Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.345425825512361e-174
Sklu_1742.22512122553e-26
YGL146C3112422313e-22
Scas_669.162771901732e-14
KLLA0E09207g2571961652e-13
AGR377C2271001087e-06
KLLA0F19778g657102730.27
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3454
         (255 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3454                                                          480   e-174
Sklu_1742.2 YGL146C, Contig c1742 1815-2570 reverse complement        102   3e-26
YGL146C (YGL146C) [1841] chr7 complement(228754..229689) Protein...    94   3e-22
Scas_669.16                                                            71   2e-14
KLLA0E09207g complement(825533..826306) weakly similar to sp|P53...    68   2e-13
AGR377C [4688] [Homologous to ScYGL146C - SH] (1425385..1426068)...    46   7e-06
KLLA0F19778g complement(1831727..1833700) highly similar to sp|P...    33   0.27 

>Kwal_23.3454
          Length = 258

 Score =  480 bits (1236), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/255 (92%), Positives = 237/255 (92%)

Query: 1   MSDKHQAASWLDMLVIFPIFFAKTAAGALSGSLARPQLSFVCPPIKVSQVGALWQDNATC 60
           MSDKHQAASWLDMLVIFPIFFAKTAAGALSGSLARPQLSFVCPPIKVSQVGALWQDNATC
Sbjct: 1   MSDKHQAASWLDMLVIFPIFFAKTAAGALSGSLARPQLSFVCPPIKVSQVGALWQDNATC 60

Query: 61  FGFEVDPNSFSATLAIEVTDTISYKIDWSRFDSNSCERGKQSLDLTITDCSDNLLRARNN 120
           FGFEVDPNSFSATLAIEVTDTISYKIDWSRFDSNSCERGKQSLDLTITDCSDNLLRARNN
Sbjct: 61  FGFEVDPNSFSATLAIEVTDTISYKIDWSRFDSNSCERGKQSLDLTITDCSDNLLRARNN 120

Query: 121 LRTGKTFIKVRRQDSEPTLNLCFINRVYDCSWKSIDMDKTITVTLIDFDSRQTKELKEQT 180
           LRTGKTFIKVRRQDSEPTLNLCFINRVYDCSWKSIDMDKTITVTLIDFDSRQTKELKEQT
Sbjct: 121 LRTGKTFIKVRRQDSEPTLNLCFINRVYDCSWKSIDMDKTITVTLIDFDSRQTKELKEQT 180

Query: 181 EKAANELSTNAGXXXXXXXXXXXXXXXXXXSNRRDFNEETFSQLLYAQILYITVLFIFNA 240
           EKAANELSTNAG                  SNRRDFNEETFSQLLYAQILYITVLFIFNA
Sbjct: 181 EKAANELSTNAGELLPLLLPKEKQELFKLESNRRDFNEETFSQLLYAQILYITVLFIFNA 240

Query: 241 LIVAYVATRRASQSS 255
           LIVAYVATRRASQSS
Sbjct: 241 LIVAYVATRRASQSS 255

>Sklu_1742.2 YGL146C, Contig c1742 1815-2570 reverse complement
          Length = 251

 Score =  102 bits (255), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 97/212 (45%), Gaps = 2/212 (0%)

Query: 37  QLSFVCPPIKVSQV-GALWQDNATCFGFEVDPNSFSATLAIEVTDTISYKIDWSRFDSNS 95
           +LS   PP+K S+V    +     C  F+    +   T  I V +++ Y+ D  RF   S
Sbjct: 28  KLSLKVPPVKDSRVREGDYGKYTQCITFDSSTETEDVTFVISVQESLPYETDIDRFGPIS 87

Query: 96  CERGKQSLDLTITDCSDNLLRARNNLRTGKTFIKVRRQDSEPTLNLCFINRVYDCSWKSI 155
             RGKQ L L I D  DNLLR   +L  G   ++V    S     +C IN VYD SWKSI
Sbjct: 88  SARGKQFLQLEIFDEYDNLLRGTRHLPNGDNVLQVNTHGSS-QFRICLINLVYDGSWKSI 146

Query: 156 DMDKTITVTLIDFDSRQTKELKEQTEKAANELSTNAGXXXXXXXXXXXXXXXXXXSNRRD 215
           D++K +T+T+   D      LK  TE+  + L+                         RD
Sbjct: 147 DVEKDVTITVTRRDKLLNPSLKIITEEDCDLLNEVKEDLFHMVNVKTTQTLTDIEREHRD 206

Query: 216 FNEETFSQLLYAQILYITVLFIFNALIVAYVA 247
            NE +F  L+Y  I+   + F+ N ++V YV 
Sbjct: 207 LNESSFELLMYQLIMVGVLSFLGNCVMVPYVV 238

>YGL146C (YGL146C) [1841] chr7 complement(228754..229689) Protein
           with similarity to Bunyamwera virus RNA-directed RNA
           polymerase [936 bp, 311 aa]
          Length = 311

 Score = 93.6 bits (231), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 109/242 (45%), Gaps = 30/242 (12%)

Query: 37  QLSFVCPPIKVSQV--GALWQD-----------NATCFGFEVDPNSFS--ATLAIEVTDT 81
           +LSF  PPIK S +   AL++D            A C  F    N  S      I V D 
Sbjct: 69  KLSFKVPPIKRSLLLGAALYEDFEYSSNNSASDGAFCTVFNAGMNDASREVVFEIHVMDV 128

Query: 82  ISYKIDWSRFDSNSCERGKQSLDLTI-TDCSDNLLRARNNLRTGKTFIKVRRQDSEPTLN 140
           +  + D SRF   S ERG+QSL  ++  + + +LLR++ NL +G + I+V   +    L 
Sbjct: 129 LQEETDSSRFGGTSHERGRQSLGFSVFNNKNGDLLRSKKNLASGTSVIEVNPGNCNEFL- 187

Query: 141 LCFINRVYDCSWKSIDMDKTITVTLI-------DFDSRQTKELKEQTEKAANELSTNAGX 193
           +CFIN VYD SW SID +K++T+ +        D       ++  Q  KA N +S     
Sbjct: 188 ICFINLVYDGSWSSIDTEKSVTIKMTYNDKLDPDMLLHLVNQMTPQVVKALNTVSDG--- 244

Query: 194 XXXXXXXXXXXXXXXXXSNRRDFNEETFSQLLYAQILYITVLFIFNALIVAYVATRRASQ 253
                            S+RRD NE T+S L+   +  +    I N ++  Y+  +  S 
Sbjct: 245 ---LFQIVSDTTLLQMESDRRDINEATYSYLIVGFVSLMVAQLISNIIVTTYLIIKIKSN 301

Query: 254 SS 255
            S
Sbjct: 302 PS 303

>Scas_669.16
          Length = 277

 Score = 71.2 bits (173), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/190 (31%), Positives = 83/190 (43%), Gaps = 16/190 (8%)

Query: 64  EVDPNSFSATLAIEVTDTISYKIDWSRFDSNSCERGKQSLDLTITDC-SDNLLRARNNLR 122
           E+   S      I V + + YKID++RF   S E+GKQ L LT+    S NLL++  +L 
Sbjct: 75  ELHKQSQELVFGITVQEVLPYKIDFTRFGGTSSEKGKQKLYLTVFGLRSGNLLQSTRDLL 134

Query: 123 TGKTFIKVRRQDSEPTLNLCFINRVYDCSWKSIDMDKTITVTLIDFD---SRQTKELKEQ 179
           TG T  ++   D E     CF N V+D SW SI+  K I +     D       K L+ Q
Sbjct: 135 TGTTLFQL-NPDGENDFEFCFQNLVFDRSWNSINAIKLIKLFTSANDILNPELNKYLETQ 193

Query: 180 -TEKAANELSTNAGXXXXXXXXXXXXXXXXXXSNRRDFNEETFSQLLYAQILYITVLFIF 238
            T +AA  L                       S+ RD NE+ FS++L            F
Sbjct: 194 YTSRAAKRLHKADFTLSNIQNNTLIKELLPLESSHRDINEDIFSRMLNG----------F 243

Query: 239 NALIVAYVAT 248
            AL+ A + T
Sbjct: 244 AALVFAVIVT 253

>KLLA0E09207g complement(825533..826306) weakly similar to sp|P53117
           Saccharomyces cerevisiae YGL146c hypothetical protein
           singleton, hypothetical start
          Length = 257

 Score = 68.2 bits (165), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 85/196 (43%), Gaps = 1/196 (0%)

Query: 59  TCFGFEVDPNSFSATLAIEVTDTISYKIDWSRFDSNSCERGKQSLDLTITDCSDNLLRAR 118
           TCF    +  +      IE+ +   +K++  RF   +  +GKQ +++ I D   NL+++R
Sbjct: 52  TCFEMNTNIKAKDLQFLIEIEEFTKWKVNVDRFGPTTSSKGKQVVNMDIYDEDQNLVQSR 111

Query: 119 NNLRTGKTFIKVRRQDSEPTLNLCFINRVYDCSWKSIDMDKTITVTLIDFDSRQTKELKE 178
           + L  G+T + V   + +    +C IN   D SW +ID  K + +++   D  Q ++   
Sbjct: 112 HGLENGETVLYVSVYEHQ-NFQICLINFSLDSSWNAIDSVKQVAISITSNDLIQKQKWDL 170

Query: 179 QTEKAANELSTNAGXXXXXXXXXXXXXXXXXXSNRRDFNEETFSQLLYAQILYITVLFIF 238
            T+   N LS                       + R+ NE TFS LL    +   ++ + 
Sbjct: 171 ITDDDLNLLSQGRDDLFSLVSADSGQELHALDVDHRNLNESTFSYLLAKVTILFCIIGVC 230

Query: 239 NALIVAYVATRRASQS 254
           + L+   +  R  S+ 
Sbjct: 231 HLLVFPILLYRIVSKG 246

>AGR377C [4688] [Homologous to ScYGL146C - SH] (1425385..1426068)
           [684 bp, 227 aa]
          Length = 227

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 8/100 (8%)

Query: 60  CFGFEVDPNSFSATLAIEVTDTISYKIDWSRFDSNSCERGKQSLDLTITDCSDN-LLRAR 118
           C  +E    + + ++ +  TD + + +D +RF   S + G+Q L L + D   N L+R R
Sbjct: 36  CVRWEAG-RAGALSVRVRRTDRVGHAVDEARFGPTSVQLGRQQLGLEVWDTEANVLVRDR 94

Query: 119 NNLRTGKTFIKVRRQDSEPT--LNLCFINRVYDCSWKSID 156
                G+T     R  + P   +++C IN   D SW++ID
Sbjct: 95  RVPAHGRTV----RFSANPAQQVDVCLINVSRDASWRAID 130

>KLLA0F19778g complement(1831727..1833700) highly similar to
           sp|P32599 Saccharomyces cerevisiae YDR129c SAC6 actin
           filament bundling protein, fimbrin singleton, start by
           similarity
          Length = 657

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 46/102 (45%), Gaps = 3/102 (2%)

Query: 77  EVTDTISYKIDWSRFDSNSCERGK-QSLDLTITDCSDNLLRARNNLRTGKTFIKVRRQDS 135
           ++ D  +Y +  ++ DSN C  G  Q+ DL   + ++ +L+    L   K          
Sbjct: 332 DIKDGENYTVLLNQLDSNLCSLGPLQTTDLL--ERAEEVLQNAEKLECRKYLTPTALVAG 389

Query: 136 EPTLNLCFINRVYDCSWKSIDMDKTITVTLIDFDSRQTKELK 177
            P LNL F+  +++       +D+   + + DFD+   +E +
Sbjct: 390 NPKLNLAFVAHLFNTHPGLDPLDENEPIEIEDFDAEGEREAR 431

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.132    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,935,810
Number of extensions: 253087
Number of successful extensions: 626
Number of sequences better than 10.0: 10
Number of HSP's gapped: 614
Number of HSP's successfully gapped: 10
Length of query: 255
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 156
Effective length of database: 13,168,927
Effective search space: 2054352612
Effective search space used: 2054352612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)