Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.346466865933710.0
YGL144C (ROG1)68567419400.0
ADL285C64465619080.0
Scas_669.1469064218210.0
KLLA0E14872g67765617990.0
CAGL0E04950g67364017320.0
YDL109C64758714270.0
Scas_613.1462857714040.0
CAGL0H10340g5926468871e-111
YDR444W6876928451e-103
AER322C6366358201e-100
CAGL0M10043g6586607786e-94
KLLA0B01375g6406267723e-93
Kwal_47.184826236437494e-90
Scas_717.506584155881e-66
KLLA0F16423g4592111782e-13
CAGL0L10318g4572261763e-13
AFR386C5041981764e-13
YOR059C4502301738e-13
Kwal_55.217034412251711e-12
Kwal_27.101022582021608e-12
ADR202C4432141577e-11
KLLA0F16709g5311981587e-11
Sklu_2393.45462041498e-10
Sklu_2232.44452201489e-10
Scas_698.394712281434e-09
Kwal_47.1848057354730.91
CAGL0J10736g38642730.92
KLLA0B01397g57279730.95
CAGL0H09218g27952702.1
YNR008W (LRO1)66182702.2
Kwal_27.1008438562683.9
CAGL0I05786g68074675.6
YEL046C (GLY1)38762666.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3464
         (659 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3464                                                         1303   0.0  
YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of...   751   0.0  
ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH] (2...   739   0.0  
Scas_669.14                                                           706   0.0  
KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces...   697   0.0  
CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces c...   671   0.0  
YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein ...   554   0.0  
Scas_613.14                                                           545   0.0  
CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces...   346   e-111
YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unkn...   330   e-103
AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)...   320   e-100
CAGL0M10043g complement(999113..1001089) similar to tr|Q04093 Sa...   304   6e-94
KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyce...   301   3e-93
Kwal_47.18482                                                         293   4e-90
Scas_717.50                                                           231   1e-66
KLLA0F16423g complement(1516717..1518096) similar to sgd|S000558...    73   2e-13
CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448 S...    72   3e-13
AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp...    72   4e-13
YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protei...    71   8e-13
Kwal_55.21703                                                          70   1e-12
Kwal_27.10102                                                          66   8e-12
ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)...    65   7e-11
KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF134...    65   7e-11
Sklu_2393.4 , Contig c2393 3530-5170 reverse complement                62   8e-10
Sklu_2232.4 YOR059C, Contig c2232 3289-4626                            62   9e-10
Scas_698.39                                                            60   4e-09
Kwal_47.18480                                                          33   0.91 
CAGL0J10736g 1046008..1047168 similar to sp|P38796 Saccharomyces...    33   0.92 
KLLA0B01397g complement(112771..114489) similar to ca|CA5942|CaD...    33   0.95 
CAGL0H09218g complement(904209..905048) similar to sp|P53078 Sac...    32   2.1  
YNR008W (LRO1) [4591] chr14 (640395..642380) Diacylglycerol acyl...    32   2.2  
Kwal_27.10084                                                          31   3.9  
CAGL0I05786g complement(547982..550024) some similarities with s...    30   5.6  
YEL046C (GLY1) [1382] chr5 complement(67629..68792) Threonine al...    30   6.3  

>Kwal_23.3464
          Length = 668

 Score = 1303 bits (3371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/659 (95%), Positives = 632/659 (95%)

Query: 1   MTKDGVVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAY 60
           MTKDGVVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAY
Sbjct: 1   MTKDGVVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAY 60

Query: 61  LMGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDV 120
           LMGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDV
Sbjct: 61  LMGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDV 120

Query: 121 VSQIIFTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLPVQLS 180
           VSQIIFTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLPVQLS
Sbjct: 121 VSQIIFTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLPVQLS 180

Query: 181 THTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGIN 240
           THTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGIN
Sbjct: 181 THTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGIN 240

Query: 241 YLGTRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITL 300
           YLGTRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITL
Sbjct: 241 YLGTRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITL 300

Query: 301 ATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDXXXXXXXXXXXXXXXVLRMFK 360
           ATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKD               VLRMFK
Sbjct: 301 ATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDGKPLLYLLPGKPTKTVLRMFK 360

Query: 361 RRTIYANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSSNTSSDFISRNFLSPI 420
           RRTIYANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSSNTSSDFISRNFLSPI
Sbjct: 361 RRTIYANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSSNTSSDFISRNFLSPI 420

Query: 421 SKAISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKIYC 480
           SKAISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKIYC
Sbjct: 421 SKAISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKIYC 480

Query: 481 DQEVPPRESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEIARRWHEGISWRKVVVGLKP 540
           DQEVPPRESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEIARRWHEGISWRKVVVGLKP
Sbjct: 481 DQEVPPRESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEIARRWHEGISWRKVVVGLKP 540

Query: 541 DAHNNIIVRRRFSNAYGWPVVDHLTQNHFNXXXXXXXXXXXXVTNSVKSDQTSPEDHKED 600
           DAHNNIIVRRRFSNAYGWPVVDHLTQNHFN            VTNSVKSDQTSPEDHKED
Sbjct: 541 DAHNNIIVRRRFSNAYGWPVVDHLTQNHFNSMDDESEEMDSMVTNSVKSDQTSPEDHKED 600

Query: 601 RSWMFDNGKETMFDVGPTGMISTVGEILDSMAKNSFMIHRSNGAPSTQGPSFEQDNLFR 659
           RSWMFDNGKETMFDVGPTGMISTVGEILDSMAKNSFMIHRSNGAPSTQGPSFEQDNLFR
Sbjct: 601 RSWMFDNGKETMFDVGPTGMISTVGEILDSMAKNSFMIHRSNGAPSTQGPSFEQDNLFR 659

>YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Ydl109p [2058 bp, 685 aa]
          Length = 685

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/674 (54%), Positives = 478/674 (70%), Gaps = 25/674 (3%)

Query: 6   VVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPY 65
           +++H KSSVKVGE+ERY+I+Y LYD +E +P DLNLNSLWLKVRN+   ++RAAYLMGP+
Sbjct: 9   ILFHYKSSVKVGELERYVITYHLYDGEE-IPPDLNLNSLWLKVRNMNPLSYRAAYLMGPF 67

Query: 66  LLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDVVSQII 125
           +LYCDV+ + YHHSQ++  S D P FEP +Q QQDF+ ELS+HN+++ YVW+ DV+SQI+
Sbjct: 68  MLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVMSQIL 127

Query: 126 FTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLPVQLSTHTHQ 185
           FTT T V +EV++GTS++ +    +     GS   KL V RLT+LDLWNLPVQ++T   +
Sbjct: 128 FTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQITT-PQK 186

Query: 186 KEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYLGTR 245
           K+HLV+LTHGLHSNV  D+ Y+ EQI K QK YP EQIVVKG+ GNVC+TEKG+ YLGTR
Sbjct: 187 KKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYLGTR 246

Query: 246 LAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITLATPLL 305
           LAEYI+++LY E ++KISF+GHSLGGL+Q FAIAYI+  YPWFF+ V+PINFITLA+PLL
Sbjct: 247 LAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITLASPLL 306

Query: 306 GIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDXXXXXXXXXXXXXXXVLRMFKRRTIY 365
           GIVTDNPAY+ +LLSFG++GKTGQDLGL    +                +LR FKRRT+Y
Sbjct: 307 GIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKPLLYLLSGLPLIEILRRFKRRTVY 366

Query: 366 ANAVNDGIVPLYSASLLFLDYEDVLGQLK------TKPELRERLSSNTSSDFISRNFLSP 419
           ANA+NDGIVPLY+ASLLFLDY D+L QL+       K  L    S+  + DF ++ F+SP
Sbjct: 367 ANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQDFFNKTFISP 426

Query: 420 ISKAISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKIY 479
           ++K +S  APQKFP +   +IPKVS  ESA+S+L+PPLPE+ YIM+P SR+ +IIHDKIY
Sbjct: 427 LTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPVIIHDKIY 486

Query: 480 CDQEVPPRESQSEKELLESNNTLLKAF--TRSSGKDNRRLEEEIARRWHEGISWRKVVVG 537
            + ++P  E   E       N LL+AF   +      R LEE IARRWHEG++WRKVVV 
Sbjct: 487 NEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGMAWRKVVVA 546

Query: 538 LKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHFNXXXXXXXXXXXXV--TNSVKSDQTSPE 595
           LKPDAHNNIIVRR+F+NAYGWPV+DHL   HFN            +  T  V+  Q+  E
Sbjct: 547 LKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFNGDDDDDNDENDDINSTQVVEPIQSVTE 606

Query: 596 DHKEDR---------SWMFDNGKETMFDVGPTGMISTVGEILDSMAKNSF--MIHRSNGA 644
             K+ R          W+       +FD GPTGMISTVGEI++++AK  F  +I R N +
Sbjct: 607 GKKKYRKAENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGFSAVIDRRNAS 666

Query: 645 --PSTQGPSFEQDN 656
             P+ +   FE+ N
Sbjct: 667 EDPNDEVLRFEEMN 680

>ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH]
           (201714..203648) [1935 bp, 644 aa]
          Length = 644

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/656 (54%), Positives = 472/656 (71%), Gaps = 27/656 (4%)

Query: 6   VVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPY 65
           V+YH +SSV++GE+ERY+I+Y LYD++E LP  + L+SLWLKV+N+ S T+RAAYLMGPY
Sbjct: 9   VLYHYRSSVRIGEVERYVITYDLYDEEE-LPERIQLSSLWLKVKNVSSLTYRAAYLMGPY 67

Query: 66  LLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDVVSQII 125
           +LYCD+R  DYHHSQ+LF SAD P FEP +QPQ +F+ ELSLH L+K YVW++DVVSQII
Sbjct: 68  MLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLLDVVSQII 127

Query: 126 FTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLPVQLSTHTHQ 185
           FTT + V FEV++ +++  L  ++  +P +GS   +L V R T+LDLWNLP Q+     +
Sbjct: 128 FTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQQVFDDYTK 187

Query: 186 KEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYLGTR 245
            EHLV+LTHGLHSNV ADM YLKE IE+CQ+YYP E IVVKGF  NVCKTEKGI YLG R
Sbjct: 188 PEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYLGGR 247

Query: 246 LAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITLATPLL 305
           L EYIVK+LY+ER+K+ISFIGHSLGGL QTFAIAYI + YPWFF+ V P+NF+ L++PLL
Sbjct: 248 LGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVALSSPLL 307

Query: 306 GIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDXXXXXXXXXXXXXXXVLRMFKRRTIY 365
           GIVT+NPAYVNILLS G+VGKTGQDLGL     D               +LR FK+RT+Y
Sbjct: 308 GIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRKFKKRTLY 367

Query: 366 ANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSSNTSSDFISRNFLSPISKAIS 425
           ANAVNDGIVPLY+++LL+LDY+ +L QL T+    ++       DF ++  ++P+ KAI+
Sbjct: 368 ANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVDK------QDFFTKTLINPLVKAIN 421

Query: 426 FWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKIYCDQEVP 485
              PQ      S  IPKVS+ +SA SVL+PPLPEK+Y+MNPS   ++I+HDK+Y + ++P
Sbjct: 422 VLMPQT---QSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSEADIP 478

Query: 486 PRESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEIARRWHEGISWRKVVVGLKPDAHNN 545
                 EK +  S   LL      + ++ ++LEEEIA++WH+G++WRKV+V LKPDAHNN
Sbjct: 479 EVGQPPEKNIWSS---LL--LNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNN 533

Query: 546 IIVRRRFSNAYGWPVVDHLTQNHFNXXXXXXXXXXXXVTNSVKSDQTSPEDHKEDRSWMF 605
           IIVRRRF+NAYGWPV+DHL QNHFN             T     +    E  ++++ W+ 
Sbjct: 534 IIVRRRFANAYGWPVIDHLVQNHFN-------GSDYPYTEGETEEAALDELIEQEKKWIN 586

Query: 606 DNGKETMFDVGPTGMISTVGEILDSMAKNSFMIHRSNGAPSTQGP--SFEQDNLFR 659
               ET FDVGPTGMIS+VGEIL+++  ++F   +   + S+  P  SF+ D +FR
Sbjct: 587 RPHNETFFDVGPTGMISSVGEILENIKNSAF---QKTASASSLKPSDSFDDDEIFR 639

>Scas_669.14
          Length = 690

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/642 (53%), Positives = 458/642 (71%), Gaps = 18/642 (2%)

Query: 4   DGVVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMG 63
           + ++Y  KS++   + +RYII+Y LYD +E +P+D+ L+ L+L+++NIE  ++RAAYLMG
Sbjct: 2   NDLLYQNKSTLGAAQQDRYIITYNLYDTEE-IPSDIKLDPLYLRIKNIEPISYRAAYLMG 60

Query: 64  PYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDVVSQ 123
           P++LYCDVR   YHHSQR++ + DQP FE  L P QD I  LSLH ++K YVW+VDVVSQ
Sbjct: 61  PFILYCDVRLETYHHSQRIYSTCDQPQFESNLLPSQDAIWSLSLHQIQKRYVWIVDVVSQ 120

Query: 124 IIFTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLPVQL--ST 181
           I+FTT T + +E+S+G +++ L  S     +      +L VT+L +LDLW LPVQL  S 
Sbjct: 121 ILFTTNTDITYEISMGYTKESLHHSINNERLGSD---RLVVTKLNTLDLWKLPVQLAPSD 177

Query: 182 HTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINY 241
              +++HLVILTHGLHSN+  DM Y+ EQI K Q  YP EQIVV G+ GN+C+TE+G+ Y
Sbjct: 178 RRRRRKHLVILTHGLHSNLTVDMEYIMEQIYKSQDNYPNEQIVVDGYPGNICQTERGVKY 237

Query: 242 LGTRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITLA 301
           LG RLA+YIV ELY   + KISFIGHSLGGLVQTFAIAYI+VKYPWFFQ V PINFI +A
Sbjct: 238 LGERLAKYIVNELYDASIVKISFIGHSLGGLVQTFAIAYINVKYPWFFQKVQPINFIAMA 297

Query: 302 TPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDXXXXXXXXXXXXXXXVLRMFKR 361
           +PLLGIVTDNPAYV +LLSFG++GKTGQDLGL  +S+                VL  FKR
Sbjct: 298 SPLLGIVTDNPAYVKLLLSFGVIGKTGQDLGLDRVSETDRPLLYLLPGEPTRSVLLKFKR 357

Query: 362 RTIYANAVNDGIVPLYSASLLFLDYEDVLGQLK-------TKPELRERLSSNTSSDFISR 414
           RT+YANA+NDGIVPLY+ASLLFLDY+D+L QL         K E    +  NT+S   ++
Sbjct: 358 RTLYANAINDGIVPLYTASLLFLDYDDILEQLHKNEDEELAKDEQNVTIPENTAS--FNK 415

Query: 415 NFLSPISKAISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIII 474
           NF+SP++K +S WAPQKFP     K+PKVS+++SATS+L+PPLP++ Y++NP +R  +II
Sbjct: 416 NFISPLTKMLSIWAPQKFPQGPDSKLPKVSMLQSATSILLPPLPDQEYLLNPKARHPVII 475

Query: 475 HDKIYCDQEVPPRESQSEKELLESNNTLLKAFT--RSSGKDNRRLEEEIARRWHEGISWR 532
           HDK Y  +++P  +++ E     S N LL+AFT  ++  K  ++LEE IARRWHEG+SWR
Sbjct: 476 HDKTYTQEDLPKGDTELEDTFFNSENMLLQAFTDIKAGRKRYQKLEESIARRWHEGMSWR 535

Query: 533 KVVVGLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHFN-XXXXXXXXXXXXVTNSVKSDQ 591
           KVVV LKPDAHNNIIVRRRF+NAYGW V+DHL   HFN             +   + +DQ
Sbjct: 536 KVVVALKPDAHNNIIVRRRFANAYGWNVIDHLIGVHFNGDDRLEEEQTKAGLEAPLPNDQ 595

Query: 592 TSPEDHKEDRSWMFDNGKETMFDVGPTGMISTVGEILDSMAK 633
           +S  +  ++ +W+     E++FD GPTGMIST+GE+L++  K
Sbjct: 596 SSVIEPIDEYAWVTKAESESLFDEGPTGMISTMGEMLETFTK 637

>KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c, start by similarity
          Length = 677

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/656 (52%), Positives = 455/656 (69%), Gaps = 27/656 (4%)

Query: 6   VVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPY 65
           ++YH +SS+++GE+ERYI +Y LY  DE +P+DL L+SLWLK++NIE+ T RAAYLMGPY
Sbjct: 34  IMYHFQSSLRIGELERYIFTYDLYMGDE-IPSDLTLDSLWLKIKNIENVTLRAAYLMGPY 92

Query: 66  LLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDVVSQII 125
           +LY DVR  DYHH QRLF+SADQP FE  +QPQQDFI ELSLHNLKK YVW+VD+ SQI+
Sbjct: 93  VLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDIASQIL 152

Query: 126 FTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLP-VQLSTHTH 184
           FT    + F ++VG S++ ++  S  +   G   S++ V RLT+ DLWN   +  S    
Sbjct: 153 FTKQASINFSITVGGSKESISVDSARNIQLGVQSSRMKVDRLTTADLWNASLLSKSVFGR 212

Query: 185 QKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYLGT 244
           +KEHLVILTHGLHSNV +D+FY+KEQIEK Q  + EE +VVKGF  NVCKTEKGI +LGT
Sbjct: 213 RKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQH-EEMLVVKGFTDNVCKTEKGIKWLGT 271

Query: 245 RLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITLATPL 304
           RLAE+IV  LY++   KISFIGHSLGGLVQ+FAIAYI   YP FF+ V P+NFIT+A+P+
Sbjct: 272 RLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFITMASPM 331

Query: 305 LGIVTDNPAYVNILLSFGIVGKTGQDLGL-TELSKDXXXXXXXXXXXXXXXVLRMFKRRT 363
           LGIV+DN  Y+  LL+ GI GKTGQDL L T                    +L+ FK  T
Sbjct: 332 LGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRILKCFKSCT 391

Query: 364 IYANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSSNTSSDFISRNFLSPISKA 423
           +YANA NDGIVPLY+++LLFLDY+D+L +L    E       +  +DF  RNF+SP++KA
Sbjct: 392 VYANACNDGIVPLYTSALLFLDYDDILDKLNMNTE-------DLQTDFFQRNFISPLTKA 444

Query: 424 ISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKIYCDQE 483
           +    PQ+   +G+ KIP  S+++SA SVLIPPLP+K+YI +P +R+++++HDK+Y  Q+
Sbjct: 445 MDILMPQRVSQNGT-KIPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHDKVYSGQD 503

Query: 484 VPPRESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEIARRWHEGISWRKVVVGLKPDAH 543
           +P  +S S+ E++ S+N LLK F  + G   ++LEE+IAR WH+ + WRKV++ LKPDAH
Sbjct: 504 IPDHQSNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQIARNWHKDVKWRKVIINLKPDAH 563

Query: 544 NNIIVRRRFSNAYGWPVVDHLTQNHFNXXXXXXXXXXXXVTNSVKSDQTSPEDHKEDRSW 603
           NNII RRRFSNAYGWPVVDHLT+ HF                S +S +  P    ED  W
Sbjct: 564 NNIITRRRFSNAYGWPVVDHLTETHF-----------LNDDKSSRSWKLDPISKDEDFDW 612

Query: 604 MFDNGKETMFDVGPTGMISTVGEILDSMAKNSFMIHRSNGAPSTQGPSFEQDNLFR 659
           +     +++FDVGPTGMI T GE+L+++  ++          ST   S+ Q+ LF+
Sbjct: 613 IVKPTVDSVFDVGPTGMICTFGEMLENLKTSTL----EGMTESTVPTSYSQEELFK 664

>CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 673

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/640 (52%), Positives = 442/640 (69%), Gaps = 22/640 (3%)

Query: 6   VVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPY 65
           ++YH +SSVKVGE+ERY+I Y LY+DDE +P DL L+SL+++++N    +FRA YL GP+
Sbjct: 10  ILYHYRSSVKVGEIERYLIEYILYEDDE-IPDDLKLDSLYVRLKNCSPLSFRAGYLAGPF 68

Query: 66  LLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDVVSQII 125
           +LY DVR+++YHHSQ +  SAD P FE  LQ QQ  + ELSLHN++  YVW++DVVSQI+
Sbjct: 69  ILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVSQIL 128

Query: 126 FTTTTQVGFEVSVGTSRKCLAKSSEFS--PVSGSLESKLNVTRLTSLDLWNLPVQLSTHT 183
           FTT T V FEV+VG  RK L +++E    P  GS  + L V+RLT+ DLW LP +L+   
Sbjct: 129 FTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKLPRELAPKK 188

Query: 184 HQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYLG 243
             K HLVILTHGLHSNV AD+ YL E+I K Q  +P E ++V G+  NVC+TEKG+ YLG
Sbjct: 189 DIK-HLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKGVRYLG 247

Query: 244 TRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITLATP 303
           TRLA+YI+  LY   VKKISF+GHSLGGLVQTFAI  +  +YPWFF  V P+NFIT+A+P
Sbjct: 248 TRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFITIASP 307

Query: 304 LLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDXXXXXXXXXXXXXXXVLRMFKRRT 363
           +LGIVTDNPAY+N+LLSFG+VG+TG+DL L     D               +LR F+RRT
Sbjct: 308 MLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEFIRSILRKFERRT 367

Query: 364 IYANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSSN--TSSD---FISRNFLS 418
           IYANAVNDGIVPLY++ LL+LDY+ +L +L+ K E +     N  T SD   F ++NF+S
Sbjct: 368 IYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITVSDNTAFFNKNFIS 427

Query: 419 PISKAISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKI 478
           P++K +S WAPQKFP+    KIPKVS  +SA S+L+PPLP+  +I+NP  R +IIIHDKI
Sbjct: 428 PLTKMLSLWAPQKFPESDP-KIPKVSFFQSAASILLPPLPDINFIVNPKHRNDIIIHDKI 486

Query: 479 YCDQEVPPRESQSEKELLESNNTLLKAFTRSSGKDNR--RLEEEIARRWHEGISWRKVVV 536
           Y ++++   E   +     + N  L+A +  + +  +   LE+ IA RWH+G+SWRKV+V
Sbjct: 487 YTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLSWRKVIV 546

Query: 537 GLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHFNXXXXXXXXXXXXVTNSVKSDQTSPED 596
            LKPDAHNNIIVRRRFSNAYGWPV+DHL   HF+                      S   
Sbjct: 547 ALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENFEMD----------SQKDVSITT 596

Query: 597 HKEDRSWMFDNGKETMFDVGPTGMISTVGEILDSMAKNSF 636
            +ED +W+    ++ +F  GPTGMISTVGEI++S AK  F
Sbjct: 597 TREDLNWIKRPDEDGLFKEGPTGMISTVGEIVESFAKKRF 636

>YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Rog1p [1944 bp, 647 aa]
          Length = 647

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/587 (49%), Positives = 374/587 (63%), Gaps = 33/587 (5%)

Query: 2   TKDGVVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYL 61
           + D V+YH +SSVK+GE+ERY+I+Y+LY  D  +PAD+ L+SLW+K++N    +++ AYL
Sbjct: 6   SADEVLYHNQSSVKLGELERYVITYELYQGD-SIPADITLDSLWVKIKNTTKLSYKPAYL 64

Query: 62  MGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDVV 121
           +GP++LYCDVRA DY  S ++  SAD+P F+  LQ QQ FI ELSLH++K  YVW+VD+V
Sbjct: 65  LGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWIVDIV 124

Query: 122 SQIIFTTTTQVGFEVSVGTS-----RKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLP 176
           SQI+F   T+V FE+ VG S     RK     S        L + L+V RLT+ D+W +P
Sbjct: 125 SQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADIWKVP 184

Query: 177 VQLSTHTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTE 236
             +     QK HLVILTHG  SNV ADM YL E+I K Q   P E++V+KG+  N C+TE
Sbjct: 185 RPIDMS--QKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETE 242

Query: 237 KGINYLGTRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPIN 296
           KGI +LG  LA YI+ ELY + V KISFIGHSLGGL QTFAI YI  KYP+FF+ V PIN
Sbjct: 243 KGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPIN 302

Query: 297 FITLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDXXXXXXXXXXXXXXXVL 356
           FI+LA+PLLGI T  P YV + LS GI+G TGQ+LGL + +                 VL
Sbjct: 303 FISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPLLYLLSEESLISVL 362

Query: 357 RMFKRRTIYANAVNDGIVPLYSASLLFLDYEDVLGQLKT----------KPELRERLSSN 406
             FKRRT+YANAVNDGIVPLYS+SLLFLDY  +L +L            +PE+       
Sbjct: 363 ARFKRRTLYANAVNDGIVPLYSSSLLFLDYSQLLQKLGGQTTAPCDPLFQPEVSPIGELP 422

Query: 407 TSSDFISRNFLSPISKAISFW-APQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMN 465
             SD  + +     S   +FW + +   D  S ++   SVI+S  SVL+ P P+  +  +
Sbjct: 423 NHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPDAKFFSD 482

Query: 466 PSSRENIIIHDKIYCDQEVPPRESQSEKELLESNNTLLKAFTRSSG---KDNRRLEEEIA 522
           P +R   IIHDKIY ++ +PP            + TL +      G   K  + +EE IA
Sbjct: 483 PDARVATIIHDKIYTEKNLPP-----------PSPTLYEGTAAKEGETRKTRKEMEEIIA 531

Query: 523 RRWHEGISWRKVVVGLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHF 569
           RRWH+G+ WRKVVV LKPDAHNNIIVRRRFSNAYGWPVVDHL   HF
Sbjct: 532 RRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHF 578

>Scas_613.14
          Length = 628

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/577 (50%), Positives = 369/577 (63%), Gaps = 29/577 (5%)

Query: 1   MTKDGVVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAY 60
           ++ D V+Y   S VK+G + RYII Y LY  DE +P  ++L+ L L ++N    +F+AAY
Sbjct: 5   ISDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDE-IPTTISLDPLKLTIKNKVRKSFKAAY 63

Query: 61  LMGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDV 120
           LMGP+ LYCDVRA  YHH QR+  S D P F   LQP   FI ELSLH +KK YVW++DV
Sbjct: 64  LMGPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWIIDV 123

Query: 121 VSQIIFTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWN--LPVQ 178
           +SQ IF+  +   FE+++GT+             SGS    L V  L++  +WN    + 
Sbjct: 124 ISQSIFSLNSVTSFELTLGTTTNNYN--------SGS---SLEVETLSTDVIWNEKATIP 172

Query: 179 LSTHTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKG 238
           L   + +  HLVILTHG+HSNV ADM YL EQI   Q  Y  E+IVVKG+ GNVCKTE G
Sbjct: 173 LLRESRKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMG 232

Query: 239 INYLGTRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFI 298
           I +LG  LA+YI+  LY   V KISFIGHSLGGL+Q+FAI+ I V +PWFF+ V P+NFI
Sbjct: 233 IKFLGEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFI 292

Query: 299 TLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDXXXXXXXXXXXXXXXVLRM 358
           TLATP LGIVTDNP+YV +LLS GI+GKTG DLGL E                   +++ 
Sbjct: 293 TLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKE---HYDNILYLLSGEPIKSIMKK 349

Query: 359 FKRRTIYANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSSNTSSDFISRNFLS 418
           F+RRT+YANA+NDGIVPLY++ LLFLDY DVL +L     L+  +     +    R    
Sbjct: 350 FERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDN---LKRSIKITIDTPESGRESEK 406

Query: 419 PISKAISFWA---PQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIH 475
            I+ + S W+     +  D  S+K+PK S+IES  S+L PP P   YI NPSSR  +IIH
Sbjct: 407 IINTS-SSWSKVFKHRKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIH 465

Query: 476 DKIYCDQEVPPRESQSEKELLESNNTLLKAFTR--SSGKDNRRLEEEIARRWHEGISWRK 533
           DK+Y + ++   ES   K     N+ LL  F R  S+GK N RLE EIA+RWH G  WRK
Sbjct: 466 DKVYTEDDIERIESNFYK---LKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRK 522

Query: 534 VVVGLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHFN 570
           V+V L  +AHNNIIVRRRFSN YGW V+DHL +NHFN
Sbjct: 523 VIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHFN 559

>CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 592

 Score =  346 bits (887), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 215/646 (33%), Positives = 331/646 (51%), Gaps = 79/646 (12%)

Query: 9   HAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPYLLY 68
           H + ++ +GE  R++I      D            +++++RN    T RA YL+GP++LY
Sbjct: 3   HVRGALAIGETSRFLIEVNSNID----------GPVFVRLRNRTKATRRATYLLGPFVLY 52

Query: 69  CDVRASDYHHSQRLFVSADQ----PTFEPTLQPQQDFITELSLHNLKKT---YVWVVDVV 121
           CD R           + A+Q    P F+  ++PQ  F  +L   + +       W++DVV
Sbjct: 53  CDSRP---------VIPANQNEYVPQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVV 103

Query: 122 SQIIFTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNL-----P 176
           S+++F   T+V +E+ +        KS     +  S+E  +   + ++ D+         
Sbjct: 104 SEVLFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAK 163

Query: 177 VQLSTHTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTE 236
           ++ S    + +HLVI+THG+ SNV  DM Y+ EQ+    +   +E++++ G+ GNVC+TE
Sbjct: 164 IKKSQTKERNQHLVIVTHGMISNVSNDMMYIMEQLRAIDRDDLDEELILDGYTGNVCRTE 223

Query: 237 KGINYLGTRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPIN 296
            GI  LG RLA YIVKE Y+  +KKISFIGHSLGGLVQTFAIAYI++ + WFF  V P+N
Sbjct: 224 LGIKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVN 283

Query: 297 FITLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSK-DXXXXXXXXXXXXXXXV 355
           FI+LATP LG+ +    Y   LLS G +G+TG+DL     +K                 +
Sbjct: 284 FISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSI 343

Query: 356 LRMFKRRTIYANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSS--------NT 407
           L+ F+RRT+YANA+NDGIVPL S++LL+LDY  +L   K   +  + + S          
Sbjct: 344 LQKFERRTLYANAINDGIVPLASSALLYLDYSKILKDSKLLKKETDDIRSIVMTWKEFQD 403

Query: 408 SSDFISRNFLSPISKAISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPS 467
           S DF     ++P SK                   +VS+  +  ++++P  P+     N +
Sbjct: 404 SEDFKVYKKVNPKSKIFR----------------RVSLTNTVGNLVLPEPPK-----NIT 442

Query: 468 SRENIIIHDKIYCDQEVPPRESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEIARRWHE 527
           S   ++IHD++Y   ++P  E      + E               D  +L+E +ARRWH 
Sbjct: 443 SDMKVLIHDQVYQYNDIPDSEYFPPDGIDE-----------IMAMDRHQLQECMARRWHA 491

Query: 528 GISWRKVVVGLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHFNXXXXXXXXXXXXVTNSV 587
           G SWRKV+V L+ DAHN+I VRRR+SN+ GW V+ H+  NHF             V+   
Sbjct: 492 GKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKCDVPEADIVSQPA 551

Query: 588 KSDQTSPEDHKEDRSWMFDNGKETMFDVGPTGMISTVGEILDSMAK 633
             D+   E +K   +W+    KE        G+I      L+ +A+
Sbjct: 552 SRDEADMEPNKT-YAWLLKEDKEK------GGLIRRATNALNPIAR 590

>YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unknown
           function, has low similarity to C. albicans Orf6.7404p
           [2064 bp, 687 aa]
          Length = 687

 Score =  330 bits (845), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 224/692 (32%), Positives = 357/692 (51%), Gaps = 132/692 (19%)

Query: 11  KSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPYLLYCD 70
           +  +++GE+ RY  S    + D      L+++ L+L+++N ES   R  YL GPY  Y D
Sbjct: 26  RKRLRIGELYRYKFSV---NKDVIKEQGLDVSHLFLRIKNEESALLRPLYLTGPYSFYID 82

Query: 71  VRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKT-----YVWVVDVVSQII 125
           VR  +Y+ + R F   +   F   L+P + F  ++ L+   +      Y W +D++SQ+ 
Sbjct: 83  VRPHNYNEN-RKFPGKEIIPFVENLKPDERFKVKILLNENSRVGDTSLYSWTIDIISQLA 141

Query: 126 FTTTTQVGFEVSVGTSRKCLAKSSE-FSPVSGSLESKLNVTRLTSLDLWNLPVQLSTHTH 184
            TT  ++ F   +GT+RK + KS+  F  + G     +++    +  LW+LP +      
Sbjct: 142 VTTIPKLEFSFRIGTTRKVVKKSNGLFKSIEG-----VSLEMWDTETLWDLPPKFP---E 193

Query: 185 QKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQ-----IVVKGFNGNVCKTEKGI 239
           +  HLVI+THG+ SN+  DM Y+K++IE+    +P ++     I+V+GF GNV K+  GI
Sbjct: 194 KPVHLVIMTHGIFSNIGCDMLYMKDKIEEMT--FPMDESINPNIIVRGFMGNVGKSGHGI 251

Query: 240 NYLGTRLAEYIVKEL----YHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFF---QNV 292
           + LG R+ +Y+++ +       +V +ISFIGHSLGG  Q+ A+ YI +K P FF   + V
Sbjct: 252 HCLGVRVGKYVLETVDKLNKKYKVDRISFIGHSLGGPTQSMAVRYISIKRPDFFDAVKGV 311

Query: 293 SPINFITLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGL--TEL-SKDXXXXXXXXXX 349
            P+NFITLA+P +G++ D P Y+++ L  G +G TG+DL L  T L SKD          
Sbjct: 312 KPVNFITLASPFIGVIGDFPFYLSVPLDMGALGLTGRDLNLKYTPLTSKDGLYADDEVYP 371

Query: 350 XXXXXVLRM------------FKRRTIYANAVNDGIVPLYSASLLFLDYEDVLGQLKTKP 397
                +L +            FKRRTIYAN ++DGIVPL +A+LL+LD+  +    K + 
Sbjct: 372 EHSKYILEILPQAPAKKVFESFKRRTIYANVMDDGIVPLRTAALLYLDWRSIHKVQKIR- 430

Query: 398 ELRERLSSNTSSDFISRN----------------------FLSPISKAISFWA-PQK--- 431
             ++  +S TSS+F+S +                        SP  KA   W  PQ    
Sbjct: 431 --KKNKNSPTSSEFVSSDSPESSGASSPSNENGNNVGEIPAESPNKKATLQWTLPQAVIH 488

Query: 432 -------------------------FPDDGSLKIPK-VSVIESATSVLIPPLPEKTYIMN 465
                                    F D    + PK  + + SA SVL   +P++ YI N
Sbjct: 489 GSKINKYKRGQTNEANSDSDNEQGVFLDGQKFEPPKEANTVLSALSVLTAAIPDQEYIKN 548

Query: 466 PSSRENIIIHDKIYCDQEVPPRESQSE---KELLESNNTLLKAFTRSSGKDNRRLEEEIA 522
           P+ R++ +IHDK+Y  +E+PP   ++    K+L+  N ++             R++E IA
Sbjct: 549 PAVRKDEVIHDKLYHPEELPPPHYENRPIVKKLIYPNESV------------NRIQERIA 596

Query: 523 RRWHEGISWRKVVVGLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHFNXXXXXXXXXXXX 582
           R W E ++WRKV+V ++PD+HNNI+VRRRF N YG+  V+H+ ++HF             
Sbjct: 597 REWQETMTWRKVLVQIQPDSHNNIVVRRRFVNLYGYVAVEHMVEHHFG----------SK 646

Query: 583 VTNSVKSDQTSPEDH-----KEDRSWMFDNGK 609
           V + +  D   P+D      + DRS  ++ G+
Sbjct: 647 VCSELAEDANEPKDEPNQSSQADRSNEYNEGE 678

>AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)
           [1911 bp, 636 aa]
          Length = 636

 Score =  320 bits (820), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 211/635 (33%), Positives = 331/635 (52%), Gaps = 101/635 (15%)

Query: 6   VVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPY 65
           ++Y+ +  +  GE+ RYII      D   L A   +  L L+++N+ES   R  YL GPY
Sbjct: 24  LLYNDQRGISQGEVFRYIIKV----DKAQLDAKTKIEELVLRIKNVESPLLRPIYLTGPY 79

Query: 66  LLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHN----LKKT-YVWVVDV 120
            +Y +VR   Y++ +      D   F   L+P + F   L L+     L+ T Y W  DV
Sbjct: 80  SVYAEVRP--YNYDENTAFQGDDLQFISDLKPDEAFSATLKLNGDSQVLESTVYSWTADV 137

Query: 121 VSQIIFTTTTQVGFEVSVGTSR-------KCLAKSSEFSPVSGSLESKLNVTRLTSLDLW 173
           +SQ+ +     +   +S+G +R       K  A++ E  PVSG       V    ++ +W
Sbjct: 138 LSQMTWMVDHPILVRLSIGNTRSIGKAAMKTPARAVE--PVSG-----FTVEIQDTMTVW 190

Query: 174 NLPVQLSTHTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPE---EQIVVKGFNG 230
           N P        +  HLVI+THG+ SN+  DM YL+++++KC     E   + +VV+G++G
Sbjct: 191 NEP---PLFPERPVHLVIVTHGIFSNIGCDMLYLRDRLKKCAHAVEENCNQNVVVRGYHG 247

Query: 231 NVCKTEKGINYLGTRLAEYIVKELYHER----VKKISFIGHSLGGLVQTFAIAYIHVKYP 286
           N+ K+ KGI YL  R+A+Y++K +        + +ISFIGHSLGGLVQTFAI Y+  + P
Sbjct: 248 NIGKSHKGIEYLAMRVADYVLKTIAQMPNEYFLDRISFIGHSLGGLVQTFAIQYMLERDP 307

Query: 287 WFFQ----NVSPINFITLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGL------TEL 336
             F      + P+NFI LA+P LG++ D P Y  + L+FG +G+TG+DL L      +EL
Sbjct: 308 GIFSPQAGGLRPMNFIALASPFLGVIGDFPLYATVALNFGALGRTGKDLNLKNDFAISEL 367

Query: 337 SKDXXXX------XXXXXXXXXXXVLRMFKRRTIYANAVNDGIVPLYSASLLFLDYEDV- 389
            ++                     VL+ F  RT+YANA++DGIVPL +++LL+LD+  + 
Sbjct: 368 VRNPKQAYNRRPVLESIVSGSMKSVLQAFSNRTLYANALHDGIVPLRTSALLYLDWYSLQ 427

Query: 390 ---------------LGQ----------LKTKPELRERLSSNTSSDFISRNFLS------ 418
                          LG+          ++  P+L E+   +T    + R  +       
Sbjct: 428 EVNLIGAQEGAETFDLGEEDHALKRYDTVEIPPDLSEK--KDTIRWLLPRALIKRRHKWY 485

Query: 419 PISKAISFWAPQKFPDDGSLK-IPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDK 477
             S+ +     Q + +D     + K S + SA ++L+ P P + Y  +P SR + I HDK
Sbjct: 486 KRSQTVKPGIEQLWDEDSDYHPLTKASALSSAANILVAPPPTQDYYKDPQSRTDYIFHDK 545

Query: 478 IYCDQEVPP---RESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEIARRWHEGISWRKV 534
            Y  +E+PP   R  +  K++L  N+ +             R +E+IAR + E +SWRKV
Sbjct: 546 RYSPEELPPAYYRNRELLKKILYPNDKV------------HRTQEKIARGYQESMSWRKV 593

Query: 535 VVGLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHF 569
           +V ++P++HNNIIVRRRF N++GW V++HL   HF
Sbjct: 594 LVNIQPESHNNIIVRRRFVNSFGWIVIEHLVNEHF 628

>CAGL0M10043g complement(999113..1001089) similar to tr|Q04093
           Saccharomyces cerevisiae YDR444w, hypothetical start
          Length = 658

 Score =  304 bits (778), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 220/660 (33%), Positives = 327/660 (49%), Gaps = 113/660 (17%)

Query: 1   MTKDG--VVYHAKSSVKVGEMERYIISYQLYDDDEGLPAD-LNLNSLWLKVRNIESFTFR 57
           M KDG  ++ H K+S+ +G M RYI+      D + L  D ++   L+L+ +N+ES   R
Sbjct: 1   MKKDGGLLLVHEKNSLGIGGMCRYILQV----DHKKLKEDGIDTQELYLRFKNLESPLLR 56

Query: 58  AAYLMGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITEL---------SLH 108
             YL GPY  Y DVR  +Y    + ++ ++   F   L+P + F  +L         + +
Sbjct: 57  PVYLTGPYAFYIDVRPCNYDED-KTYIGSEDVAFCSDLKPDEKFKAKLYFNANSRLQTKN 115

Query: 109 NLKKTYVWVVDVVSQIIFTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLT 168
              + Y W +D++SQ+   T   + +   VGTS+K + KS      S      L++    
Sbjct: 116 ARDEIYSWTIDIISQLAVVTFPILKYSFKVGTSKKIVKKSKGKKVTS---VRGLSLKMWD 172

Query: 169 SLDLWNLPVQLSTHTHQKEHLVILTHGLHSNVHADMFYLKEQIEKC-----QKYYPEEQI 223
              LWNLP +   +  +  HLVILTHG+ SNV  DM Y+K++IE+      ++Y P   +
Sbjct: 173 EKSLWNLPPK---YPDKPIHLVILTHGIFSNVGCDMLYMKDKIEQTAMNIEERYNP--NV 227

Query: 224 VVKGFNGNVCKTEKGINYLGTRLAEYIVK---ELYHE-RVKKISFIGHSLGGLVQTFAIA 279
           VV+G   N+ K+  GI YLG RLA+++V+   EL  E  V KISFIGHSLGG  Q+ AI 
Sbjct: 228 VVRGCMDNMGKSAHGIYYLGKRLAKFVVRTVEELRKEYHVDKISFIGHSLGGPTQSMAIH 287

Query: 280 YIHVKYPWFFQNVS---PINFITLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGL--T 334
           YI V YP FF  VS   P++FI LA+P +G++ D P Y+++ L  G +G TG+DL L  T
Sbjct: 288 YISVMYPDFFNTVSGIKPMHFIALASPFIGVIGDFPLYLSVPLDMGALGLTGRDLNLKYT 347

Query: 335 ELSKDXXXXXXXXXXXX---------------XXXVLRMFKRRTIYANAVNDGIVPLYSA 379
            L+ +                              V ++F  RT+YAN V+DGIVPL +A
Sbjct: 348 PLTSNEGLSALTLAQENSHLPKNILEIIPQPPAQQVFQLFMNRTLYANIVHDGIVPLRTA 407

Query: 380 SLLFLDYEDVLGQLKTKPELRERLSSNTSSDFISRN----------------FLSPISKA 423
           +LL+LD+  +      K    E+ ++  + D  + N                  SP SK 
Sbjct: 408 ALLYLDWRSLTQVKDIKKSAGEKSNNKITEDSPTDNESVSTTNKDNKMGEIPSESPNSKN 467

Query: 424 ISFWA-PQ---KFPDDGSLKIPKV------------------------------SVIESA 449
              WA PQ   K P     K  ++                              S   SA
Sbjct: 468 FLQWALPQVIIKGPKMNKFKRGQIMDTKSNESSDTDTESSDSKQEQKFKGPSEASTFMSA 527

Query: 450 TSVLIPPLPEKTYIMNPSSRENIIIHDKIYCDQEVPPRESQSEKELLESNNTLLKAFTRS 509
            S L  P+P + YI NP  R++ ++HD++Y  Q++P      E+  L+ +      +   
Sbjct: 528 LSTLTAPVPTQEYIKNPKVRKDRVVHDRVYEPQDLP------EQHYLKRSTMKRVVYPNE 581

Query: 510 SGKDNRRLEEEIARRWHEGISWRKVVVGLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHF 569
           S     R++E IAR W   +SWRKV+V ++PD+HNNI+VRRRF N YG   V H+ + HF
Sbjct: 582 SV---NRIQERIARAWQMNMSWRKVLVEIQPDSHNNIVVRRRFVNLYGNVAVSHMVREHF 638

>KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyces
           cerevisiae YDR444w, start by similarity
          Length = 640

 Score =  301 bits (772), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 196/626 (31%), Positives = 324/626 (51%), Gaps = 85/626 (13%)

Query: 12  SSVKVGEMERYIISYQLYDDDEGLPADLNL--NSLWLKVRNIESFTFRAAYLMGPYLLYC 69
            S+ +G++ RY I   + D ++ L   +    ++L+L+ +N ES   R  ++ GPY +Y 
Sbjct: 25  GSLGIGDVNRYKI---IVDKNKLLSDGIECTDDTLYLEFKNQESALLRPLWITGPYSIYV 81

Query: 70  DVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKK-----TYVWVVDVVSQI 124
           ++  ++Y   ++     D   F   L+P ++F  +L L++  +      Y W +D+++Q 
Sbjct: 82  EITPNNYDERKQFI--GDGIEFMSDLKPDENFKAKLYLNSNARVDGTSCYAWKIDLIAQF 139

Query: 125 IFTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLPVQLSTHTH 184
              T  ++ F  ++ T+ K    S +   +       L +++L +  LWNLP        
Sbjct: 140 TVVTIVRLPFVFTLATTYKTAKHSQKDKNIEVQQTDGLKISKLDTEQLWNLPPPFP---D 196

Query: 185 QKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQ---IVVKGFNGNVCKTEKGINY 241
           +  HLVI+THG+ S++  DM  LK+ IE+   + P++    +V++G+ GNV K+ KGI +
Sbjct: 197 KPVHLVIITHGIFSSIGGDMLCLKDTIERASNFLPDDNNGNLVIRGYPGNVGKSHKGIRH 256

Query: 242 LGTRLAEYIVKELYHER----VKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQ---NVSP 294
           LG +LAEYI+  +   +    + +ISF+GHSLGG VQ  AI YI V+ P  F     ++P
Sbjct: 257 LGFKLAEYIIDTIDKLQQQFTLTRISFVGHSLGGPVQAMAIHYISVERPDIFDKTTGLTP 316

Query: 295 INFITLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGL-------------TELSKDXX 341
           +NF+  A+P LG++ D P Y++I+L  G +G+TG+DL L              + S D  
Sbjct: 317 VNFVAAASPFLGVIGDLPKYISIVLDIGALGQTGRDLTLKRSYFLPSKGIVNNDGSHDRI 376

Query: 342 XXXXXXXXXXXXXVLRMFKR---RTIYANAVNDGIVPLYSASLLFLDYEDV--LGQLKTK 396
                         L +F+R   RT+YAN   DGIVPL +A+LL+LD+  +  + Q++++
Sbjct: 377 KSKPILELLPKHPALEVFQRFKCRTVYANVAFDGIVPLRTAALLYLDWRGLSDVQQVRSE 436

Query: 397 --PELRERLSSNTSSDFISRNFLSPISKAISFW-APQKF--------------------- 432
              +  E +     S        S  +K+I  W  PQ                       
Sbjct: 437 NNAQSEEGVEEQKGSSLGEIPESSSDNKSILQWLLPQSLIKKEKYKPYVRTQTTSSVESA 496

Query: 433 --------PDDGSLKIP-KVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKIYCDQE 483
                       + K P K + +++A S +  PLP  +Y+++PSSR + IIHDK+Y  +E
Sbjct: 497 SSDSNNNSDSPTTFKPPKKANTLQAAASTISAPLPGMSYLVDPSSRTDRIIHDKVYTPEE 556

Query: 484 VPPRESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEIARRWHEGISWRKVVVGLKPDAH 543
           +P +  + +K        L+K     +   + + EE IAR W E + WRKV+V L+PD+H
Sbjct: 557 LPDKHYKHKK--------LVKKIIYPNYSIHMK-EERIARYWQETMDWRKVIVELQPDSH 607

Query: 544 NNIIVRRRFSNAYGWPVVDHLTQNHF 569
           NNIIVRRRF N++GW VV+H+   HF
Sbjct: 608 NNIIVRRRFVNSFGWIVVNHIADEHF 633

>Kwal_47.18482
          Length = 623

 Score =  293 bits (749), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 201/643 (31%), Positives = 325/643 (50%), Gaps = 110/643 (17%)

Query: 3   KDGVVYHAKSSVKVGEMERY--IISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAY 60
           +D ++   +  + +GE+ RY   +   L DD        ++   +L  +N ES   R  Y
Sbjct: 7   EDLLLVDDRLKLGLGELVRYNVTVDRSLLDDHLS-----HITEFYLTFKNTESAFLRPIY 61

Query: 61  LMGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKT-----YV 115
           L GPY  Y DV+  +Y   +R+  + ++  F   ++P +++   L L++  +      +V
Sbjct: 62  LTGPYSFYVDVQPCNY--DERIPFN-EKLQFCEDVKPNEEYRAVLQLNDNSRVEESERFV 118

Query: 116 WVVDVVSQIIFTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNL 175
           W ++V+SQ+  T    +GF + +   +     SS  + + G +  K +     +  LWNL
Sbjct: 119 WQINVMSQLSVTKIPVLGFRLCISCGKSSEIPSSPVTSIKGFVCEKWD-----THGLWNL 173

Query: 176 PVQLSTHTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEE----QIVVKGFNGN 231
           P +      +  HLV+LTHG+ SNV  D+ YLK++IE       ++     +VV+G+ GN
Sbjct: 174 PPRFP---DRPLHLVVLTHGIFSNVGCDLVYLKDRIEAAASVAGKDSKTSNLVVRGYMGN 230

Query: 232 VCKTEKGINYLGTRLAEYIV------KELYHERVKKISFIGHSLGGLVQTFAIAYIHVKY 285
             ++ KGI   G RLA++I+      KE Y   ++ ISF+ HSLGG  Q  AI YI ++ 
Sbjct: 231 QGRSSKGIKANGVRLAKFIIETVDDLKEEYD--LQYISFVAHSLGGPSQAMAIRYICLER 288

Query: 286 PWFF---QNVSPINFITLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLTE---LSKD 339
           P  F   + + P+NFITLA+P LGI  + P +V + L  G++G+TG DL L     LSKD
Sbjct: 289 PDIFDPAKGLKPLNFITLASPYLGIAGEVPPFVTLALDVGVLGQTGADLNLNRTFFLSKD 348

Query: 340 XXXXXXXXX-------------XXXXXXVLRMFKRRTIYANAVNDGIVPLYSASLLFLDY 386
                                       +++ F+ RTIYAN ++DGIVPL +A+LL+LD+
Sbjct: 349 GIVRKDEKLGSYRRKPLLEIIPSRPLTELIQRFENRTIYANILHDGIVPLRTAALLYLDW 408

Query: 387 EDVLGQLKTKPELRERLSSNTSSDFISRNFLSPISK----------AISFWAPQ------ 430
           +  LG ++    +R     +      S N    I K          A+ +  PQ      
Sbjct: 409 K-ALGDVRG---IRRENGKDDEGTPYSSNEKDAIGKIPEEKMDKQSALKYLMPQAALRRK 464

Query: 431 ------------------KFPDDGSLKI---PKVSVIESATSVLIPPLPEKTYIMNPSSR 469
                              + ++ +  I   P  + + SA ++++ PLP + Y+ NP  R
Sbjct: 465 YKKYTRTQILSQESGNENSYSEESTEPISPPPSANPLVSAANIIVAPLPTQKYLQNPKER 524

Query: 470 ENIIIHDKIYCDQEVPP---RESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEIARRWH 526
           E+ I+HDKIY   E+PP   R+    K+++  N+ +             R++E IAR+W 
Sbjct: 525 EDKIVHDKIYYPDELPPAHYRKRDVLKKIIYPNDRIY------------RVQERIARQWQ 572

Query: 527 EGISWRKVVVGLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHF 569
           E ++WRKV+V ++PD+HNNI+VRR+F NA+GW VVDHL + HF
Sbjct: 573 ETMNWRKVLVSIEPDSHNNIVVRRKFVNAFGWVVVDHLVKEHF 615

>Scas_717.50
          Length = 658

 Score =  231 bits (588), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 152/415 (36%), Positives = 230/415 (55%), Gaps = 41/415 (9%)

Query: 2   TKDGVVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYL 61
           TK  ++ +    + +G++ RYIIS    D  +   + + +  L+L+++N ES   R  YL
Sbjct: 14  TKGILLLNETKKLGIGDLSRYIISV---DKKKLEDSGICIEELFLRIKNEESPLLRPVYL 70

Query: 62  MGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKK-----TYVW 116
            GPY  Y DVR  +YH  + +F   +   F   L+P   F T++ L+   +     TY W
Sbjct: 71  TGPYTFYVDVRPHNYHEDE-IFEGDEVIPFCEHLKPDARFKTKIFLNKHSRVANTNTYSW 129

Query: 117 VVDVVSQIIFTTTTQVGFEVSVGTSRKCLAKSSEFS-PVS-GSLESKLNVTRLTSLDLWN 174
            VD++SQ+    T  + +   + T++K     S+   PV     E KL    L +  LW+
Sbjct: 130 TVDILSQLCVIPTPTLKYSFRIATTKKETKNGSKGKKPVKMDGFEVKL----LDTSSLWS 185

Query: 175 LPVQLSTHTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEE---QIVVKGFNGN 231
            P +   + ++  HLVI+THG+ SN+  DM Y+K++IE+     PE+    +VV+G   N
Sbjct: 186 FPPK---YPNKPVHLVIMTHGIFSNIGCDMLYMKDKIEETANSVPEDINPNVVVRGCMKN 242

Query: 232 VCKTEKGINYLGTRLAEYIVK---ELYHE-RVKKISFIGHSLGGLVQTFAIAYIHVKYPW 287
           + K+  G++YLG R+AEYI++   EL  + +V KISFIGHSLGG  Q  A+ YI VK P 
Sbjct: 243 MGKSAHGVHYLGKRVAEYIIETVDELNKKYKVDKISFIGHSLGGPTQGMAVHYISVKRPD 302

Query: 288 FF---QNVSPINFITLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGL--TEL-SKDXX 341
            F   + + P+NFITLA+P +G++ D P YV++ L  G +G TG+DL L  T L SKD  
Sbjct: 303 IFHPTKGIKPVNFITLASPFIGVIGDFPLYVSLPLDAGSLGLTGRDLNLKYTPLTSKDGL 362

Query: 342 XXXXXXXXXX-------XXXVLRMFKR---RTIYANAVNDGIVPLYSASLLFLDY 386
                                L +F+R   RT+YAN V+DGIVPL +A+LL+LD+
Sbjct: 363 TTDGNAAKTKLILEIIPQPPALAIFERFVHRTLYANVVHDGIVPLRTAALLYLDW 417

 Score =  103 bits (256), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 76/130 (58%), Gaps = 10/130 (7%)

Query: 441 PKVSVIESATSVLIPPLPEKTYIMNPSSRE-NIIIHDKIYCDQEVPPRESQSEKELLESN 499
           P+ S + +A SVL  PLP + YI NP  R  + I+HDKIY  +E+P            +N
Sbjct: 526 PEASTMLAALSVLTAPLPSQEYIKNPEVRHHDAIVHDKIYTPKEIP--------RAHYAN 577

Query: 500 NTLLKAFTRSSGKDNRRLEEEIARRWHEGISWRKVVVGLKPDAHNNIIVRRRFSNAYGWP 559
              +K     +   NR  +E IAR+W   ++WRKV+V +KPD+HNNI+VRRRF N YG  
Sbjct: 578 RPAIKKVIYPNESVNR-TQERIARQWQMTMNWRKVLVKIKPDSHNNIVVRRRFVNLYGDV 636

Query: 560 VVDHLTQNHF 569
            V H+ + HF
Sbjct: 637 AVSHMVEEHF 646

>KLLA0F16423g complement(1516717..1518096) similar to sgd|S0005585
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 459

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 103/211 (48%), Gaps = 21/211 (9%)

Query: 185 QKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYLGT 244
           +K+HL IL HGL  N H  M  +KE +EK      ++ ++ K  N    KT  GI  +  
Sbjct: 5   KKKHLFILVHGLWGN-HKHMNSIKEMLEKTLDDI-DDIVIFKPENSGYLKTLHGIRVVSY 62

Query: 245 RLAEYIVKELYH---ERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITLA 301
            + + I K + +   E+  ++S IG+S+GGLV  F I  +  +    FQ++ P+ F+T A
Sbjct: 63  NVLDEICKFVLNYGPEKFDRVSMIGYSMGGLVSRFIIGKMVTECRDIFQHMEPMIFMTFA 122

Query: 302 TPLLGIVTDNPA-----YV------NILLSFG--IVGKTGQDLGLTELSKDXXXXXXXXX 348
           TP LG+    P+     YV      ++L   G  I+G++G ++ ++  +KD         
Sbjct: 123 TPHLGVNFYLPSDKTRRYVSRKILTSVLSGLGRTILGRSGAEIFIS--NKDDRILVDLSQ 180

Query: 349 XXXXXXVLRMFKRRTIYANAVNDGIVPLYSA 379
                 + R F  R  +AN  ND  V  Y++
Sbjct: 181 GEYLYGLSR-FHHRVCFANVKNDRTVAFYTS 210

>CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 457

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 103/226 (45%), Gaps = 38/226 (16%)

Query: 185 QKEHLVILTHGLHSNVHADMFYLKEQIE------KCQK------YYPEEQIVVKGFNGNV 232
           Q +HL +L HGL  N +  M  L++ ++      K  K      + P++    K F+G  
Sbjct: 3   QDKHLFVLIHGLWGN-YKHMKSLEKVLDATLNGKKSGKDKDYVFFLPKQNATFKTFDG-- 59

Query: 233 CKTEKGINYLGTR----LAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWF 288
                 I  +G R    L E++ KE     + KISF+G+SLGGLV  F +  ++ +    
Sbjct: 60  ------IEIIGYRTLLELCEFM-KEFKDGNITKISFVGYSLGGLVARFVVGKMYSECNDI 112

Query: 289 FQNVSPINFITLATPLLGIVTDNP-AYVNILLSFG--------IVGKTGQDLGLTELSKD 339
           F N+    F+T+ATP LGI   NP  Y++  L F         I+GK+G++L +   S D
Sbjct: 113 FGNIERCIFMTMATPHLGIQFYNPLGYLHRKLLFSTFTGLGSTILGKSGRELFIANSSND 172

Query: 340 XXXXXXXXXXXXXXXVLRMFKRRTIYANAVNDGIVPLYSASLLFLD 385
                           L  F  R ++AN  ND  V  ++  +  +D
Sbjct: 173 ---ILVRLSEGKYIEALEEFNHRILFANVKNDRTVAFFTGFIADVD 215

>AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp,
           504 aa]
          Length = 504

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 91/198 (45%), Gaps = 15/198 (7%)

Query: 188 HLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYLGTRLA 247
           HLV L HGL  NV   M YL   + + Q+  PE  +V         +T  GI+  G R+A
Sbjct: 5   HLVFLVHGLWGNV-THMEYLGRAVSQLQERSPETLVVYAAKMNQGYRTYDGIDICGYRVA 63

Query: 248 EYIVKELY-------HERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITL 300
           + I +++           V K S +G+S+GGL+  +A+  ++    +  Q++  INF T 
Sbjct: 64  KEIQEQVATLNCPETGTVVTKFSIVGYSMGGLISRYAVGLLYSNQFFKKQDIKLINFTTF 123

Query: 301 ATPLLGIVTDNPAYVNILLSFG---IVGKTGQDLGLTELSKDXXXXXXXXXXXXXXXV-- 355
            +P +G++         + +F    I+G +G+ + L +  K                +  
Sbjct: 124 CSPHVGVLAPGKNLAVRVFNFVCSLILGNSGRQMFLKDRIKAANGMPLIVLMSVGDSIFY 183

Query: 356 --LRMFKRRTIYANAVND 371
             L  F+ R++YAN VND
Sbjct: 184 KALEQFQHRSLYANIVND 201

>YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.7873p [1353 bp, 450 aa]
          Length = 450

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 108/230 (46%), Gaps = 38/230 (16%)

Query: 187 EHLVILTHGLHSN-VHADMFYL-------KEQIEKCQKYY-PEEQIVVKGFNGNVCKTEK 237
           +HL +L HGL  N  H +           KE +     Y+ P++  + K F+G       
Sbjct: 5   KHLFVLIHGLWGNYTHMESMRTILSTTLKKEDVNDDMIYFLPKQNAMFKTFDG------- 57

Query: 238 GINYLGTR----LAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVS 293
            I  +G R    + E+I ++    ++ K+S +G+S GGLV  F I  +  ++   F+++ 
Sbjct: 58  -IEIIGYRTLIEVCEFI-RDYKDGKITKLSVMGYSQGGLVARFMIGKMLTEFKELFEDIE 115

Query: 294 PINFITLATPLLGIVTDNP---AYVNIL------LSFGIVGKTGQDLGLTELSKDXXXXX 344
           P  FIT+ATP LG+   NP   AY + L      L   I+GK+G+++ +   S +     
Sbjct: 116 PQLFITMATPHLGVEFYNPTGIAYKSALYSALRTLGSTILGKSGREMFIANSSNN---IL 172

Query: 345 XXXXXXXXXXVLRMFKRRTIYANAVNDGIVPLYSASLL----FLDYEDVL 390
                      L +FK R  +AN  ND  V  Y+A +     F+D+++ L
Sbjct: 173 VKLSQGEYLEALSLFKWRIAFANVKNDRTVAFYTAFITDCDPFIDFDNKL 222

>Kwal_55.21703
          Length = 441

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 99/225 (44%), Gaps = 32/225 (14%)

Query: 187 EHLVILTHGL-----HSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINY 241
           +HL +L HGL     H N   D+F       +   ++   Q      NG   KT  GI  
Sbjct: 4   KHLFVLVHGLWGNYKHMNAIRDVFAETFHDHENTLFFSPRQ------NGYF-KTFDGIEI 56

Query: 242 LGTR----LAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINF 297
           +G R    L  +I ++     + KISF+G+S+GGL+  F I  +  +    FQ + P  F
Sbjct: 57  MGYRTLLELCRFI-EQFPKGEITKISFVGYSMGGLIARFMIGKMFTECHELFQCIEPQLF 115

Query: 298 ITLATPLLGI--------VTDNPAYVNILLSFG--IVGKTGQDLGLTELSKDXXXXXXXX 347
           IT ATP LG+         +   A + IL + G  I+G+TG+ L + +   +        
Sbjct: 116 ITFATPHLGVHFFLKEDRASHRRALLRILSALGTTILGRTGRQLFIQDSLPEQSILVQLS 175

Query: 348 XXXXXXXVLRMFKRRTIYANAVNDGIVPLYSASLL----FLDYED 388
                  + R FK R   AN  ND  V  Y++ +     FLD E+
Sbjct: 176 SGEYLHGLAR-FKHRLCVANVKNDRTVAFYTSFITDCDPFLDSEN 219

>Kwal_27.10102
          Length = 258

 Score = 66.2 bits (160), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 95/202 (47%), Gaps = 24/202 (11%)

Query: 188 HLVILTHGLHSN-VHADMF--YLKEQIEKCQKYYPEEQIVV------KGFNGNVCKTEKG 238
           HLV+L HGL  N  H D     LKE  E  +    +E++VV      +G+     KT  G
Sbjct: 15  HLVVLVHGLWGNRSHLDYMSNALKESFESREDTCSKEELVVYTPHLNEGY-----KTYDG 69

Query: 239 INYLGTRLAEYIVKELYH-ERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINF 297
           I+  G R+A  I +++     V K S  G+SLGGL+  +A+  +H +  +  +++  +NF
Sbjct: 70  IDVCGVRVASEIEEQIVSLGSVTKFSICGYSLGGLISRYALGVLHKRQLFKKRDIQLVNF 129

Query: 298 ITLATPLLGIVTDNPAYVNILLSFGIV----GKTGQDLGLTELSKDXXXXXXXXXXXXXX 353
            T  TP +G+       V + L   IV    G +G+ + L +  K               
Sbjct: 130 TTFCTPHVGVYAPGKN-VAVRLYNAIVPLVLGSSGKQMFLKDKPKFSGELPLILSMSLEN 188

Query: 354 XV----LRMFKRRTIYANAVND 371
            +    L+ F+ +++YAN +ND
Sbjct: 189 SIFYKALQEFQTKSLYANVIND 210

>ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)
           [1332 bp, 443 aa]
          Length = 443

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 94/214 (43%), Gaps = 31/214 (14%)

Query: 186 KEHLVILTHGL---HSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYL 242
           K+HL +L HGL   HS++++      E +     +Y      V   NG V KT  GI  +
Sbjct: 4   KKHLFVLVHGLWGTHSHMNSIKTAFSEALGDDAVFY------VPRSNGYV-KTLHGIELV 56

Query: 243 G----TRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFI 298
           G      L E+ V+    ++  +ISFIG+S+GGLV  F I  I  +    F ++ P+ F+
Sbjct: 57  GYQTVVELTEF-VQARDPQKFDRISFIGYSMGGLVSRFVIGTIFTECRVIFGHMRPVLFM 115

Query: 299 TLATPLLGIVTDNP-----------AYVNILLSFG--IVGKTGQDLGLTELSKDXXXXXX 345
           T ATP LG+    P           A + +    G   +G++G+ L L   + D      
Sbjct: 116 TFATPHLGVQFYQPRNPQAKSTVMGAVLPVARFVGSHFLGRSGRQLFLAYENDDTLVRMT 175

Query: 346 XXXXXXXXXVLRMFKRRTIYANAVNDGIVPLYSA 379
                     L  F+ R   AN  ND  V  Y+A
Sbjct: 176 EGVYLEQ---LARFRHRVCLANVKNDRTVAFYTA 206

>KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF13423
           Candida albicans unknown function, start by similarity
          Length = 531

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 90/198 (45%), Gaps = 12/198 (6%)

Query: 186 KEHLVILTHGL-----HSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGIN 240
           K HLV+L HGL     H N   +            K   E  +V +       KT  GI+
Sbjct: 14  KIHLVVLVHGLWGNRSHMNEICNYLLSLNDSSAGHKSLNEMIVVHQTHLNEGYKTYDGID 73

Query: 241 YLGTRLAEYIVKELYH---ERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINF 297
             G R+++ I  ++ H   + V K S IG+SLGGL+  +A+  ++    +   ++  +NF
Sbjct: 74  VCGIRVSKEIKDQINHYGSDHVVKFSLIGYSLGGLICRYALGVLYQAQTFKKNDIELVNF 133

Query: 298 ITLATPLLGIVT-DNPAYVNI--LLSFGIVGKTGQDLGLTELSKDX-XXXXXXXXXXXXX 353
           IT  TP +G++   N   VN+  ++   ++G +G+ + L +                   
Sbjct: 134 ITFCTPHVGVLAPGNNVAVNLFNIIVPLVLGNSGKQMFLKDKYNGYPLLYVMSSPSSVFY 193

Query: 354 XVLRMFKRRTIYANAVND 371
             L+ FK R +YAN +ND
Sbjct: 194 KALKQFKYRALYANIIND 211

>Sklu_2393.4 , Contig c2393 3530-5170 reverse complement
          Length = 546

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 93/204 (45%), Gaps = 23/204 (11%)

Query: 188 HLVILTHGLHSN-VHADMFYLKEQIEKCQKYYP----------EEQIVVKGFNGNVCKTE 236
           HLV+L HGL  N  H D  Y+   I+   K +           EE +V         KT 
Sbjct: 10  HLVVLVHGLWGNGSHFD--YISNSIDTSLKTHDVFQPGGKLAGEEIVVYTTCLNEGYKTY 67

Query: 237 KGINYLGTRLAEYIVKELYH-ERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPI 295
            GI+  G R+A+ I  ++     V K S +G+SLGGL+  +A+  ++ K  +   ++  I
Sbjct: 68  DGIDVCGLRVAKEIEDQIETLGSVIKFSLVGYSLGGLIARYALGILYKKQLFKKHDIELI 127

Query: 296 NFITLATPLLGIVT--DNPA--YVNILLSFGIVGKTGQDLGLTELSKDXXXXXXXXXXXX 351
           NF T  TP +G+     N A    N ++ F ++G +G+ + L +  +             
Sbjct: 128 NFTTFCTPHVGVYAPGKNIAVNLFNTIVPF-VLGNSGKQMFLKDQVRSAGNLPLVYLMSM 186

Query: 352 XXXV----LRMFKRRTIYANAVND 371
              V    L+ FK + +YAN +ND
Sbjct: 187 ENSVFYKALQEFKYKALYANVIND 210

>Sklu_2232.4 YOR059C, Contig c2232 3289-4626
          Length = 445

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 96/220 (43%), Gaps = 42/220 (19%)

Query: 187 EHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYLGTR- 245
           +HL +L HGL  N +  M  +K    K   +  E  I          KT  GI  +G R 
Sbjct: 4   KHLFVLVHGLWGN-YKHMDSIKGVFSK--TFGDENVIFFAPKQNGYFKTFDGIEIVGYRT 60

Query: 246 ---LAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITLAT 302
              L E+I ++    ++ KISFIG+S+GGL+  F I  +  +    F+ ++   FIT AT
Sbjct: 61  LLELCEFI-RKYGVGKITKISFIGYSMGGLISRFIIGKMETECQELFEGINRQLFITFAT 119

Query: 303 PLLGI----------VTDNPAYVNILLSF---GIVGKTGQDL----------GLTELSKD 339
           P LG+           T +  +++ +LSF    ++G++G+ L           L +LS D
Sbjct: 120 PHLGVEFYLPKEKPLQTRSRRFLHSVLSFLGSTVLGRSGRQLFIRDKHSWDSTLVKLSSD 179

Query: 340 XXXXXXXXXXXXXXXVLRMFKRRTIYANAVNDGIVPLYSA 379
                           L  FK R   AN  ND  V  Y++
Sbjct: 180 EYLLG-----------LSAFKYRICIANVKNDRTVAFYTS 208

>Scas_698.39
          Length = 471

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 105/228 (46%), Gaps = 48/228 (21%)

Query: 183 THQKE-HLVILTHGLHSNVHADMFYLKEQIEKCQK----------YYPEEQIVVKGFNGN 231
           ++QK+ HL IL HGL  N +  M  LKE ++   +          + P +  + K F+G 
Sbjct: 11  SNQKDAHLFILLHGLWGN-YKHMESLKETLKNSIQDDTDRLPLVFFSPRQNAMFKTFDG- 68

Query: 232 VCKTEKGINYLGTRLAEYIVK--ELYHE-RVKKISFIGHSLGGLVQTFAIAYIHVKYP-- 286
                  +  +G R    I++  +L+ E +  K+S +G+S+GGL+  F I  +  K    
Sbjct: 69  -------VEVVGYRALIEIIQFIQLHPEFKFTKLSILGYSMGGLIARFLIGVMFDKNNDE 121

Query: 287 ---WFFQNVSPINFITLATPLLGIVTDNP------AYVNILLSF---GIVGKTGQDLGL- 333
                F+ + P  FIT ATP LGI   NP       ++N +L+     I+G +G+++ + 
Sbjct: 122 DEMKVFKGMEPQLFITFATPHLGIHFYNPLNNMLRTFLNPMLTLIGSNIIGVSGREMFIM 181

Query: 334 --TELSKDXXXXXXXXXXXXXXXVLRMFKRRTIYANAVNDGIVPLYSA 379
             TEL +                 L  FK R ++AN  ND  V  Y++
Sbjct: 182 RNTELVE--------LSSGKYLDALSKFKWRIVFANVKNDRTVAFYTS 221

>Kwal_47.18480
          Length = 573

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 187 EHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGIN 240
           +H+V L HG  +N+H D+FY  +Q E C++   E+   +   N   C  E GI 
Sbjct: 475 QHMV-LGHG-DANLHYDIFYTPDQFEMCKEAV-EKMARLTIMNEGTCSGEHGIG 525

>CAGL0J10736g 1046008..1047168 similar to sp|P38796 Saccharomyces
           cerevisiae YHR075c PPE1, start by similarity
          Length = 386

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 246 LAEYIVKE-LYHERVKKIS--FIGHSLGGLVQTFAIAYIHVK 284
           L EY V E L H   +K+S  FIGHSLGG + TF  + + ++
Sbjct: 169 LVEYFVSEKLKHLPTEKLSIIFIGHSLGGSICTFTYSKLSIE 210

>KLLA0B01397g complement(112771..114489) similar to ca|CA5942|CaDLD2
           Candida albicans D-lactate ferrycytochrome C
           oxidoreductase (by homology), start by similarity
          Length = 572

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 181 THTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGIN 240
           T T+   H+  L H    N+H D+FY  +Q E C++   E   V     G  C  E GI 
Sbjct: 467 TATYPLTHMT-LGHVGDGNIHYDIFYEPDQFEICKQLVAEINAVTLKNEG-TCSGEHGI- 523

Query: 241 YLGTRLAEYIVKELYHERV 259
             GT   +++  EL  + V
Sbjct: 524 --GTGKRKFLEDELGSDTV 540

>CAGL0H09218g complement(904209..905048) similar to sp|P53078
           Saccharomyces cerevisiae YGL224c, hypothetical start
          Length = 279

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 24/52 (46%)

Query: 41  LNSLWLKVRNIESFTFRAAYLMGPYLLYCDVRASDYHHSQRLFVSADQPTFE 92
           ++ LWL     ++   R   L+G   L+  +   DY+H++ L    D   FE
Sbjct: 154 IDKLWLFTNAYKNHALRCVRLLGIADLFDGITYCDYNHAESLICKPDPAAFE 205

>YNR008W (LRO1) [4591] chr14 (640395..642380) Diacylglycerol
           acyltransferase, has similarity to lecithin cholesterol
           acyl transferase (phosphatidylcholine-sterol
           O-acyltransferase) [1986 bp, 661 aa]
          Length = 661

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 13/82 (15%)

Query: 244 TRLAEYIVKELYHE-RVKKISFIGHSLGGLVQTFAIAYIHVKYP--------WFFQNVSP 294
           T+L E I  EL+H+   +K+  IGHS+G  +  + + ++  + P        W  +++  
Sbjct: 301 TKLKEQI--ELFHQLSGEKVCLIGHSMGSQIIFYFMKWVEAEGPLYGNGGRGWVNEHID- 357

Query: 295 INFITLATPLLGIVTDNPAYVN 316
            +FI  A  LLG     PA ++
Sbjct: 358 -SFINAAGTLLGAPKAVPALIS 378

>Kwal_27.10084
          Length = 385

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 25/62 (40%), Gaps = 3/62 (4%)

Query: 54  FTFRAAYLMGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKT 113
              R   L  PY + CD RA  Y H         Q    P +    +++T   L ++K+ 
Sbjct: 75  IALRTHLLQPPYSILCDYRAHVYTHEAAGLAILSQAMVTPVVPSNGNYMT---LQDIKRA 131

Query: 114 YV 115
           Y+
Sbjct: 132 YI 133

>CAGL0I05786g complement(547982..550024) some similarities with
           sp|P40345 Saccharomyces cerevisiae YNR008w LRO1,
           hypothetical start
          Length = 680

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 10/74 (13%)

Query: 251 VKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYP--------WFFQNVSPINFITLAT 302
           V+  Y    +K+  +GHS+G  V  + + ++  + P        W  +++   +FI +A 
Sbjct: 323 VELFYQSTGEKVCLVGHSMGSQVVFYFLKWVEAEGPEYGNGGKDWVAKHID--SFINVAG 380

Query: 303 PLLGIVTDNPAYVN 316
            LLG     PA ++
Sbjct: 381 TLLGAPKAVPALIS 394

>YEL046C (GLY1) [1382] chr5 complement(67629..68792) Threonine
           aldolase, required for glycine biosynthesis [1164 bp,
           387 aa]
          Length = 387

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 3/62 (4%)

Query: 54  FTFRAAYLMGPYLLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKT 113
              R   +  PY + CD RA  Y H         Q    P +    D++T   L ++K  
Sbjct: 77  IAIRTHLMQPPYSILCDYRAHVYTHEAAGLAILSQAMVVPVVPSNGDYLT---LEDIKSH 133

Query: 114 YV 115
           YV
Sbjct: 134 YV 135

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,404,279
Number of extensions: 923842
Number of successful extensions: 2773
Number of sequences better than 10.0: 40
Number of HSP's gapped: 2727
Number of HSP's successfully gapped: 47
Length of query: 659
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 551
Effective length of database: 12,857,365
Effective search space: 7084408115
Effective search space used: 7084408115
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)