Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.34581531526215e-84
Sklu_1742.31541533724e-46
Scas_613.23*1371142881e-33
YDL110C1501142681e-30
CAGL0H10362g1491122482e-27
KLLA0E09229g1601212291e-24
AGR378C1171121687e-16
KLLA0C10802g167221631.8
YDL176W708111622.7
Sklu_2135.336274603.7
CAGL0K00297g62782579.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3458
         (152 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3458                                                          243   5e-84
Sklu_1742.3 YDL110C, Contig c1742 2887-3351 reverse complement        147   4e-46
Scas_613.23*                                                          115   1e-33
YDL110C (YDL110C) [759] chr4 complement(264512..264964) Protein ...   107   1e-30
CAGL0H10362g 1009858..1010307 similar to tr|Q12513 Saccharomyces...   100   2e-27
KLLA0E09229g complement(827035..827517) similar to sgd|S0002268 ...    93   1e-24
AGR378C [4689] [Homologous to ScYDL110C - SH] (1426104..1426457)...    69   7e-16
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    29   1.8  
YDL176W (YDL176W) [696] chr4 (142098..144224) Protein of unknown...    28   2.7  
Sklu_2135.3 YGR263C, Contig c2135 5470-6558                            28   3.7  
CAGL0K00297g 29492..31375 highly similar to sp|P32368 Saccharomy...    27   9.9  

>Kwal_23.3458
          Length = 153

 Score =  243 bits (621), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 123/152 (80%), Positives = 123/152 (80%)

Query: 1   MSDATSRRRPVEITEFKAVIKDLPDGQLNKIRSELENSMKHLDRSNLRLKKYIAKIEGKR 60
           MSDATSRRRPVEITEFKAVIKDLPDGQLNKIRSELENSMKHLDRSNLRLKKYIAKIEGKR
Sbjct: 1   MSDATSRRRPVEITEFKAVIKDLPDGQLNKIRSELENSMKHLDRSNLRLKKYIAKIEGKR 60

Query: 61  ESTPDGVDEEELDKVDANDLQLFQDSYRENEIVLRNHYERLEALDLEASYRDRGARSGXX 120
           ESTPDGVDEEELDKVDANDLQLFQDSYRENEIVLRNHYERLEALDLEASYRDRGARSG  
Sbjct: 61  ESTPDGVDEEELDKVDANDLQLFQDSYRENEIVLRNHYERLEALDLEASYRDRGARSGTT 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXPNSVY 152
                                      PNSVY
Sbjct: 121 ASTSDQHDTTATTTSFDTDNTNGDTNAPNSVY 152

>Sklu_1742.3 YDL110C, Contig c1742 2887-3351 reverse complement
          Length = 154

 Score =  147 bits (372), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 79/153 (51%), Positives = 96/153 (62%), Gaps = 1/153 (0%)

Query: 1   MSDATSRRRPVEITEFKAVIKDLPDGQLNKIRSELENSMKHLDRSNLRLKKYIAKIEGKR 60
           MS A S RRP++I EFK  I+DLP  QL+KIR EL+NS+KHLDRSN RL KYIA+I+GK+
Sbjct: 1   MSTAGSIRRPIQIAEFKTAIRDLPQDQLSKIRQELQNSIKHLDRSNARLTKYIARIQGKK 60

Query: 61  -ESTPDGVDEEELDKVDANDLQLFQDSYRENEIVLRNHYERLEALDLEASYRDRGARSGX 119
            ES  +   E + D +DANDLQL+QDS RENEIVLRNHY RL+ALD E +YR  G+ S  
Sbjct: 61  PESNVELEGESDEDTIDANDLQLYQDSLRENEIVLRNHYARLDALDQEEAYRTSGSTSAS 120

Query: 120 XXXXXXXXXXXXXXXXXXXXXXXXXXXXPNSVY 152
                                       PNSV+
Sbjct: 121 ENKASRGPAVAAAISGIDTDNTQGDANAPNSVF 153

>Scas_613.23*
          Length = 137

 Score =  115 bits (288), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 83/114 (72%), Gaps = 2/114 (1%)

Query: 1   MSDATSRRRPVEITEFKAVIKDLPDGQLNKIRSELENSMKHLDRSNLRLKKYIAKIEGKR 60
           MS   + +RP++I EFK  IKD+ + +L  IR ++ENS+ HL+RSN +L+KYIAK+EG  
Sbjct: 1   MSSPGAMKRPIQIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLE 60

Query: 61  ESTPDGVDEEELDKVDANDLQLFQDSYRENEIVLRNHYERLEALDLEASYRDRG 114
           +   D  D EE++ ++A DLQLF+DS REN+IVL+N+ +RL+ALD E  YR  G
Sbjct: 61  QEYAD--DSEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQENIYRTSG 112

>YDL110C (YDL110C) [759] chr4 complement(264512..264964) Protein of
           unknown function [453 bp, 150 aa]
          Length = 150

 Score =  107 bits (268), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 78/114 (68%), Gaps = 1/114 (0%)

Query: 1   MSDATSRRRPVEITEFKAVIKDLPDGQLNKIRSELENSMKHLDRSNLRLKKYIAKIEGKR 60
           M  A   RRP++I EFK  I  + D +L +I++E+ENS+ HL RSN RL KYIAK+EG  
Sbjct: 1   MCSAGGIRRPIQIEEFKTAISGMSDMELAQIKTEIENSINHLQRSNARLGKYIAKLEGAD 60

Query: 61  ESTPDGVDEEELDKVDANDLQLFQDSYRENEIVLRNHYERLEALDLEASYRDRG 114
           +   +  D ++L+ +D+ DL L++DS RENEIVL N+ ER++AL+ E  YR  G
Sbjct: 61  DRL-EADDSDDLENIDSGDLALYKDSVRENEIVLNNYNERVDALEQETVYRKTG 113

>CAGL0H10362g 1009858..1010307 similar to tr|Q12513 Saccharomyces
           cerevisiae YDL110c, start by similarity
          Length = 149

 Score =  100 bits (248), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 79/112 (70%), Gaps = 4/112 (3%)

Query: 1   MSDATSRRRPVEITEFKAVIKDLPDGQLNKIRSELENSMKHLDRSNLRLKKYIAKIEGKR 60
           M+ A+  +RPV++  FK  I+D+ D +L +++ E+ENS++HL RSN RL +YI K++G  
Sbjct: 1   MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGHA 60

Query: 61  ESTPDGVDEEELDK-VDANDLQLFQDSYRENEIVLRNHYERLEALDLEASYR 111
               DG   EE+D+ + ++D++LFQ+S RENE+VL N  ERLEAL  E +YR
Sbjct: 61  VELEDG---EEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDELAYR 109

>KLLA0E09229g complement(827035..827517) similar to sgd|S0002268
           Saccharomyces cerevisiae YDL110c hypothetical protein,
           start by similarity
          Length = 160

 Score = 92.8 bits (229), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 76/121 (62%), Gaps = 3/121 (2%)

Query: 1   MSDATSRRRPVEITEFKAVIKDLPDGQLNKIRSELENSMKHLDRSNLRLKKYIAKIEGKR 60
           M+ ++  RRP++I EF   I++  + +L +IR E+ N++KHL RSN RL+ Y+AK++G+ 
Sbjct: 1   MAHSSGIRRPIQIQEFVIAIRESSEHELQEIRKEINNAVKHLQRSNRRLEAYVAKLKGEE 60

Query: 61  ESTPDGVDEE---ELDKVDANDLQLFQDSYRENEIVLRNHYERLEALDLEASYRDRGARS 117
                 +D E     D +D  DLQ+FQDS  EN  VL N+ ERL+ALDLE  +R     S
Sbjct: 61  VLNRQELDAEGNFSDDDIDEKDLQVFQDSLAENGKVLDNYNERLQALDLEEQHRASTVSS 120

Query: 118 G 118
           G
Sbjct: 121 G 121

>AGR378C [4689] [Homologous to ScYDL110C - SH] (1426104..1426457)
           [354 bp, 117 aa]
          Length = 117

 Score = 69.3 bits (168), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 59/112 (52%), Gaps = 14/112 (12%)

Query: 1   MSDATSRRRPVEITEFKAVIKDLPDGQLNKIRSELENSMKHLDRSNLRLKKYIAKIEGKR 60
           M+ +   RRPV+I EFK  +++L   +L   R  LE   + L R++ RL ++        
Sbjct: 1   MAGSEVARRPVQIAEFKTAVRELSQQELAAARQALEARARQLARTSERLARH-------- 52

Query: 61  ESTPDGVDEEELDKVDANDLQLFQDSYRENEIVLRNHYERLEALDLEASYRD 112
                 V E E  + +  +L LF+ S RENE+VL N  ERLEA+ LE  +R 
Sbjct: 53  ------VQELEQQEGEGGNLALFRTSLRENEVVLGNCRERLEAVGLEEEFRG 98

>KLLA0C10802g complement(926916..931934) similar to sp|P15442
           Saccharomyces cerevisiae YDR283c GCN2 ser/thr protein
           kinase, start by similarity
          Length = 1672

 Score = 28.9 bits (63), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 18/21 (85%), Gaps = 1/21 (4%)

Query: 16  FKAVIKDLPDGQLNKIRSELE 36
           FK VI ++PDGQLNK+R E++
Sbjct: 83  FKNVI-NVPDGQLNKLRQEIK 102

>YDL176W (YDL176W) [696] chr4 (142098..144224) Protein of unknown
           function [2127 bp, 708 aa]
          Length = 708

 Score = 28.5 bits (62), Expect = 2.7,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 53/111 (47%), Gaps = 9/111 (8%)

Query: 2   SDATSRRRPV---EITEFKAVIKDLPDGQLN---KIRSELENSMKHLDRSNLRLKKYIAK 55
           S A+S  RP+       F+A+ +D    +++     + EL++ ++ L R+   +   I +
Sbjct: 389 STASSEPRPLSRRRRESFQALTRDAFRERMDVPCSTKWELDSFIRGLRRNTFMVDFEIVE 448

Query: 56  IEGKRESTPDGVDEEE--LDKVDANDLQLFQDSYRENEIVLRNHYERLEAL 104
               R    DGV+E++   D+ D        D+Y++ +IV  +H+  L A 
Sbjct: 449 KISHRNGN-DGVNEDDNTTDESDETMTSFLTDNYKKMDIVCIDHFVTLSAF 498

>Sklu_2135.3 YGR263C, Contig c2135 5470-6558
          Length = 362

 Score = 27.7 bits (60), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 37  NSMKHLDRSNLRLKKYIAKIEGKRESTPDGVDEEELDKVDANDLQLFQDSYRENEIVLRN 96
           N +++   + LRL +    I     +T DG ++++LD +    + +F+  Y    +V +N
Sbjct: 215 NILQYAGMTGLRLPEKCISISPWLNTTEDGDEKDQLDFLTWKLISVFKSIYAP-RLVTKN 273

Query: 97  HYERLEALDLEASY 110
            +     LDLE+++
Sbjct: 274 KF-----LDLESAF 282

>CAGL0K00297g 29492..31375 highly similar to sp|P32368 Saccharomyces
           cerevisiae YKL212w recessive suppressor of secretory
           defect, start by similarity
          Length = 627

 Score = 26.6 bits (57), Expect = 9.9,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 36/82 (43%)

Query: 37  NSMKHLDRSNLRLKKYIAKIEGKRESTPDGVDEEELDKVDANDLQLFQDSYRENEIVLRN 96
           N M  LDR+N+        I      T   V EE+L + D + L LFQ+ + +N   +  
Sbjct: 395 NCMDCLDRTNVVQSVLAHWILQNELETSGVVGEEQLWEQDKSLLSLFQNLWADNADAVSF 454

Query: 97  HYERLEALDLEASYRDRGARSG 118
            Y    AL  + +   +  ++G
Sbjct: 455 SYSGTGALKTDFTRTGKRTKAG 476

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.132    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,023,145
Number of extensions: 169667
Number of successful extensions: 841
Number of sequences better than 10.0: 80
Number of HSP's gapped: 835
Number of HSP's successfully gapped: 82
Length of query: 152
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 59
Effective length of database: 13,376,635
Effective search space: 789221465
Effective search space used: 789221465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 57 (26.6 bits)