Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.346067266234460.0
Sklu_1742.468566214320.0
ADL286W67267011421e-148
KLLA0E14894g66967210401e-132
Scas_669.156726849711e-122
YGL145W (TIP20)7017057947e-96
CAGL0E04972g6716667595e-91
Scas_714.36514109721.4
YOR191W (RIS1)161949684.5
Kwal_26.889378447666.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3460
         (662 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3460                                                         1332   0.0  
Sklu_1742.4 YGL145W, Contig c1742 3577-5634                           556   0.0  
ADL286W [1455] [Homologous to ScYGL145W (TIP20) - SH] complement...   444   e-148
KLLA0E14894g complement(1328372..1330381) similar to sp|P33891 S...   405   e-132
Scas_669.15                                                           378   e-122
YGL145W (TIP20) [1842] chr7 (230246..232351) Cytoplasmic protein...   310   7e-96
CAGL0E04972g complement(480678..482693) similar to sp|P33891 Sac...   296   5e-91
Scas_714.36                                                            32   1.4  
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    31   4.5  
Kwal_26.8893                                                           30   6.9  

>Kwal_23.3460
          Length = 672

 Score = 1332 bits (3446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/662 (98%), Positives = 651/662 (98%)

Query: 1   MLASIEDLKKIPDLMSDLERQREALAETLRSKTGEVNQSKVQVDDRSVQITKAADEILQA 60
           MLASIEDLKKIPDLMSDLERQREALAETLRSKTGEVNQSKVQVDDRSVQITKAADEILQA
Sbjct: 1   MLASIEDLKKIPDLMSDLERQREALAETLRSKTGEVNQSKVQVDDRSVQITKAADEILQA 60

Query: 61  RSTLDVDDLKKEYGALDILNDLSSLFSXXXXXXXXXXXLQRVSTIHASMMEQKEANVAQL 120
           RSTLDVDDLKKEYGALDILNDLSSLFS           LQRVSTIHASMMEQKEANVAQL
Sbjct: 61  RSTLDVDDLKKEYGALDILNDLSSLFSKKEANEAEEKALQRVSTIHASMMEQKEANVAQL 120

Query: 121 ELWHEEIKSAVAPLKSDRIVENLYGRFMVLLRQEADILIQALEKKLLESTWDGTSFDVGN 180
           ELWHEEIKSAVAPLKSDRIVENLYGRFMVLLRQEADILIQALEKKLLESTWDGTSFDVGN
Sbjct: 121 ELWHEEIKSAVAPLKSDRIVENLYGRFMVLLRQEADILIQALEKKLLESTWDGTSFDVGN 180

Query: 181 GEAVLDLRNLSQRLYHLWTLQLPKADENHIWNFQCIANNFKIKFVYHFNQQAMQQLQSVE 240
           GEAVLDLRNLSQRLYHLWTLQLPKADENHIWNFQCIANNFKIKFVYHFNQQAMQQLQSVE
Sbjct: 181 GEAVLDLRNLSQRLYHLWTLQLPKADENHIWNFQCIANNFKIKFVYHFNQQAMQQLQSVE 240

Query: 241 MYFKFLDKYLDQNSFKCVEIFSDASAGLPQTMVHQQFVNHVLTPIREKVSSTLTKISNDT 300
           MYFKFLDKYLDQNSFKCVEIFSDASAGLPQTMVHQQFVNHVLTPIREKVSSTLTKISNDT
Sbjct: 241 MYFKFLDKYLDQNSFKCVEIFSDASAGLPQTMVHQQFVNHVLTPIREKVSSTLTKISNDT 300

Query: 301 SSQALKTLIVLLSQIFIMDNALLKKHLYYGDGLIVMVPKSILDTWQNFEIETSVSQFQKL 360
           SSQALKTLIVLLSQIFIMDNALLKKHLYYGDGLIVMVPKSILDTWQNFEIETSVSQFQKL
Sbjct: 301 SSQALKTLIVLLSQIFIMDNALLKKHLYYGDGLIVMVPKSILDTWQNFEIETSVSQFQKL 360

Query: 361 TSTSLEKSGNDFAKLLRNLYTYFEPFFQIQNERLMDYKIKITNRIFMDLPNRYREALLTI 420
           TSTSLEKSGNDFAKLLRNLYTYFEPFFQIQNERLMDYKIKITNRIFMDLPNRYREALLTI
Sbjct: 361 TSTSLEKSGNDFAKLLRNLYTYFEPFFQIQNERLMDYKIKITNRIFMDLPNRYREALLTI 420

Query: 421 KGGKGVSYTDEEQFEKTLWKLHNLENIQSLLKEFETKLTFIQLTNYVNTATSSSYDTILS 480
           KGGKGVSYTDEEQFEKTLWKLHNLENIQSLLKEFETKLTFIQLTNYVNTATSSSYDTILS
Sbjct: 421 KGGKGVSYTDEEQFEKTLWKLHNLENIQSLLKEFETKLTFIQLTNYVNTATSSSYDTILS 480

Query: 481 DILERYDEALIAVRDSIIHRFKKMLSTALRNYFKLNEWASISSSPQQCSAELVIPLKVSS 540
           DILERYDEALIAVRDSIIHRFKKMLSTALRNYFKLNEWASISSSPQQCSAELVIPLKVSS
Sbjct: 481 DILERYDEALIAVRDSIIHRFKKMLSTALRNYFKLNEWASISSSPQQCSAELVIPLKVSS 540

Query: 541 RLIAMVDKFDLKPHVSLYIRNEVLNIIIHFLFDYVVNLNKFSEAGLQQLRLDFDALKNSL 600
           RLIAMVDKFDLKPHVSLYIRNEVLNIIIHFLFDYVVNLNKFSEAGLQQLRLDFDALKNSL
Sbjct: 541 RLIAMVDKFDLKPHVSLYIRNEVLNIIIHFLFDYVVNLNKFSEAGLQQLRLDFDALKNSL 600

Query: 601 NFPYSHTPQNAEEGAFLETISVLQLRHSHIDSSQRFLSGSYIKGKDFSAVRDFLKLRYST 660
           NFPYSHTPQNAEEGAFLETISVLQLRHSHIDSSQRFLSGSYIKGKDFSAVRDFLKLRYST
Sbjct: 601 NFPYSHTPQNAEEGAFLETISVLQLRHSHIDSSQRFLSGSYIKGKDFSAVRDFLKLRYST 660

Query: 661 DS 662
           DS
Sbjct: 661 DS 662

>Sklu_1742.4 YGL145W, Contig c1742 3577-5634
          Length = 685

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/662 (43%), Positives = 421/662 (63%), Gaps = 7/662 (1%)

Query: 4   SIEDLKKIPDLMSDLERQREALAETLRSKTGEVNQSKVQVDDRSVQITKAADEILQARST 63
           S++DL  +  L+  +  QRE LA  LR+K  E            V +   ++EI + +S 
Sbjct: 18  SVDDLLNVDRLIGQVNNQRERLALQLRTKKNEEEDFLEHFVLMDVTLVTISEEISKVKSV 77

Query: 64  LDVDDLKKEYGALDILNDLSSLFSXXXXXXXXXXXLQRVSTIHASMMEQKEANVAQLELW 123
            D+  L++++G L IL+ +++L             L  +  I     E  E +  Q    
Sbjct: 78  EDIKKLREKHGNLQILDRIAALLQLKEKKLSEKHDLDELQQI---CRELDEVDDHQDTEM 134

Query: 124 HEEIKSAVAPLKSD--RIVENLYGRFMVLLRQEADILIQALEKKLLESTWDGTSFDVGNG 181
           +E+ ++ +  L  D    +  +Y +F  LL  +   L  A E  LL S WD   F     
Sbjct: 135 YEKFQTRITSLACDDTSALGIVYAKFNKLLEDQGKTLSAAFEHNLLHSKWDTNHFLFAE- 193

Query: 182 EAVLDLRNLSQRLYHLWTLQLPKADENHIWNFQCIANNFKIKFVYHFNQQAMQQLQSVEM 241
           +++ +LR  S +LY L  L LP+ + N +WNF  IANNFKIKF+YHFN ++  +LQSVEM
Sbjct: 194 KSIKELRQQSTKLYRLNMLLLPQPNLNDLWNFHSIANNFKIKFIYHFNSKSQNELQSVEM 253

Query: 242 YFKFLDKYLDQNSFKCVEIFSDASAGLPQTMVHQQFVNHVLTPIREKVSSTLTKISNDTS 301
           YF+FLDKYL+QN F+C+EIF D  AG+ Q ++H+QF+NH+L PIR K++S+L KIS   S
Sbjct: 254 YFEFLDKYLEQNLFRCIEIFYDEHAGVTQELIHRQFINHILDPIRHKINSSLIKISETPS 313

Query: 302 SQALKTLIVLLSQIFIMDNALLKKHLYYGDGLIVMVPKSILDTWQNFEIETSVSQFQKLT 361
            + LK ++VL+SQIFI DNAL+KKH Y G GL  ++P ++L+TW NFE +++  Q+ KLT
Sbjct: 314 QENLKMMMVLISQIFINDNALVKKHYYDGVGLASLIPDTVLETWLNFETDSTKRQYDKLT 373

Query: 362 STSLEKSGNDFAKLLRNLYTYFEPFFQIQNERLMDYKIKITNRIFMDLPNRYREALLTIK 421
           S SL+K+G DF  LL+NLY+YFEPF+ I+ ER ++YKIKITN+IFM+LP+ YR  +L   
Sbjct: 374 SASLKKNGTDFRTLLQNLYSYFEPFYNIEYERFLNYKIKITNQIFMELPDSYRRYVLNFN 433

Query: 422 GGKG-VSYTDEEQFEKTLWKLHNLENIQSLLKEFETKLTFIQLTNYVNTATSSSYDTILS 480
             +G VS ++E + E+ LWKL NL  I   L  FE K+ FI LT+ +N  T SSY T+  
Sbjct: 434 EERGSVSKSEEAKLEENLWKLQNLITINKTLMVFENKVNFIDLTSKLNHLTDSSYRTLFQ 493

Query: 481 DILERYDEALIAVRDSIIHRFKKMLSTALRNYFKLNEWASISSSPQQCSAELVIPLKVSS 540
           ++ +RY++A+   RDSI+HR K+ LS+ LR YFKLN W+S++SSP+QCS+ELV  +   +
Sbjct: 494 EVQQRYEQAITTARDSIVHRIKRKLSSLLRVYFKLNNWSSVTSSPEQCSSELVGAINAMN 553

Query: 541 RLIAMVDKFDLKPHVSLYIRNEVLNIIIHFLFDYVVNLNKFSEAGLQQLRLDFDALKNSL 600
           +++A +   +L   V  YI+ EVLN+IIHF+ DYVV LNKFSE GL+QL +D+++LK +L
Sbjct: 554 KIVASIQLHELSGDVVYYIKIEVLNVIIHFILDYVVKLNKFSEMGLKQLIMDYESLKGTL 613

Query: 601 NFPYSHTPQNAEEGAFLETISVLQLRHSHIDSSQRFLSGSYIKGKDFSAVRDFLKLRYST 660
                  P NAEEGA LET+ +L+L++ H    + F++ +YI   DF   +  +K+RYS 
Sbjct: 614 KLEMVGFPTNAEEGALLETVEILKLKYQHDKRHENFINRAYIDRGDFRDFKKLMKIRYSI 673

Query: 661 DS 662
           D 
Sbjct: 674 DG 675

>ADL286W [1455] [Homologous to ScYGL145W (TIP20) - SH]
           complement(199673..201691) [2019 bp, 672 aa]
          Length = 672

 Score =  444 bits (1142), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 258/670 (38%), Positives = 396/670 (59%), Gaps = 21/670 (3%)

Query: 2   LASIEDLKKIPDLMSDLERQREALAETLRSKTGEVNQSKVQVDDRSV---QITKAADEIL 58
           + S+EDL ++   +  LE++R+ +A  +++      +   QVDD      ++   A+EI 
Sbjct: 1   MNSVEDLLQLQPKIDALEKERDDIARKVQAVARTEGE---QVDDFEALNSKLAGIAEEIS 57

Query: 59  QARSTLDVDDLKKEYGALDILNDLSSLFSXXXXXXXXXXXLQRVSTIHASMMEQKEANVA 118
            AR+  DV  L+  YG L IL+   +L                ++ +   +    E +  
Sbjct: 58  GARTLEDVQRLRDNYGELAILDRAETLLREREAGERRAQNACTLAAVTEKLGRAAELDYC 117

Query: 119 QLELWHEEIKSAVAPLKSDRIVENLYGRFMVLLRQEADILIQALEKKLLESTWDGTSFDV 178
            LE  H E++    PL           +F  LL + A +  + LE +LLE   D   F V
Sbjct: 118 DLEALHAELE----PLARSADAAPQVEQFNELLTERARVPRRDLEHELLERRCDTELF-V 172

Query: 179 GNGEAVLDLRNLSQRLYHLWTLQLPKADENHIWNFQCIANNFKIKFVYHF-NQQAMQQLQ 237
              ++V +LR  +  L+ L  L LP+   + +WNF C+ANNF+IKF+YHF +  A  + Q
Sbjct: 173 STDDSVHELREKAGLLFQLSQLLLPEPRADQLWNFVCMANNFRIKFIYHFTSPSAESEQQ 232

Query: 238 SVEMYFKFLDKYLDQNSFKCVEIFSDASAGLPQTMVHQQFVNHVLTPIREKVSSTLTKIS 297
           S+E YFKFLDKYL +N +K ++IF D S G+ +T++H+QF+NH+L P+REKV+ T+TKI+
Sbjct: 233 SIENYFKFLDKYLSENLYKYMDIFEDESKGITRTLIHKQFINHILEPVREKVNVTMTKIA 292

Query: 298 NDTSSQALKTLIVLLSQIFIMDNALLKKHLYYGDGLIVMVPKSILDTWQNFEIETSVSQF 357
              S+  +K L++L+S+IFI DNAL K H Y G GL+ ++ ++ L+ WQNFE+E++VSQF
Sbjct: 293 ASNSASDVKMLVLLISEIFITDNALKKSHYYDGVGLVSLIDEAALEVWQNFEVESAVSQF 352

Query: 358 QKLTSTSLE----KSGNDFAKLLRNLYTYFEPFFQIQNERLMDYKIKITNRIFMDLPNRY 413
           +KLT+        K+G DF KLL N+Y Y EPFF I    L   K ++ + IF+ LP +Y
Sbjct: 353 EKLTTPGASLMSPKNGADFGKLLENMYRYLEPFFSIDYRNLFSVKYQLVDEIFIQLPLKY 412

Query: 414 REALLTIKGGKGVSYTDEEQFEKTLWKLHNLENIQSLLKEFETKLTFIQLTNYVNTATSS 473
           R  LL+ K       T E+QFE T  KLH+L  I ++L  F    TFI++T  +N  T S
Sbjct: 413 RSFLLS-KNILQNELTAEQQFENTCVKLHSLLLISNILVRFSHDFTFIEMTQQINKITDS 471

Query: 474 SYDTILSDILERYDEALIAVRDSIIHRFKKMLSTALRNYFKLNEWASISSSPQQCSAELV 533
            Y+ I  ++ E YDEA+I +RDSI+HR+ K LS++LRNYFK NEW SI+++P+QCSAELV
Sbjct: 472 DYEYIFDEVWESYDEAVIVLRDSIVHRWVKGLSSSLRNYFKYNEWDSIATAPEQCSAELV 531

Query: 534 IPLKVSSRLIAMVDKFDLKPHVSLYIRNEVLNIIIHFLFDYVVNLNKFSEAGLQQLRLDF 593
             L    ++  + DK+    H+   I+  +L  II F+ +YVV LNKFSE GL+QL  D+
Sbjct: 532 GALAWMKKMTDIFDKYWYPQHIIAQIKVALLENIIKFMLNYVVKLNKFSENGLRQLTFDY 591

Query: 594 DALKNSLNFPYSHTPQNAEEGAFLETISVLQLRHSHIDSSQRFLSGSYIKG---KDFSAV 650
           +AL+ +L  P  H+   AEE A  E  ++L +++++   + +FL   Y+     ++F  +
Sbjct: 592 EALRATLGLPLEHSSV-AEELALFEYFNILSMKYTNNKITSKFLDAEYVSSHHTRNFREL 650

Query: 651 RDFLKLRYST 660
           R+ L++ + T
Sbjct: 651 RESLQVSHLT 660

>KLLA0E14894g complement(1328372..1330381) similar to sp|P33891
           Saccharomyces cerevisiae YGL145w TIP20 required for ER
           to Golgi transport singleton, start by similarity
          Length = 669

 Score =  405 bits (1040), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 240/672 (35%), Positives = 392/672 (58%), Gaps = 23/672 (3%)

Query: 1   MLASIEDLKKIPDLMSDLERQREALAETLRSKTGEVNQSKVQVDDRSVQITKAADEILQA 60
           ML SI+DL  I   + ++  +R+ LAE L+    E +    Q+D    ++  A  EI   
Sbjct: 1   MLQSIQDLINIDSHIKEVSSKRDELAERLKQLKDEEDDFINQMDLIEKRLDDATAEISSI 60

Query: 61  RSTLDVDDLKKEYGALDILNDLSSLFSXXXXXXXXXXXLQRVSTIHASMMEQKEANVAQL 120
            +   ++ L+ +YG L +L+ + +LF            ++ +  +    ++        +
Sbjct: 61  SNIAHIEPLRLKYGRLQVLDQIENLFRQKEVFRHETEVIEEIEKVSTEQLQS-------V 113

Query: 121 ELWH-EEIKSAVAPLKSDRIVENLYGRFMVLLRQEADILIQALEKKLLESTWDGTSFDVG 179
           +L H   +K  +  L  + +   +  RF  LL   A  L++  ++ LL S WD T + V 
Sbjct: 114 DLEHLSTLKQRIVSLGIESM--EVITRFNSLLEAIAKELMEKFKQDLLNSKWD-TDYFVS 170

Query: 180 NGEAVLDLRNLSQRLYHLWTLQLP-KADEN---HIWNFQCIANNFKIKFVYHFN----QQ 231
           + + + D+R  S  L++L TL L   +D+N     WNFQ I++NF IKF+YHF+    + 
Sbjct: 171 SKKIIHDIRQQSSTLFNLQTLWLDDSSDDNENRQYWNFQGISHNFLIKFMYHFSNPKFED 230

Query: 232 AMQQLQSVEMYFKFLDKYLDQNSFKCVEIFSDASAGLPQTMVHQQFVNHVLTPIREKVSS 291
           + QQ QS+E+YFKFLD+YL+   F+C++IF D  +GL +  VH+QF+NH L PIR K++ 
Sbjct: 231 SGQQKQSIELYFKFLDRYLETKLFRCIDIFCDEKSGLTKEFVHEQFINHTLNPIRNKITQ 290

Query: 292 TLTKISNDTSSQALKTLIVLLSQIFIMDNALLKKHLYYGDGLIVMVPKSILDTWQNFEIE 351
           TL  IS + +++ L+T+IVL+SQIFI DNAL+KKH Y G GL+ ++P  +L+ W  FE++
Sbjct: 291 TLLNISENQTNENLRTMIVLISQIFINDNALIKKHYYTGIGLVSLLPTKVLEAWLEFELD 350

Query: 352 TSVSQFQKLTSTSLEKSGNDFAKLLRNLYTYFEPFFQIQNERLMDYKIKITNRIFMDLPN 411
           +++ Q++K+ S++L  +G D  KLL ++Y YFEP F I    L  YK++I +RIF++L +
Sbjct: 351 STLDQYEKIVSSALLTNGADLVKLLESMYQYFEPCFNIDYYHLNSYKLQIVSRIFLELVS 410

Query: 412 RYREALLTIKGGKGVSYTDEEQFEKTLWKLHNLENIQSLLKEFETKLTFIQLTNYVNTAT 471
           RY + +++      +   +E+Q E T  KLHN+  ++  + E   K  FI+LT   N  +
Sbjct: 411 RYNKFIISPDPALSL-LPEEKQLEITFLKLHNIVLLEQCVSELRFKPAFIELTYIFNKLS 469

Query: 472 SSSYDTILSDILERYDEALIAVRDSIIHRFKKMLSTALRNYFKLNEWASISSSPQQCSAE 531
           +S+Y +I ++     +E ++ VR+SIIHR+KK+L  +L  YF+L++W  IS+ P QCS E
Sbjct: 470 NSTYPSIFTESFSALEETVVTVRESIIHRWKKILKASLSPYFRLSKWQEISNPPAQCSTE 529

Query: 532 LVIPLKVSSRLIAMVDKFDLKPHVSLYIRNEVLNIIIHFLFDYVVNLNKFSEAGLQQLRL 591
           L+  ++ SS+L A      L  ++S+ I + +L   I +L DYVV +N FSE GL+Q+ L
Sbjct: 530 LIGAIQKSSKLKAEFALLKLPTNISISIFHGLLTQWIFYLKDYVVKVNNFSENGLKQVML 589

Query: 592 DFDALKNSLNFPYSHTPQNAEEGAFLETISVLQLRHSHIDSSQRFLSGSYI-KGKDFSAV 650
           D+  LK  L       PQ  +E  F E + VL L+++       FLS  Y+ + +D+  V
Sbjct: 590 DYGELKTVLQL--DDVPQCVQEEEFEEFMKVLSLKYNGKSQVLPFLSKGYMSQSQDYLEV 647

Query: 651 RDFLKLRYSTDS 662
           RD L L+Y ++S
Sbjct: 648 RDALGLKYISNS 659

>Scas_669.15
          Length = 672

 Score =  378 bits (971), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 245/684 (35%), Positives = 382/684 (55%), Gaps = 49/684 (7%)

Query: 1   MLASIEDLKKIPDLMSDLERQREALAETLR-SKTGEVNQSKVQVDDRSVQITKAADEILQ 59
           ML  I DL  I   + D++ QR  LA  L+ ++   ++  K Q+ DRS  I  AAD I +
Sbjct: 1   MLNDINDLLAIDSKIEDIKDQRTQLATLLQNAQQNNISLIKPQLRDRSENI--AADIISR 58

Query: 60  ARSTLDVDDLKKEYGALDILNDLSSLFSXXXXXXXXXXXLQRVSTIHASMMEQKEANVAQ 119
           A S   V +LKK+YG+LD+L++L  L+            L+     H     +K  N+  
Sbjct: 59  AHSLSGVQELKKQYGSLDVLDELEQLYEKQETLNNAKIDLE-----HLKTEIKKLGNLDI 113

Query: 120 LEL-W------HEEIKSAVA--------PLKSDRIVENLYGRFMVLLRQEADILIQALEK 164
           LEL W      H++IK+ +          L  D++  N       ++ + A+ +    ++
Sbjct: 114 LELSWETVLELHDKIKATIELVEKDPTEKLSIDQVTSNFNDN---VITRWANSISNDFKQ 170

Query: 165 KLLESTWDGTSFDVGNGEAVLDLRNLSQRLYHLWTLQLPKADENHIWNFQCIANNFKIKF 224
            LLES WD         + +  LR  S  LY +  L L  AD N +WNFQCIANNFKI+F
Sbjct: 171 LLLESKWDANQCTTPEHDLIDKLRETSSLLYKISLLYLNTADSN-LWNFQCIANNFKIRF 229

Query: 225 VYHFNQQAMQQLQSVEMYFKFLDKYLDQNSFKCVEIFSDASAGLPQTMVHQQFVNHVLTP 284
           +YHF++ +      +E+YFKFL+ YL +N +KC+ IF D + G+ +  +H++F+N+VL P
Sbjct: 230 LYHFHESSAM----IEIYFKFLNDYLTENLYKCINIFHDEANGITEQKIHEEFINYVLQP 285

Query: 285 IREKVSSTLTKISNDTSSQALKTLIVLLSQIFIMDNALLKKHLYYGDGLIVMVPKSILDT 344
           IR+KV STL++  ND     LKTLI+L+SQI   D  L     Y G GL+ ++P    D 
Sbjct: 286 IRDKVQSTLSQ--ND-----LKTLIILISQIIFTDKNLSTSFHYTGKGLVSLLPDESWDK 338

Query: 345 WQNFEIETSVSQFQKLT--STSLEKSGNDFAKLLRNLYTYFEPFFQIQNERLMDYKIKIT 402
           W  +EIE +  QF+ +T     L KS +DF K+L+  Y Y EPF+Q++ E L  YK+K  
Sbjct: 339 WLTYEIEATTKQFETITQNPVDLSKSADDFNKILKKTYEYLEPFYQLEYEPLETYKLKTC 398

Query: 403 NRIFMDLPNRYREALLTIKGGKGVSYTDEEQFEKTLWKLHNLENIQSLLKEFETKLTFIQ 462
           ++IFM L + Y + +LT     G   T E++  +T+ KL  L  +   + E      FI+
Sbjct: 399 SQIFMKLSSSYLDYVLT-TDSLGEKRTKEKELYQTIIKLQCLNIVYRKIYELSENPVFIR 457

Query: 463 LTNYVNTATSSSYDTILSDILERYDEALI-AVRDSIIHRFKKMLSTALRNYFKLNEWASI 521
           LTN VN    S+Y ++  +IL  Y   ++  +++SIIHR KK++  +L+NYFKL  W+++
Sbjct: 458 LTNMVNEIEGSNYFSVFQNILNDYQTDMVDDIQNSIIHRVKKLIKESLQNYFKLKTWSNL 517

Query: 522 ---SSSPQQCSAELVIPLKVSSRLIAMVDKFDLKPHVSLYIRNEVLNIIIHFLFDYVVNL 578
              S + +  S+ELV  + + +R+I  VD  D+   + L I+NE+LNII+++  + ++ L
Sbjct: 518 ENPSENMESASSELVNTINLLNRVINSVDSRDIPSPIILNIKNELLNIIVNYFVESILKL 577

Query: 579 NKFSEAGLQQLRLDFDALKNSLNFPYSHTPQNAEEGAFLETISVLQLRHSHIDSSQRFLS 638
           NKF++ GL Q  +DF +L+++LN P +    NA+E   LE + VL +R+      + FLS
Sbjct: 578 NKFNQQGLSQFNIDFCSLRDTLNLPTNII--NAKESNLLELLKVLTIRYDQ--KGETFLS 633

Query: 639 GSYIKGKDFSAVRDFLKLRYSTDS 662
            +YI    F  +R  L L++  DS
Sbjct: 634 KTYINAGAFDDLRKRLSLQHLDDS 657

>YGL145W (TIP20) [1842] chr7 (230246..232351) Cytoplasmic protein
           required for ER to Golgi transport, interacts physically
           with Sec20p [2106 bp, 701 aa]
          Length = 701

 Score =  310 bits (794), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 216/705 (30%), Positives = 375/705 (53%), Gaps = 63/705 (8%)

Query: 2   LASIEDLKKIPDLMSDLERQREALAETLRSKTGEVNQSKVQVDDRSVQITKA-ADEILQA 60
           +  I+DL  I D +  ++ +R  LA    SK   + QS +  +D  V +++  A +I++ 
Sbjct: 1   MNGIDDLLNINDRIKQVQNERNELA----SKLQNLKQS-LASNDTEVALSEVIAQDIIEV 55

Query: 61  RSTLD-VDDLKKEYGALDILNDLSSLFSXXXXXXXXXXXLQRVSTIHASMMEQK--EANV 117
            ++++ ++ L+ +YG L ILN L  +             L         + EQ   +  +
Sbjct: 56  GASVEGLEQLRAKYGDLQILNKLEKVAVQQTQMQAGVDKLDSFERQLDELAEQPPDQFTL 115

Query: 118 AQLELWHEEIKSAVAPLKSDRIVENLYGRFMVLLRQEA----DILIQAL--------EKK 165
             ++  H ++ S  A +     +++ Y  +  L  +      D++IQ L        ++K
Sbjct: 116 DDVKALHSKLTSVFATVPQINNIDSQYAAYNKLKSKVTGKYNDVIIQRLATNWSNTFDQK 175

Query: 166 LLESTWDGTSFDVGNGEAVLDLRNLSQRLYHLWTLQLPKADENH---------------- 209
           LLE+ WD   F   +   V  LR  S +LY L  L LP  +E                  
Sbjct: 176 LLEAQWDTQKFASTSVGLVKCLRENSTKLYQLSLLYLPLEEETQNGDSERPLSRSNNNQE 235

Query: 210 --IWNFQCIANNFKIKFVYHFNQQAMQQLQSVEMYFKFLDKYLDQNSFKCVEIFSDASAG 267
             +WNF+ +ANNF ++F YHF   A      +E YF+FL+ YL +N +KC+ IF D   G
Sbjct: 236 PVLWNFKSLANNFNVRFTYHF--HATSSSSKIETYFQFLNDYLAENLYKCINIFHDDCNG 293

Query: 268 LPQTMVHQQFVNHVLTPIREKVSSTLTKISNDTSSQALKTLIVLLSQIFIMDNALLKKHL 327
           L + ++H+QF+N+VL PIR+KV STL    ND     LKTLIVL+SQI   D  LL    
Sbjct: 294 LTKPVIHEQFINYVLQPIRDKVRSTL--FQND-----LKTLIVLISQILATDKNLLNSFH 346

Query: 328 YYGDGLIVMVPKSILDTWQNFEIETSVSQFQKLTSTS--LEKSGNDFAKLLRNLYTYFEP 385
           Y+G GL+ ++   + + W N+E+E +  QF  +T       KS  +F KL+  +Y Y EP
Sbjct: 347 YHGLGLVSLISDEVWEKWINYEVEMANRQFINITKNPEDFPKSSQNFVKLINKIYDYLEP 406

Query: 386 FFQIQNERLMDYKIKITNRIFMDLPNRYREALLTIKGGKGVSYTDEEQFEKTLWKLHNLE 445
           F+ +  + L+ YK+   + IFM+L + Y + +LT+      + T E++  +T+ KL ++ 
Sbjct: 407 FYDLDFDLLVRYKLMTCSLIFMNLTSSYLDYILTV-DSLNETRTKEQELYQTMAKLQHVN 465

Query: 446 NIQSLLKEFETKLTFIQLTNYVNTATSSSYDTILSDILERYDEALIA-VRDSIIHRFKKM 504
            +   +K   +   FIQLT+ VN+  S  Y+++  ++   Y++A+   +++SI+HR +K+
Sbjct: 466 FVYRKIKSLSSNFIFIQLTDIVNSTESKKYNSLFQNVENDYEKAMSTDMQNSIVHRIQKL 525

Query: 505 LSTALRNYFKLNEWASISSSPQQ-------CSAELVIPLKVSSRLIAMVDKFDLKPHVSL 557
           L   LRNYFK++ W+++  S  +        SAELV  + V  RLI  +D  D+   +SL
Sbjct: 526 LKETLRNYFKISTWSTLEMSVDENIGPSSVPSAELVNSINVLRRLINKLDSMDIPLAISL 585

Query: 558 YIRNEVLNIIIHFLFDYVVNLNKFSEAGLQQLRLDFDALKNSLNFPYSHTPQNAEEGAFL 617
            ++NE+LN+I+++  + ++ LNKF++ GL Q   DF +L + L+ P   T  N +  +  
Sbjct: 586 KVKNELLNVIVNYFTESILKLNKFNQNGLNQFLHDFKSLSSILSLPSHAT--NYKCMSLH 643

Query: 618 ETISVLQLRHSHIDSSQRFLSGSYIKGKDFSAVRDFLKLRYSTDS 662
           E + +L+L++    ++Q+FL+  YIK  +F+++++   ++Y  D+
Sbjct: 644 ELVKILKLKYD--PNNQQFLNPEYIKTGNFTSLKEAYSIKYLKDT 686

>CAGL0E04972g complement(480678..482693) similar to sp|P33891
           Saccharomyces cerevisiae YGL145w TIP20 required for ER
           to Golgi transport, start by similarity
          Length = 671

 Score =  296 bits (759), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 198/666 (29%), Positives = 350/666 (52%), Gaps = 37/666 (5%)

Query: 1   MLASIEDLKKIPDLMSDLERQREALAETLRSKTGEVNQSKVQVDDRSVQITKAADEILQA 60
           ML  I DL  +   + ++E++R  LA  L +    V   K+  +  S+ +   A+ IL A
Sbjct: 1   MLNDINDLLDLEKHIDEIEQKRNTLANELETYRNGVVTRKIHEEQESIDL--LAERILAA 58

Query: 61  RSTLD-VDDLKKEYGALDILNDLSSLFSXXXXXXXXXXXLQRVSTIHASMMEQKEANVAQ 119
              L+ ++ LK E+G L IL +L +              LQ++      ++E  + N   
Sbjct: 59  TDNLEAIEQLKTEFGELRILKELETDIKNRNKKKETVDELQKLEPELNEVIESNDENTIT 118

Query: 120 LELWHEEIKSAVAPLKSDRIVE-NLYGRFMV------LLRQEADILIQALEKKLLESTWD 172
             + +  +   ++ + +D ++  + Y ++ +      L+R      +  L+ KLL+S WD
Sbjct: 119 DSIIN--LHDKISLICNDEVIHLDDYIQYFIFKFEDELVRPVISTKMNELQDKLLKSYWD 176

Query: 173 GTSFDVGNGEAVLDLRNLSQRLYHLWTLQLPKADENHIWNFQCIANNFKIKFVYHFNQQA 232
               +      + DLR+ S  L+ L       + E  + N + IANNFK++F YHF+   
Sbjct: 177 NQKKNSLTTNQINDLRSKSSELFRLNNCLFNNSSE-PLANMKAIANNFKVRFTYHFHNST 235

Query: 233 MQQLQSVEMYFKFLDKYLDQNSFKCVEIFSDASAGLPQTMVHQQFVNHVLTPIREKVSST 292
                 +E YFKFL  YL +N ++C+ IF D S GL + ++HQ+F+N+VL PIREK+ ST
Sbjct: 236 T----DIETYFKFLKDYLHENLYQCISIFYDPSVGLSKAIIHQEFINNVLNPIREKIRST 291

Query: 293 LTKISNDTSSQALKTLIVLLSQIFIMDNALLKKHLYYGDGLIVMVPKSILDTWQNFEIET 352
           L       S+  LK+ I L+SQI   D  L K   Y G GL  ++     + W N+E E 
Sbjct: 292 L-------STNDLKSAIFLISQILATDKILSKTFHYQGSGLASLISDDQWEKWINYEEEI 344

Query: 353 SVSQFQKLTSTS---LEKSGNDFAKLLRNLYTYFEPFFQIQNERLMDYKIKITNRIFMDL 409
           +  QF  +T  +   L +S N+F +L++  Y Y EP   ++ +    +K++  + IF++L
Sbjct: 345 TKKQFSSITGNTEKELLQSANNFNELIKKTYVYLEPLLTLEYDPAQKFKLQCCSNIFLNL 404

Query: 410 PNRYREALLTIKGGKGVSYTDEEQFEKTLWKLHNLENIQSLLKEFETKLTFIQLTNYVNT 469
            + Y E  L +    G   + +E+ ++TL KL+NL  + + + E +    F+ LT+ VN 
Sbjct: 405 FSMYLEHTLAV-DTLGEKRSKDEELQQTLIKLNNLCIVANKIIELQGMEPFVLLTDIVNR 463

Query: 470 ATSSSYDTILSDILERYDEAL-IAVRDSIIHRFKKMLSTALRNYFKLNEWASISSSPQ-- 526
             + +Y ++  DIL  Y++ + I ++ SI+HR +K+L   LRNYFK+  W++  S  +  
Sbjct: 464 NEAKNYISVFQDILNDYEQNIQIDIQRSIVHRLQKLLKDTLRNYFKITGWSTDYSQEELT 523

Query: 527 QCSAELVIPLKVSSRLIAMVDKFDLKPHVSLYIRNEVLNIIIHFLFDYVVNLNKFSEAGL 586
             S+E++  + + +R+   +D   + P + + I+N++LN+++ +  + ++ LNKF++ GL
Sbjct: 524 TPSSEIIAAINLLTRIFIKIDTLQVPPSIVIQIKNDILNVLVLYFTESILKLNKFNKRGL 583

Query: 587 QQLRLDFDALKNSLNFPYSHTPQNAEEGAFLETISVLQLRHSHIDSSQ-RFLSGSYIKGK 645
            Q  LDF+ LK+ L+ PY +   N +E    E + +L+L++   DS+Q  F    YIK  
Sbjct: 584 LQFELDFNKLKDCLSLPYDNF--NFKERMLTEILHILRLKY---DSAQSHFYEKQYIKQG 638

Query: 646 DFSAVR 651
            +  +R
Sbjct: 639 LYDDLR 644

>Scas_714.36
          Length = 514

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 7/109 (6%)

Query: 318 MDNALLKKHLYYGDGLIVMVPKSILDTWQNFE-IETSVSQFQKLTST-SLEKSGNDFAKL 375
           M+  +L  +L YG GLIV +  S +   ++F+ +E  V +F  +  T   E +  D A+ 
Sbjct: 1   MNRYILLPYLIYGLGLIVALQPSYIHPDEHFQSLEILVQKFWHIKGTIPWEFTPTDAARS 60

Query: 376 LRNLYTYFEPFFQIQNERLMDYKIKITNRIFMDLPNRYREALLTIKGGK 424
              LY  + P F      L+ Y + + N +++    R +  +L I   K
Sbjct: 61  YVPLYLTYGPLFS-----LLRYVLHVNNPMWILYCARVQNLILYIITFK 104

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 334  IVMVPKSILDTWQNFEIETSVSQFQKLTSTSLEKSGNDFAKLLRNLYTY 382
            +++ P S+L  W+  E+ET V +  K T+     SGN   K  R+L  Y
Sbjct: 997  LIVAPVSVLRVWKG-ELETKVKKRAKFTTFIFGGSGNGKVKHWRDLARY 1044

>Kwal_26.8893
          Length = 784

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 251 DQN-SFKCVEIFSDASAGLPQTM--VHQQFVNHVLTPIREKVSSTLT 294
           DQN  F+ +E   DA AG    +  +  +F N+V+TP+RE+++  L 
Sbjct: 48  DQNVHFEPMEFEDDALAGASSQVERLRLKFKNYVVTPVRERITDPLA 94

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,238,088
Number of extensions: 850480
Number of successful extensions: 3299
Number of sequences better than 10.0: 49
Number of HSP's gapped: 3384
Number of HSP's successfully gapped: 49
Length of query: 662
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 554
Effective length of database: 12,857,365
Effective search space: 7122980210
Effective search space used: 7122980210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)