54%), Gaps = 6/157 (3%)

Query: 3   AIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKS 60
            +RE    Q + H ++  L +++   ++  ++ E++     L+ II+  S+  ++A  ++
Sbjct: 147 TVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQLLDYIIQHGSLKESRA--RT 204

Query: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
           +       + + H + I+HRDLK  N++++ DG +KL DFGL+ N+    + L +   + 
Sbjct: 205 FTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGLS-NLYDKCNKLKTYCGSL 263

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELML-RIPY 156
           ++ APELL    +    ID+WS GV+   L+  ++P+
Sbjct: 264 YFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPF 300

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 101/237 (42%), Gaps = 18/237 (7%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLM 64
           RE+  L+ + H N+I L +V      + +VLEF+                ++        
Sbjct: 99  REINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQ 158

Query: 65  TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRA 124
            + GV++ H   ++HRDLK  NLLL     L + DFG         +++ ++  +  Y A
Sbjct: 159 LISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMKTSCGSPCYAA 218

Query: 125 PELLFGAKHYTG-AIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPE 183
           PEL+   K Y     D+WS GVI   ++    YLP  DD +           PT  D   
Sbjct: 219 PELVVSTKAYEARKADVWSCGVILYAML--AGYLPWDDDHEN----------PTGDDIAR 266

Query: 184 ISTFGTYNKIQF---YPPPSREEMRRRFIAATENALNL--MDGMLTMNPHKRWDPIQ 235
           +  + T   ++F     P  R+ +RR  +      +NL  +   + + PH+ +  IQ
Sbjct: 267 LYKYITQTPLKFPEYITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPHEAFLSIQ 323

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 76/151 (50%), Gaps = 8/151 (5%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLL 63
           E+  LQ + H N++   D + ++    ++ +        + I+K     FT+ D    L+
Sbjct: 86  ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGK--FTEEDAVRILV 143

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLL---APDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
             L  V + H   I+HRDLKP NLL    + +  L +ADFG+A+ + S +++L     + 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSL 203

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELM 151
            Y APE+L    H     D+WS+GVI   L+
Sbjct: 204 GYVAPEVLTQDGH-GKPCDIWSIGVITYTLL 233

>Scas_653.25
          Length = 666

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 86/175 (49%), Gaps = 17/175 (9%)

Query: 3   AIREVKYLQEIRHVNVIELIDV-YMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSW 61
            I+E      + H N+IE +D+ Y     ++ ++E+ P D   I+   + L T+ +   +
Sbjct: 316 CIKEFILSSHLSHPNIIETLDIFYNPSGQISEIMEWCPHDFFNIVMSRTHLLTRRETFCY 375

Query: 62  LLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLA------RNMGSPQDMLTS 115
                 GV + H   I HRDLK +N ++  +G LKL DFG A      ++     +++ S
Sbjct: 376 FKQLCNGVRYLHTLGIAHRDLKLDNCVITYNGILKLIDFGSATIFQLNKSTEEKPELIPS 435

Query: 116 N--VVTRWYRAPELLFGAK--HYTGAIDMWSVGVIFAELML-----RIPYLPGKD 161
              V +  Y APE+L   +  +     D+WS+G+IF  +ML     RIP L  KD
Sbjct: 436 RGIVGSDPYLAPEVLLSKEIPYDASLADVWSLGIIFCAIMLKRFPWRIP-LASKD 489

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 86/157 (54%), Gaps = 8/157 (5%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSW 61
           IRE    Q + H ++  L ++    ++  ++ E++     L+ II+  S+    A  + +
Sbjct: 128 IREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSLRERHA--RKF 185

Query: 62  LLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRW 121
                  + + H N I+HRDLK  N++++  G++++ DFGL+ NM  P+  L +   + +
Sbjct: 186 ARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLS-NMYDPKKQLHTFCGSLY 244

Query: 122 YRAPELLFGAKHYTG-AIDMWSVGVIFAELML-RIPY 156
           + APELL  A  YTG  +D+WS GV+   L+  ++P+
Sbjct: 245 FAAPELL-KAHPYTGPEVDIWSFGVVLYVLVCGKVPF 280

>Kwal_55.21545
          Length = 865

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 79/153 (51%), Gaps = 4/153 (2%)

Query: 5   REVKYLQEIRHV-NVIELIDVYMAQSNLNLVLEFLPA-DLEMIIKDNSILFTQADIKSWL 62
           +E+++L  ++ V N+      Y+  + L +++E+     L  +++   I   +  I   +
Sbjct: 64  KEIQFLSSLKQVPNITHYYGSYLNDTKLWVIMEYCAGGSLRTLLRPGKI--GEQYIGVIM 121

Query: 63  LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWY 122
              L  + H H++ ++HRD+K  N+L+  DG +KL DFG+A  +   +    +   T ++
Sbjct: 122 RELLTALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYW 181

Query: 123 RAPELLFGAKHYTGAIDMWSVGVIFAELMLRIP 155
            APE++    +Y   +D+WS+G+   E+    P
Sbjct: 182 MAPEVIMEGVYYDTKVDIWSLGITAYEIATGNP 214

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 84/163 (51%), Gaps = 10/163 (6%)

Query: 4   IREVKYLQEIRHVNVIELIDVYM-AQSNLNLVLEFLPADLEMIIKDNSIL-------FTQ 55
           + E+  + + RH N++  ++ Y+  + +L +V+E++       I +NS          ++
Sbjct: 627 VNEIMVMNDSRHENIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSE 686

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTS 115
             I   +  T +G+   H   I+HRD+K +N+LL    ++K+ DFG    +   +    +
Sbjct: 687 PQIAYIVRETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRAT 746

Query: 116 NVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELML-RIPYL 157
            V T ++ APE++   K Y   +D+WS+G++  E++    PYL
Sbjct: 747 MVGTPYWMAPEVV-KQKEYDAKVDVWSLGIMAIEMLEGEPPYL 788

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 80/163 (49%), Gaps = 9/163 (5%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLL 63
           E+  LQ++ H N++   D + ++    +V +        + I++     F + D    + 
Sbjct: 95  ELSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGK--FCEVDAVFIVK 152

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLL---APDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
             L+GV + H+  I+HRDLKP N+L    + D  L + DFG+A+ +    +++     + 
Sbjct: 153 QILQGVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSM 212

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRI-PYLPGKDD 162
            Y APE+L  + H     D+WS+GVI   L+    P+L    D
Sbjct: 213 GYVAPEVLTSSGH-GKPCDIWSIGVITYTLLCGYSPFLAESAD 254

>Scas_640.14*
          Length = 728

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 72/163 (44%), Gaps = 3/163 (1%)

Query: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60
           M   RE+  L+ + H N++ L +V      + +VLE+                 +A    
Sbjct: 91  MKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACR 150

Query: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
                + GV + H   I+HRDLK  NLLL     L + DFG      +  +++ ++  + 
Sbjct: 151 LFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSCGSP 210

Query: 121 WYRAPELLFGAKHYTG-AIDMWSVGVIFAELMLRIPYLPGKDD 162
            Y APEL+   + Y     D+WS G+I   ++    YLP  DD
Sbjct: 211 CYAAPELVITTEPYKARKADIWSCGIILYGMLA--GYLPWDDD 251

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 79/171 (46%), Gaps = 3/171 (1%)

Query: 18  VIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHCHRNFI 77
           ++ L   +   ++L LV +FL              FT+   K ++   +  + + H N I
Sbjct: 367 IVGLKFSFQTPTDLYLVTDFLSGGELFWHLQKEGRFTEERAKFYIAELVLALEYLHDNDI 426

Query: 78  LHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGA 137
           ++RDLKP N+LL  +G + L DFGL++     +D   +   T  Y APELL     YT  
Sbjct: 427 VYRDLKPENILLDANGNIALCDFGLSK--ADLKDRTNTFCGTTEYLAPELLLDETGYTKM 484

Query: 138 IDMWSVGVIFAELMLR-IPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTF 187
           +D WS+GV+  E+     P+    +      + F  +  P D   PE  +F
Sbjct: 485 VDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSF 535

>Scas_713.7
          Length = 983

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 79/151 (52%), Gaps = 5/151 (3%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLP-ADLEMIIKDNSILFTQADIKSWLLM 64
           E+  L+ + HVN+++        SNL ++LEF     L+ ++        + D K ++  
Sbjct: 71  EIDLLKNLNHVNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELDAKVYIRQ 130

Query: 65  TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRA 124
           TL G+ + H   ++HRD+K  NLLL  +  +KLADFG++  + +    L  ++   W  +
Sbjct: 131 TLNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGVSTKVSNTAMTLAGSL--HW-MS 187

Query: 125 PELLFGAKHYTGAIDMWSVGVIFAELMLRIP 155
           PE++ G +  +   D+WS+G    EL+   P
Sbjct: 188 PEII-GNRGASTLSDIWSLGATVVELVTGNP 217

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 73/142 (51%), Gaps = 9/142 (6%)

Query: 13  IRHVNVIELIDVYM-AQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLLMTLRGV 69
           ++H N+IE +D++  A+ +   V+E+        +II    + + +AD   +L   + GV
Sbjct: 391 LKHTNIIETLDLFQDAKGDYCEVMEYCSGGDLFTLIIAAGKLEYQEADC--FLKQLITGV 448

Query: 70  HHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLA---RNMGSPQDMLTSNVVTRW-YRAP 125
            + H   + HRDLKP NLLL  DG LK+ DFG +   R     +  L+  V     Y AP
Sbjct: 449 VYMHNMGVCHRDLKPENLLLTHDGTLKITDFGNSECFRMAWEKEIHLSGGVCGSGPYIAP 508

Query: 126 ELLFGAKHYTGAIDMWSVGVIF 147
           E     +    A+D+W+ GVI+
Sbjct: 509 EEYTQEEFDPRAVDIWACGVIY 530

>Scas_618.8
          Length = 427

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 103/230 (44%), Gaps = 33/230 (14%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLL 63
           E+  L+++ H N++E  + +     + +V +        + IIK     F++ D    L+
Sbjct: 76  ELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGR--FSEDDAVKILI 133

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLL---APDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
             L  V + H   I+HRDLKP NLL      D +L +ADFG+A+ +   + ++     + 
Sbjct: 134 QILSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSL 193

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180
            Y APE+L    H     D+WS+GVI   L      L G          + A    T + 
Sbjct: 194 GYVAPEVLTVDGH-GKPCDIWSIGVITYTL------LSG----------YAAFVAETVEG 236

Query: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
           + +  T G Y  ++F+ P         +   +++A N +   L +NP KR
Sbjct: 237 FLDECTSGDY-PVKFHKP--------YWDNISDDAKNFILKALDLNPQKR 277

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 79/171 (46%), Gaps = 3/171 (1%)

Query: 18  VIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHCHRNFI 77
           ++ L   +   ++L LV +F+              FT+   K ++   +  + + H N I
Sbjct: 388 IVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEDRAKFYIAELVLALEYLHDNDI 447

Query: 78  LHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGA 137
           ++RDLKP N+LL  +G + L DFGL++     +D   +   T  Y APELL     YT  
Sbjct: 448 VYRDLKPENILLDANGNIALCDFGLSK--ADLKDRTNTFCGTTEYLAPELLMDETGYTKM 505

Query: 138 IDMWSVGVIFAELMLR-IPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTF 187
           +D WS+GV+  E+     P+    +      + F  +  P D   PE  +F
Sbjct: 506 VDFWSLGVLIFEMCCGWSPFFASDNQKMYQKIAFGKVKFPRDVLSPEGRSF 556

>Scas_700.54
          Length = 698

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 112/244 (45%), Gaps = 41/244 (16%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPA-DLEMIIKDNSILFTQADIKSWLL 63
           RE++ LQ++ H  ++ L   Y  + +  +V+EF+   DL   +  +  +  +A  K    
Sbjct: 268 RELEVLQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAG-KEISR 326

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDG--QLKLADFGLARNMGSPQDMLTSNVVTRW 121
             L  V + H   I HRDLKP+N+L+  D    +K+ DFGLA+  G+   M T    T  
Sbjct: 327 QILEAVKYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTF-CGTLA 385

Query: 122 YRAPELLFGA-------KHYTGAIDMWSVG-VIFAELMLRIPYLPGKDDIDQIDVTFRAL 173
           Y APE++ G          Y+  +DMWS+G +++  L   +P+                 
Sbjct: 386 YVAPEVIGGKGETNEERNEYSSLVDMWSMGCLVYVILTGHLPF----------------S 429

Query: 174 GTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDP 233
           G+  ++ + +IS  G+Y     +  P ++         ++ A + +D +L +NP  R   
Sbjct: 430 GSTQEQLYKQISR-GSY-----HEGPLKD------FRISDEARSFIDSLLQVNPGNRLTA 477

Query: 234 IQCL 237
            + L
Sbjct: 478 ARAL 481

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 84/169 (49%), Gaps = 19/169 (11%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPA-DLEMIIKDNSILFTQADIKSWLL 63
           RE++ LQ++ H  ++ L   Y  ++N  +V+EF+   DL   +  +  +  +A  +    
Sbjct: 233 RELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAG-REISR 291

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ--LKLADFGLARNMGSPQDMLTSNVVTRW 121
             L  + + H   I HRDLKP+N+L+  D    +K+ DFGLA+  G+   M T    T  
Sbjct: 292 QILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTF-CGTLA 350

Query: 122 YRAPELLFGAKHYTGA-------------IDMWSVG-VIFAELMLRIPY 156
           Y APE++ G    TG              +DMWS+G ++F  L   +P+
Sbjct: 351 YVAPEVIGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF 399

>Kwal_23.5668
          Length = 1689

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 71/135 (52%), Gaps = 17/135 (12%)

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDM------------- 112
           L  + + H   I+HRDLKP N+ +     +K+ DFGLA+N+    D+             
Sbjct: 848 LDALSYIHSQGIIHRDLKPMNIFIDESRNIKIGDFGLAKNVHKSVDLLRMDSHISTASTE 907

Query: 113 -LTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQI-DVTF 170
            LTS + T  Y A E+L G+ +Y   IDM+S+G+IF E++    +  G + ++ I  +  
Sbjct: 908 DLTSAIGTALYVATEVLTGSGNYNEKIDMYSLGIIFFEMVY--SFNTGMERVNDIKKIRT 965

Query: 171 RALGTPTDKDWPEIS 185
            A+  P+D D  +++
Sbjct: 966 SAIDFPSDFDSSKLA 980

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 14/107 (13%)

Query: 5   REVKYLQEIRH--VNVIELIDVYMAQSN-------LNLVLEFLPADLEMIIKDNSILFTQ 55
           +E++ L  + H  VNV+    V     N       ++L+ E+ P  L   I D+      
Sbjct: 307 KELESLLRVSHENVNVLYAFSVERTGRNNTNYAWKISLLSEYSPLSLVGDIVDSVGFVNL 366

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGL 102
           A  + W+L  + G+   H++ I+H+++   ++ L+ D     ADFG+
Sbjct: 367 ATARGWILRLIEGLESLHKHGIVHKNITLQSVTLSKD-----ADFGV 408

>Kwal_33.13222
          Length = 148

 Score = 66.2 bits (160), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 71/122 (58%), Gaps = 3/122 (2%)

Query: 10  LQEIRHVNVIELIDVYMAQSNLNLVLEFL-PADLEMIIKDNSILFTQADIKSWLLMTLRG 68
           ++ + H NV+ L DV+   SNL +VLE++   +L  ++ +   L     ++ +  + + G
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIII-G 59

Query: 69  VHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELL 128
           + +CH   I+HRDLKP NLLL     +K+ADFG+A  + S   +L ++  +  Y APE++
Sbjct: 60  ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALESKDKLLETSCGSPHYAAPEIV 118

Query: 129 FG 130
            G
Sbjct: 119 SG 120

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 106/209 (50%), Gaps = 12/209 (5%)

Query: 12   EIRHVNVIELIDVYMAQSNLNLVLEFLPA-DLEMIIKDNSILFTQADIKSWLLMTLRGVH 70
            E +H  +  L   +  ++ +   +EF+   DL   +++  +   +A  K +    L  + 
Sbjct: 891  ETKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNRRLSVRRA--KFYAAEVLLSLK 948

Query: 71   HCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFG 130
            + H N +++RDLK  N+LL P+G +K+AD+GL ++     +  ++   T  + APE+L G
Sbjct: 949  YFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILKG 1008

Query: 131  AKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTFGTY 190
             + YT A+D W+ GV+  +++L      G+D+    D  F A+   TD+    I   G  
Sbjct: 1009 -QAYTKAVDWWTFGVLLYQMLLCQSPFSGEDE----DEVFNAI--LTDEPLYPIDMAG-- 1059

Query: 191  NKIQFYPPPSREEMRRRFIAATENALNLM 219
            + +Q +     ++  +R  A  ++AL +M
Sbjct: 1060 DIVQIFQGLLTKDPEKRLGAGPKDALEIM 1088

>Scas_703.5
          Length = 749

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 79/171 (46%), Gaps = 3/171 (1%)

Query: 18  VIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHCHRNFI 77
           ++ L   +   ++L LV +F+              FT+   K ++   +  + + H N I
Sbjct: 407 IVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEERAKFYIAELVLALEYLHDNDI 466

Query: 78  LHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGA 137
           ++RDLKP N+LL  +G + L DFGL++     +D   +   T  Y APELL     YT  
Sbjct: 467 VYRDLKPENILLDANGNIALCDFGLSK--ADLKDRTNTFCGTTEYLAPELLLDEAGYTKM 524

Query: 138 IDMWSVGVIFAELMLR-IPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTF 187
           +D WS+GV+  E+     P+    +      + F  +  P D   PE  +F
Sbjct: 525 VDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSF 575

>AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C
           (HAL5) - SH] (399738..401789) [2052 bp, 683 aa]
          Length = 683

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 75/149 (50%), Gaps = 13/149 (8%)

Query: 15  HVNVIELIDVYMAQSNLNLVLEFLPA-DLEMIIKDNSILFT-----QADIKSWLLMTLRG 68
           H N+++++D+  A      V EF P+ DL  ++  +S   +     +AD   ++   L G
Sbjct: 451 HPNILKVLDLMQAHDVFIEVFEFCPSGDLFSLLTRSSKTGSGLHPLEADC--FMKQLLNG 508

Query: 69  VHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQD----MLTSNVVTRWYRA 124
           V + H + + H DLKP N+L  P+G LKL DFG +    +  +      T  V +  Y A
Sbjct: 509 VRYMHDHGVAHCDLKPENILFTPNGTLKLCDFGSSSVFQTAWEKRVHFQTGAVGSEPYVA 568

Query: 125 PELLFGAKHY-TGAIDMWSVGVIFAELML 152
           PE     + Y T  +D WS G+I+  ++L
Sbjct: 569 PEEFIPKREYDTRLVDCWSCGIIYCTMVL 597

>CAGL0K01661g complement(146952..148400) some similarities with
           tr|Q12100 Saccharomyces cerevisiae YDL025c, hypothetical
           start
          Length = 482

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 8/146 (5%)

Query: 13  IRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHC 72
           + H NVIE  D+    ++L +V+E+ P D   ++  N++  +  +I  +      GV++ 
Sbjct: 237 LHHANVIETFDIIREGNSLLMVMEYAPYDFFDLVMTNTM--SPDEISCYFKQLCHGVNYL 294

Query: 73  HRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQD----MLTSNVVTRWYRAPELL 128
           H   I HRDLK +N ++  DG LKL DFG A     P +      T  V +  Y +PELL
Sbjct: 295 HAMGIAHRDLKLDNCVVTNDGILKLIDFGSAVIFQYPYERNIVKATGIVGSDPYLSPELL 354

Query: 129 FGAKHYTGAI-DMWSVGVIFAELMLR 153
               HY   + D+WS+ +I+  + L+
Sbjct: 355 -EMNHYDPRLADVWSLAIIYYCMTLK 379

>CAGL0H01199g 110610..115556 highly similar to sp|P15442
           Saccharomyces cerevisiae YDR283c GCN2 ser/thr protein
           kinase, start by similarity
          Length = 1648

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 61/114 (53%), Gaps = 18/114 (15%)

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNM---------------GSPQ 110
           L  + + H   I+HRDLKP N+ +     +K+ DFGLA+N+               GS  
Sbjct: 810 LEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLAKNVHKSLDALKLDSQMSTGSVD 869

Query: 111 DMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDID 164
           D LTS + T  Y A E+L G  +Y   IDM+S+G+IF E++   P+  G + ++
Sbjct: 870 D-LTSAIGTALYVATEVLTGKGNYNEKIDMYSLGIIFFEMIY--PFSTGMERVN 920

>Kwal_26.8709
          Length = 829

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 45/164 (27%), Positives = 74/164 (45%), Gaps = 3/164 (1%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLM 64
           RE+  L+ + H N++ L +V      + +VLE+                 +         
Sbjct: 94  REINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPACRLFAQ 153

Query: 65  TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRA 124
            + GV++ H   ++HRDLK  NLLL  +  L + DFG         +++ ++  +  Y A
Sbjct: 154 LISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSCGSPCYAA 213

Query: 125 PELLFGAKHYTG-AIDMWSVGVIFAELMLRIPYLPGKDDIDQID 167
           PEL+  A+ Y     D+WS GVI   ++    YLP  DD +  D
Sbjct: 214 PELVVTARPYEARKADVWSCGVILYAML--AGYLPWDDDPENPD 255

>Kwal_23.3590
          Length = 499

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 118/273 (43%), Gaps = 59/273 (21%)

Query: 6   EVKYLQEIRHVNVIELID-----VYMAQSNLNLVLEFLPADLEM---IIKDNSILFTQAD 57
           E K L  I+H N+++LID     V  AQ    LVLE + +D E+   I++   +   + +
Sbjct: 234 ETKILMSIQHKNIVKLIDRFVEPVSKAQIQTFLVLEKV-SDGELFDRIVRKTRL--REDE 290

Query: 58  IKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLA------PDGQ-------------LKLA 98
             +     L G+ + H   I+HRD+KP N+LL+       D Q             +K+A
Sbjct: 291 TNAIFKQILNGLRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIA 350

Query: 99  DFGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLP 158
           DFGLA+ +G  Q    +   T  Y APE+L     YT  +DMWS GV+    +   P   
Sbjct: 351 DFGLAKFIGEMQ-FTNTLCGTPSYVAPEVLTKTG-YTSRVDMWSAGVLLYVCLCGFPPFS 408

Query: 159 GKDDIDQIDVTFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNL 218
            +            L  P+ K+           K  FY P         +    ++ L+L
Sbjct: 409 EQ------------LAPPSMKEQI------LNGKFAFYSP--------YWDDIDDSCLHL 442

Query: 219 MDGMLTMNPHKRWDPIQCLTSEYFVE-LPVPTT 250
           +  +L +NP  R+D  + +   +F   +P P T
Sbjct: 443 ISNLLVVNPAYRFDVQKTINHPWFSNTIPEPDT 475

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 96/220 (43%), Gaps = 17/220 (7%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLM 64
           RE+  L+ + H N++ L +V      + +VL++                 +         
Sbjct: 97  RELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQ 156

Query: 65  TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRA 124
            + GVH+ H   + HRDLK  NLLL     L + DFG   N     D++ ++  +  Y A
Sbjct: 157 LISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFV-NEFHKNDLMRTSCGSPCYAA 215

Query: 125 PELLFGAKHYTG-AIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPE 183
           PEL+  +K Y+    D+WS GVI   ++    YLP  DD +           P  +D  +
Sbjct: 216 PELVVSSKPYSAQKADVWSCGVILYAMLAG--YLPWDDDPE----------NPEGEDIAK 263

Query: 184 ISTFGTYNKIQF---YPPPSREEMRRRFIAATENALNLMD 220
           +  + T+  ++F     P  R+ ++R  ++  E  L + D
Sbjct: 264 LYQYITHTSLKFPEYIKPIPRDLLKRILVSNPEVRLTVAD 303

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 82/159 (51%), Gaps = 13/159 (8%)

Query: 6    EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMT 65
            E++ ++ + H N+++   V + +  +N+ +EF        + ++  +  +   + + L  
Sbjct: 1308 EMRVMEILNHPNIVQYYGVEVHRDKVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQL 1367

Query: 66   LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR---NMGSPQDMLTSN------ 116
            L G+   H++ ++HRD+KP N+LL  +G +K  DFG A+     GS +  L +N      
Sbjct: 1368 LEGLACLHQSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGG 1427

Query: 117  ---VVTRWYRAPELLFGAKHYT-GAIDMWSVGVIFAELM 151
               + T  Y APE + G  H   G+ D+WS+G +  E++
Sbjct: 1428 KDMIGTPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMV 1466

>Scas_700.35
          Length = 439

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 67/127 (52%), Gaps = 17/127 (13%)

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAP 125
           LRG+ + H   I+HRD+KP N+LL  +G++KL DFG++    +   + T+   T +Y AP
Sbjct: 263 LRGLSYLHERKIIHRDIKPQNILLNEEGEVKLCDFGVSGE--AVNSLATTFTGTSFYMAP 320

Query: 126 ELLFGAKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRALG--------TP 176
           E + G   Y+   D+WS+G+   E+   R P+     D D+I  T   +         TP
Sbjct: 321 ERIQG-HPYSVTCDVWSLGLTILEVAQGRFPF-----DSDKITTTIAPIDLLMLILTFTP 374

Query: 177 TDKDWPE 183
             KD PE
Sbjct: 375 ELKDEPE 381

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 55/98 (56%), Gaps = 2/98 (2%)

Query: 53  FTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDM 112
           F++   K ++   +  + H H N I++RDLKP N+LL  +G + L DFGL++     +D 
Sbjct: 510 FSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSK--ADLKDR 567

Query: 113 LTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAEL 150
             +   T  Y APELL     YT  +D WS+GV+  E+
Sbjct: 568 TNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEM 605

>Kwal_14.2497
          Length = 418

 Score = 68.2 bits (165), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 71/144 (49%), Gaps = 11/144 (7%)

Query: 66  LRGVHHCH-RNFILHRDLKPNNLLLAPDGQLKLADFGLA----RNMGSPQDMLTSNVVTR 120
           +  + H H R  + HRD+KP NLLL   G LKLADFGLA    R  GS + +++    + 
Sbjct: 32  INAIDHLHNRCGVAHRDIKPENLLLDERGNLKLADFGLASQFKRKDGSKR-IMSDTRGSL 90

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGV-IFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDK 179
            Y APE+++   +Y  + D+WS GV +F  L    P+    DD  + D      G     
Sbjct: 91  PYMAPEIVYSKSYYADSTDIWSCGVLVFVLLTGETPWDSPSDD-SRFDDFLENSGGIASG 149

Query: 180 DWP--EISTFGTYNKIQFYPPPSR 201
            W   +IS      K+  +P P+R
Sbjct: 150 SWAKIDISQLNLLRKM-LHPDPAR 172

>YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine protein
           kinase involved in sensitivity to salt [1812 bp, 603 aa]
          Length = 603

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 108/242 (44%), Gaps = 37/242 (15%)

Query: 13  IRHVNVIELIDVYM-AQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLLMTLRGV 69
           + H N++  +D++  A+     V+E+        +++    + + +AD   +    +RGV
Sbjct: 380 LHHTNIVTTLDLFQDAKGEYCEVMEYCAGGDLFTLVVAAGKLEYMEADC--FFKQLIRGV 437

Query: 70  HHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR--NMGSPQDMLTSNVV--TRWYRAP 125
            + H   + HRDLKP NLLL  DG LK+ DFG +    M   +++  S  V  +  Y AP
Sbjct: 438 VYMHEMGVCHRDLKPENLLLTHDGVLKITDFGNSECFKMAWEKNIHLSGGVCGSSPYIAP 497

Query: 126 ELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEIS 185
           E     +     +D+W+ GVI+  + +R               T R L +  +KD P   
Sbjct: 498 EEYIKEEFDPRPVDIWACGVIY--MAMR---------------TGRQLWSSAEKDDPFYM 540

Query: 186 TF--GTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYFV 243
            +  G   K  + P  S +  R R         N++  ML   P++R +  Q L SE+  
Sbjct: 541 NYLKGRKEKGGYEPIESLKRARCR---------NVIYSMLDPVPYRRINGKQILNSEWGR 591

Query: 244 EL 245
           E+
Sbjct: 592 EI 593

>Scas_628.9
          Length = 621

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 71/142 (50%), Gaps = 9/142 (6%)

Query: 13  IRHVNVIELIDVYM-AQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLLMTLRGV 69
           + H+N++  +D++  A+     V+E+        +I+    + + +AD   +    +RGV
Sbjct: 395 LHHINIVTTLDLFQDAKGEYCEVMEYCSGGDLFSLIVSAGKLEYAEADC--FFKQLMRGV 452

Query: 70  HHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR--NMGSPQDMLTSNVV--TRWYRAP 125
            + H   + HRDLKP NLLL  DG LK+ DFG +    M    D+  S  V  +  Y AP
Sbjct: 453 VYMHDMGVSHRDLKPENLLLTSDGVLKITDFGNSECFKMAWEDDIHLSGGVCGSSPYIAP 512

Query: 126 ELLFGAKHYTGAIDMWSVGVIF 147
           E     +     +D+W+ GVI+
Sbjct: 513 EEYIKEEFDPRCVDIWACGVIY 534

>AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH]
           complement(196774..201870) [5097 bp, 1698 aa]
          Length = 1698

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 15/101 (14%)

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDM------------- 112
           L  + + H   I+HRDLKP N+ +     +K+ DFGLA+N+    D+             
Sbjct: 859 LEALSYIHSQGIIHRDLKPMNIFIDESRNIKIGDFGLAKNVHKSADILRIEGAFGSNVSA 918

Query: 113 --LTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELM 151
             LTS + T  Y A E+L G  +Y   IDM+S+G+IF E++
Sbjct: 919 DDLTSAIGTALYVASEVLTGNGNYNEKIDMYSLGIIFFEMV 959

>KLLA0C03938g complement(358851..360632) some similarities with
           sgd|S0002183 Saccharomyces cerevisiae YDL025c,
           hypothetical start
          Length = 593

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 99/222 (44%), Gaps = 26/222 (11%)

Query: 13  IRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHC 72
           + H NVIE +D+     +  +V+E+   D   ++   S L  + +I  +      GV + 
Sbjct: 325 LHHQNVIETLDMLQEGEHFLVVMEYCQYDFFTLVM--SDLMGKHEIACYFKQICNGVAYL 382

Query: 73  HRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP-QDMLTSN---VVTRWYRAPELL 128
           H   + HRDLK +N ++   G LKL DFG A       +D +      V +  Y APELL
Sbjct: 383 HSQGLAHRDLKLDNCVVNAQGILKLIDFGSATIFHYKYEDKIVKAKGIVGSDPYLAPELL 442

Query: 129 FGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTFG 188
               +    +D+WS+ V+F  + LR    P K   +++ V+F+      D +     T G
Sbjct: 443 VSQYYDPRPVDVWSIAVMFYCMTLR--RFPWKKPSEEV-VSFKLFAQNPDDE--NDHTKG 497

Query: 189 TYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKR 230
            Y  ++  P  SR                L+  ML ++PHKR
Sbjct: 498 PYKILKLLPRHSRP---------------LIGRMLELSPHKR 524

>CAGL0J04972g 472984..474003 some similarities with tr|Q12100
           Saccharomyces cerevisiae YDL025c, hypothetical start
          Length = 339

 Score = 67.8 bits (164), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 79/152 (51%), Gaps = 17/152 (11%)

Query: 4   IREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLL 63
           +R+ KY+     VNV +L D+    S   + +EFLP  L  ++  + +  +  + K + L
Sbjct: 100 LRKSKYV-----VNVYDL-DI----SKRTIKMEFLPFSLSRVLSMD-LSPSLQEKKCYFL 148

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDG-QLKLADFGLARNMGSPQDMLTSN---VVT 119
                V + H   I+HRDLK  N++L  D  Q+KL DFG+A N   PQ + T+      T
Sbjct: 149 QICEAVQYLHSRGIVHRDLKLENIMLCADACQIKLIDFGVAVNRQDPQSLTTACKGMCGT 208

Query: 120 RWYRAPELLFGAKHYTGA-IDMWSVGVIFAEL 150
               APE+L G+  Y G   D WSVG+I  ++
Sbjct: 209 EALMAPEVL-GSISYVGEYADCWSVGIIMFQI 239

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 74/151 (49%), Gaps = 8/151 (5%)

Query: 6   EVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKSWLL 63
           E+  LQ++ H N++   D + ++    +V +        + I+      FT+ D    ++
Sbjct: 96  ELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGK--FTEVDAVEIIV 153

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ---LKLADFGLARNMGSPQDMLTSNVVTR 120
             L  V + H   ++HRDLKP N+L     +   L +ADFG+A+ +   +D++     + 
Sbjct: 154 QILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSL 213

Query: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELM 151
            Y APE+L    H     D+WS+GVI   L+
Sbjct: 214 GYVAPEVLTQDGH-GKPCDIWSIGVITYTLL 243

>Kwal_33.13831
          Length = 700

 Score = 68.2 bits (165), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 72/147 (48%), Gaps = 11/147 (7%)

Query: 15  HVNVIELIDVYMAQSNLNLVLEFLPA-DLEMIIK---DNSILFTQADIKSWLLMTLRGVH 70
           H N+++++D+         VLEF P+ DL  ++     N +   +AD   ++   L GV 
Sbjct: 467 HPNILKMLDLMQTHDGFIEVLEFCPSGDLYSLLSRTSKNGLHPLEADC--FMKQLLHGVK 524

Query: 71  HCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQD----MLTSNVVTRWYRAPE 126
           + H + I H DLKP N+L  P G LK+ DFG +    +  +      T  V +  Y APE
Sbjct: 525 YMHDHGIAHCDLKPENILFGPQGVLKICDFGTSCVFQTAWEKQVHFQTGAVGSEPYVAPE 584

Query: 127 LLFGAKHYTGA-IDMWSVGVIFAELML 152
                + Y    +D WS GVI+  ++L
Sbjct: 585 EFIAEREYDPRLVDSWSCGVIYCTMVL 611

>KLLA0C10802g complement(926916..931934) similar to sp|P15442
           Saccharomyces cerevisiae YDR283c GCN2 ser/thr protein
           kinase, start by similarity
          Length = 1672

 Score = 68.6 bits (166), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 70/141 (49%), Gaps = 27/141 (19%)

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDM------------- 112
           L  + + H   I+HRDLKP N+ +     +K+ DFGLA+N+   QD              
Sbjct: 832 LEALSYIHSQGIIHRDLKPMNIFIDESRNIKIGDFGLAKNVQISQDTLRRDSFTSAGSSG 891

Query: 113 -LTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDID------Q 165
            LTS + T  Y A E++    +Y   +DM+S+G+IF E++   P+  G + ++       
Sbjct: 892 DLTSAIGTALYVASEIITSHGNYNEKVDMYSLGIIFFEMIY--PFDTGMERVNVIKKLRN 949

Query: 166 IDVTFRALGTPTDKDWPEIST 186
           IDV F     P+D D  ++ T
Sbjct: 950 IDVEF-----PSDFDDKKLHT 965

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 47/109 (43%), Gaps = 22/109 (20%)

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFG--LARNMGSPQDML 113
           A  + WLL  L G+ + H++ I HR +  + + L+ D      DFG  + + +       
Sbjct: 367 ATARGWLLRLLEGLENLHKHGISHRLIDMHTVQLSKD-----TDFGTTIPKLIHPSYGYT 421

Query: 114 TSNVVTRW--------------YRAPELL-FGAKHYTGAIDMWSVGVIF 147
             ++VTR+              + APEL+ F         D+W + V+F
Sbjct: 422 ILSMVTRYPSKNGVKLELPNIKWIAPELVKFKGSKPQRKTDIWQLAVLF 470

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 68.2 bits (165), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 43/145 (29%), Positives = 75/145 (51%), Gaps = 6/145 (4%)

Query: 13  IRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHC 72
           +RH N+I  I++    + +  V+E+   DL  I+  N + + +  I       L GV + 
Sbjct: 480 LRHPNIISTIEIVYENNRIFQVMEYCDYDLFAIVMSNKMSYEE--ICCCFKQILTGVEYL 537

Query: 73  HRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQD---MLTSNVV-TRWYRAPELL 128
           H   + HRD+K +N ++   G +KL DFG A     P     + +S +V +  Y APE+ 
Sbjct: 538 HSIGLAHRDMKLDNCVINNQGIVKLIDFGAAEVFSYPHSKTLIESSGIVGSDPYLAPEVC 597

Query: 129 FGAKHYTGAIDMWSVGVIFAELMLR 153
              K+    +D+WSV ++FA ++L+
Sbjct: 598 IFTKYDPRPVDIWSVAILFACMVLK 622

>Scas_718.90
          Length = 647

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 106/239 (44%), Gaps = 30/239 (12%)

Query: 13  IRHVNVIELIDVYMAQSNLNLVLEFLPADL-EMIIKDNSILFTQADIKSWLLMTLRGVHH 71
           + H N+IE  D+        +V+E+ P D   +++ D   L T  ++  +      GV++
Sbjct: 370 LHHQNIIETFDMLREGETFLVVMEYAPYDFFNLVMAD---LMTTKEVSCYFKQLCNGVNY 426

Query: 72  CHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQD----MLTSNVVTRWYRAPEL 127
            H   I HRDLK +N +++ +G LKL DFG A     P +         V +  Y APEL
Sbjct: 427 LHDMGIAHRDLKLDNCVVSHNGILKLIDFGSAVIFQYPYENKIVKAQGIVGSDPYLAPEL 486

Query: 128 LFGAKHYTGAIDMWSVGVIFAELML-RIPYLPGKDDIDQIDVTFRALGTPTDKDWPEIST 186
           L  + +    +D+WS+ +I+  ++L R P+   +   +    +FR      D D  +   
Sbjct: 487 LNTSTYDPRPVDVWSIAIIYYCMILRRFPWKAPRKSFN----SFRLFC--EDPDDEDDVA 540

Query: 187 FGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSEYFVEL 245
            G Y  ++  P  SR                L+  ML ++P KR    + +  E+F  +
Sbjct: 541 KGPYRLLRLLPSKSRP---------------LIAKMLLLDPKKRILMNEVVKDEWFASI 584

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 85/158 (53%), Gaps = 8/158 (5%)

Query: 3   AIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPAD--LEMIIKDNSILFTQADIKS 60
           AIRE    Q   H ++  L ++    ++  ++ E++     L+ II+  S+    A  + 
Sbjct: 179 AIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYIIQHGSLREHHA--RK 236

Query: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120
           +       + + H N I+HRDLK  N++++  G++K+ DFGL+ N+   +  L +   + 
Sbjct: 237 FARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLS-NVYDTRKQLHTFCGSL 295

Query: 121 WYRAPELLFGAKHYTG-AIDMWSVGVIFAELML-RIPY 156
           ++ APELL  A  YTG  +D+WS GV+   L+  ++P+
Sbjct: 296 YFAAPELL-KAHPYTGPEVDVWSFGVVLYVLVCGKVPF 332

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 77/168 (45%), Gaps = 21/168 (12%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPA-------DLEMIIKDNSI--LFTQ 55
           RE+  L+ + H N+++L +V      + +VLE+            +  +K+N    LF+Q
Sbjct: 116 REINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQRKRRLKENHACRLFSQ 175

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTS 115
                     +  VH+ H   ++HRDLK  NLLL  +  L + DFG          M+ +
Sbjct: 176 ---------LISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNEFLRQNGMMKT 226

Query: 116 NVVTRWYRAPELLFGAKHYTG-AIDMWSVGVIFAELMLRIPYLPGKDD 162
           +  +  Y APEL+   + Y     D WS G+I   ++    YLP  DD
Sbjct: 227 SCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAML--AGYLPWDDD 272

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 88/168 (52%), Gaps = 11/168 (6%)

Query: 4   IREVKYLQEIRH-VNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWL 62
           +REVK      + VNV+++ID  ++   L + +E L    ++  K    +   +++  + 
Sbjct: 63  LREVKLHSRCSNFVNVLKVIDCNLSDPFLWIAME-LAEGGDLFDKIEPDIGVDSEVAQFY 121

Query: 63  LMTL-RGVHHCHRNF-ILHRDLKPNNLLLAPDGQLKLADFGLA----RNMGSPQDMLTSN 116
              L + + + H    + HRD+KP N+LL  DG LKLADFGLA    R  GS + +    
Sbjct: 122 YKQLIKAISYLHDTCGVAHRDIKPENILLDKDGNLKLADFGLASLFKRKDGSKR-ISRDQ 180

Query: 117 VVTRWYRAPELLFGAKHYTGAIDMWSVGV-IFAELMLRIPY-LPGKDD 162
             +  Y APE+++   +Y    D+WS+GV +F  L    P+ LP +DD
Sbjct: 181 RGSLPYMAPEIIYCDGYYADMTDIWSIGVLLFVLLTGETPWELPHEDD 228

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 44/149 (29%), Positives = 71/149 (47%), Gaps = 3/149 (2%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPA-DLEMIIKDNSILFTQADIKSWLL 63
           RE+  L+ + H N++ L +V      + +VL +    +    I+    L   A  + +  
Sbjct: 107 REINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQ 166

Query: 64  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYR 123
           + + GVH+ H   + HRDLK  NLLL     L + DFG      S  D++ ++  +  Y 
Sbjct: 167 L-ISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYA 225

Query: 124 APELLFGAKHYTG-AIDMWSVGVIFAELM 151
           APEL+   K Y     D+WS GVI   ++
Sbjct: 226 APELVVTTKAYEARKADVWSCGVILYAML 254

>Kwal_47.16761
          Length = 744

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 78/171 (45%), Gaps = 3/171 (1%)

Query: 18  VIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHCHRNFI 77
           ++ L   +   ++L LV +F+              F +   + ++   +  + + H N I
Sbjct: 397 IVGLKFSFQTPADLYLVTDFMSGGELFWHLQKEGRFAEDRARFYIAELVLALEYLHENDI 456

Query: 78  LHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFGAKHYTGA 137
           ++RDLKP N+LL  +G + L DFGL++     +D   +   T  Y APELL     YT  
Sbjct: 457 VYRDLKPENILLDANGNIALCDFGLSK--ADLKDRTNTFCGTTEYLAPELLLDESGYTKM 514

Query: 138 IDMWSVGVIFAELMLR-IPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTF 187
           +D WS+GV+  E+     P+    +      + F  +  P D   PE  +F
Sbjct: 515 VDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSF 565

>CAGL0F03707g complement(359839..361665) similar to sp|Q08732
           Saccharomyces cerevisiae YOR267c, start by similarity
          Length = 608

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 91/209 (43%), Gaps = 37/209 (17%)

Query: 3   AIREVKYLQEIRHVNVIELIDVYMAQSNLNL--VLEFLPADLEMIIKDNSILFTQADIKS 60
            I E      + HVNVIE +D++          V+E+ P D   ++   S   ++ ++  
Sbjct: 227 CIAEFTIGSTLHHVNVIETMDIFSDAKKQRYFEVMEYCPVDFFAVVM--SGKMSRGEVNC 284

Query: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP---QDMLTSNV 117
            L     GV + H   + HRDLK +N ++  +G LKL DFG A     P   +  L S +
Sbjct: 285 CLKQLACGVKYLHSMGLAHRDLKLDNCVMTENGILKLIDFGSAVVFRYPFEQEVTLASGI 344

Query: 118 V-TRWYRAPELLFGAKHYTG------------------------AIDMWSVGVIFAELML 152
           V +  Y APE+L       G                        A+D+WS+G+IF+ +ML
Sbjct: 345 VGSDPYLAPEVLGKISRADGDESEEPHQTIKIDKKTGLSLYDPQAVDVWSIGIIFSCMML 404

Query: 153 -RIPYLPGKDDIDQIDVTFRALGTPTDKD 180
            R P+   K+     D  F+    P D++
Sbjct: 405 KRFPWKAPKES----DPNFKLYNMPEDEE 429

>Kwal_23.5290
          Length = 819

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 85/163 (52%), Gaps = 10/163 (6%)

Query: 4   IREVKYLQEIRHVNVIELIDVYM-AQSNLNLVLEFLPADLEMIIKDNSIL-------FTQ 55
           + E+  +++ +H N++  ++ Y+  + +L +V+E++       + +NS          T+
Sbjct: 585 VNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLTE 644

Query: 56  ADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTS 115
             I   +  T +G+   H   I+HRD+K +N+LL    ++K+ DFG    +   +    +
Sbjct: 645 PQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNRARVKITDFGFCAKLTDKRSKRAT 704

Query: 116 NVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELML-RIPYL 157
            V T ++ APE++   + Y   +D+WS+G++  E++    PYL
Sbjct: 705 MVGTPYWMAPEVV-KQREYDEKVDVWSLGIMTIEMLEGEPPYL 746

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 102/244 (41%), Gaps = 58/244 (23%)

Query: 10  LQEIRHVNVIELIDVYMAQSNLNLVLEFLPA-------DLEMIIKDNSILFTQADIKSWL 62
           L ++ H N+++L   +   S L L+L+++P             ++++++ F  A+I   L
Sbjct: 224 LSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHLKEHGTLEEDTVAFYAAEISCAL 283

Query: 63  LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR--------------NMGS 108
                     H   +++RDLKP N LL  +G L L DFGL++              N G 
Sbjct: 284 KF-------LHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSASNASQEDLGAGNEGE 336

Query: 109 PQDMLTSNVVTRWYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDV 168
             + L S + T  Y APE+L G + YT   D +S+G +  +++   P   G +       
Sbjct: 337 DVNELHSIIGTPEYCAPEILLG-QPYTANCDWYSLGCLLYDMLTGKPPYTGANH------ 389

Query: 169 TFRALGTPTDKDWPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPH 228
              A     DK  P         KI +Y               ++   +++  +L  +P 
Sbjct: 390 KVIANKIKNDKQGP---------KIPYY--------------LSDGMKDVLGALLKSDPK 426

Query: 229 KRWD 232
           KRWD
Sbjct: 427 KRWD 430

>Kwal_0.307
          Length = 490

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 76/142 (53%), Gaps = 9/142 (6%)

Query: 13  IRHVNVIELIDVYM-AQSNLNLVLEF-LPADL-EMIIKDNSILFTQADIKSWLLMTLRGV 69
           ++H N+I  +D++  A+ +   V+E+    DL  +II    + + +AD   +    +RGV
Sbjct: 328 LKHTNIIMTLDLFQDAKGDYCQVMEYCFGGDLFTLIIAAGKLEYMEADC--FFKQLIRGV 385

Query: 70  HHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLAR--NMGSPQDMLTSNVV--TRWYRAP 125
            + H   + HRDLKP NLLL+ +G LK+ DFG +    M   +D+  S  V  +  Y AP
Sbjct: 386 VYMHDMGVCHRDLKPENLLLSSNGTLKITDFGNSECFRMAWEKDIHLSGGVCGSSPYIAP 445

Query: 126 ELLFGAKHYTGAIDMWSVGVIF 147
           E     +     +D+W+ GVI+
Sbjct: 446 EEYVHEEFDPRPVDIWACGVIY 467

>Kwal_14.1273
          Length = 415

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 69/142 (48%), Gaps = 8/142 (5%)

Query: 15  HVNVIELIDVYMAQSNLNLVLEFLP-ADLEMII---KDNSILFTQADIKSWLLMTLRGVH 70
           H NV  L+D Y  ++    V+E+    DL  +I   K +S      ++   +L     + 
Sbjct: 63  HPNVCALLDFYERETCYVFVMEYAARGDLYDVIRGWKRHSAERVPVELARVVLQLCSAIE 122

Query: 71  HCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAPELLFG 130
           + H   I HRD+KP N+LL   G +KLAD+GL+  M    D   + + T  Y APE  + 
Sbjct: 123 YAHSCGIAHRDIKPENVLLDSAGNVKLADWGLSTRMRVSCD---TRIGTEKYLAPE-AYA 178

Query: 131 AKHYTGAIDMWSVGVIFAELML 152
           + H T   D WS+GV    +M 
Sbjct: 179 SPHDTFLADFWSLGVTLLFVMF 200

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 70/159 (44%), Gaps = 3/159 (1%)

Query: 5   REVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLM 64
           RE+  L+ + H NV+ L +V      + +VLE+                 ++        
Sbjct: 102 REINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQ 161

Query: 65  TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRA 124
            + GV + H   ++HRDLK  NLLL  +  L + DFG         + + ++  +  Y A
Sbjct: 162 LISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPCYAA 221

Query: 125 PELLFGAKHYTG-AIDMWSVGVIFAELMLRIPYLPGKDD 162
           PEL+   + Y     D+WS G+I   ++    YLP  DD
Sbjct: 222 PELVISTRPYVARKADVWSCGIILYAML--AGYLPWDDD 258

>YNL183C (NPR1) [4417] chr14 complement(293137..295509)
           Serine/threonine protein kinase involved in regulating
           transport systems for nitrogen source nutrients [2373
           bp, 790 aa]
          Length = 790

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 44/145 (30%), Positives = 76/145 (52%), Gaps = 6/145 (4%)

Query: 13  IRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHC 72
           + H N+IE I++      +  V+E+   DL  I+  N + + +  I       L GV + 
Sbjct: 495 LNHPNIIETIEIVYENDRILQVMEYCEYDLFAIVMSNKMSYEE--ICCCFKQILTGVQYL 552

Query: 73  HRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP--QDMLTSN--VVTRWYRAPELL 128
           H   + HRDLK +N ++   G +KL DFG A     P  ++++ ++  V +  Y APE+ 
Sbjct: 553 HSIGLAHRDLKLDNCVINEKGIVKLIDFGAAVVFSYPFSKNLVEASGIVGSDPYLAPEVC 612

Query: 129 FGAKHYTGAIDMWSVGVIFAELMLR 153
             AK+    +D+WS  +IFA ++L+
Sbjct: 613 IFAKYDPRPVDIWSSAIIFACMILK 637

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 69/122 (56%), Gaps = 7/122 (5%)

Query: 66  LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTRWYRAP 125
           LRG+ + H+  I+HRD+KP N+LL   GQ+KL DFG++    +   + T+   T +Y AP
Sbjct: 349 LRGLSYLHQRKIIHRDIKPQNILLNEAGQVKLCDFGVSGE--AVNSLATTFTGTSYYMAP 406

Query: 126 ELLFGAKHYTGAIDMWSVGVIFAEL-MLRIPYLPGK--DDIDQIDVTFRALG-TPTDKDW 181
           E + G + Y+   D+WS+G+   E+     P+  GK   ++  I++    L  TP  KD 
Sbjct: 407 ERIQG-QPYSVTSDVWSLGLTLLEVAQAHFPFDSGKFAANMPPIELLMLILTFTPQLKDE 465

Query: 182 PE 183
           PE
Sbjct: 466 PE 467

>CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase,
           hypothetical start
          Length = 728

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 75/145 (51%), Gaps = 6/145 (4%)

Query: 13  IRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKSWLLMTLRGVHHC 72
           + H N+IE +++    + +  V+E+   DL  I+  N + + +  I       L GV + 
Sbjct: 431 LNHPNIIETVEIVYEDNRIFQVMEYCDYDLFAIVMSNKMSYEE--ICCCFKQILCGVQYL 488

Query: 73  HRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP--QDMLTSN--VVTRWYRAPELL 128
           H   + HRDLK +N ++   G +KL DFG A     P  + ++ ++  V +  Y APE+ 
Sbjct: 489 HSIGLAHRDLKLDNCVINSKGIVKLIDFGAAVVFSYPFSKTLVEASGIVGSDPYLAPEVC 548

Query: 129 FGAKHYTGAIDMWSVGVIFAELMLR 153
              K+    +D+WS  +IFA ++L+
Sbjct: 549 IFTKYDPRPVDIWSTAIIFACMILK 573

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.139    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,764,187
Number of extensions: 370133
Number of successful extensions: 2172
Number of sequences better than 10.0: 629
Number of HSP's gapped: 1473
Number of HSP's successfully gapped: 660
Length of query: 257
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 158
Effective length of database: 13,168,927
Effective search space: 2080690466
Effective search space used: 2080690466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 60 (27.7 bits)