Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.336652651925850.0
Sklu_1720.251851321280.0
KLLA0A04081g52751819220.0
Scas_687.55604755747e-67
YJR152W (DAL5)5434765327e-61
KLLA0D02970g5504695126e-58
YLR004C5234755107e-58
Scas_590.105344625063e-57
KLLA0D11330g5215155036e-57
Kwal_33.152765525075012e-56
Kwal_47.171695764694865e-54
CAGL0G04081g5134534748e-53
Kwal_47.165965044494413e-48
KLLA0E09548g5114544371e-47
Kwal_26.66585454724354e-47
Kwal_23.64865475173767e-39
Scas_630.155504783591e-36
YLL055W5314443572e-36
KLLA0F00286g5394523221e-31
KLLA0C18678g5504723192e-31
KLLA0C19019g5113862901e-27
Kwal_47.165865025052863e-27
ABR113C4794672864e-27
KLLA0A09449g5104512856e-27
CAGL0F08371g5295332857e-27
Kwal_14.7824912982751e-25
YGR260W (TNA1)5345132714e-25
ADR330W4934432572e-23
Kwal_27.128325083162502e-22
ACL203C5374852475e-22
YIL166C5424702475e-22
Scas_645.75464522218e-19
KLLA0F09405g5434452172e-18
AER444W5474762093e-17
KLLA0D07370g5994752076e-17
AFR229C5354712058e-17
CAGL0F00209g5403242012e-16
Sklu_1875.15724311906e-15
KLLA0A06193g4382031887e-15
CAGL0L08052g4842471852e-14
Kwal_33.132675504811843e-14
Sklu_2010.55171961816e-14
YAL067C (SEO1)5934831791e-13
AGL026W5453071781e-13
Kwal_33.137135002151772e-13
YCR028C (FEN2)5122381762e-13
KLLA0B07953g5982061721e-12
Scas_689.115082181701e-12
Kwal_56.243535824971701e-12
Scas_630.255822121692e-12
YGR065C (VHT1)5931961631e-11
AFL158C5642341593e-11
CAGL0K04609g6092921576e-11
AGR235W5625431551e-10
Kwal_26.92646141951424e-09
AEL143W5192271362e-08
KLLA0D12716g5952111335e-08
AFR578C6252871301e-07
CAGL0K04565g6202351255e-07
Scas_683.236013211192e-06
YOL162W2151981055e-05
Scas_21.1140123890.002
Sklu_2043.2242115890.005
YOL163W169161790.065
KLLA0F06853g528186820.067
CAGL0I07447g570204810.091
Sklu_2358.216778770.11
Sklu_2244.6230192760.20
YOL103W (ITR2)609209740.61
AFL207C539178701.7
Scas_581.6587174692.4
CAGL0M01672g547151682.8
Scas_637.960789683.0
Kwal_56.2295159683649.0
Scas_685.55601796410.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3366
         (519 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3366                                                         1000   0.0  
Sklu_1720.2 , Contig c1720 2063-3619 reverse complement               824   0.0  
KLLA0A04081g 366969..368552 similar to ca|CA5240|IPF3032 Candida...   744   0.0  
Scas_687.5                                                            225   7e-67
YJR152W (DAL5) [3043] chr10 (719581..721212) Allantoate and urei...   209   7e-61
KLLA0D02970g 252052..253704 similar to sp|P15365 Saccharomyces c...   201   6e-58
YLR004C (YLR004C) [3422] chr12 complement(157933..159504) Member...   201   7e-58
Scas_590.10                                                           199   3e-57
KLLA0D11330g 970243..971808 similar to ca|CA2478|CaDAL52 Candida...   198   6e-57
Kwal_33.15276                                                         197   2e-56
Kwal_47.17169                                                         191   5e-54
CAGL0G04081g 388383..389924 highly similar to tr|Q07904 Saccharo...   187   8e-53
Kwal_47.16596                                                         174   3e-48
KLLA0E09548g complement(846600..848135) similar to sgd|S0003994 ...   172   1e-47
Kwal_26.6658                                                          172   4e-47
Kwal_23.6486                                                          149   7e-39
Scas_630.15                                                           142   1e-36
YLL055W (YLL055W) [3368] chr12 (30109..31704) Member of the alla...   142   2e-36
KLLA0F00286g 14519..16138 some similarities with sp|Q9C0U9 Schiz...   128   1e-31
KLLA0C18678g complement(1655735..1657387) similar to sgd|S000397...   127   2e-31
KLLA0C19019g 1689555..1691090 weakly similar to sp|P53322 Saccha...   116   1e-27
Kwal_47.16586                                                         114   3e-27
ABR113C [705] [Homologous to ScYLL055W - NSH] (601035..602474) [...   114   4e-27
KLLA0A09449g 825574..827106 similar to sp|P53322 Saccharomyces c...   114   6e-27
CAGL0F08371g 835733..837322 highly similar to sp|P53322 Saccharo...   114   7e-27
Kwal_14.782                                                           110   1e-25
YGR260W (TNA1) [2206] chr7 (1012490..1014094) Nicotinic acid per...   108   4e-25
ADR330W [2071] [Homologous to ScYGR260W (TNA1) - SH] complement(...   103   2e-23
Kwal_27.12832                                                         100   2e-22
ACL203C [846] [Homologous to ScYIL166C - NSH; ScYOL162W - NSH] (...   100   5e-22
YIL166C (YIL166C) [2512] chr9 complement(30938..32566) Member of...   100   5e-22
Scas_645.7                                                             90   8e-19
KLLA0F09405g 867882..869513 similar to sp|P40445 Saccharomyces c...    88   2e-18
AER444W [2944] [Homologous to ScYIL166C - NSH] complement(148785...    85   3e-17
KLLA0D07370g complement(630095..631894) similar to ca|CA4956|IPF...    84   6e-17
AFR229C [3421] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH] ...    84   8e-17
CAGL0F00209g complement(22109..23731) weakly similar to sp|P5332...    82   2e-16
Sklu_1875.1 YAL067C, Contig c1875 643-2361 reverse complement          78   6e-15
KLLA0A06193g 566780..568096 similar to sp|P25621 Saccharomyces c...    77   7e-15
CAGL0L08052g complement(878996..880450) similar to sp|P25621 Sac...    76   2e-14
Kwal_33.13267                                                          75   3e-14
Sklu_2010.5 YCR028C, Contig c2010 7036-8589                            74   6e-14
YAL067C (SEO1) [2] chr1 complement(7236..9017) Member of the all...    74   1e-13
AGL026W [4285] [Homologous to ScYGR260W - NSH] complement(664335...    73   1e-13
Kwal_33.13713                                                          73   2e-13
YCR028C (FEN2) [562] chr3 complement(170881..172419) High affini...    72   2e-13
KLLA0B07953g 703782..705578 similar to sp|P53241 Saccharomyces c...    71   1e-12
Scas_689.11                                                            70   1e-12
Kwal_56.24353                                                          70   1e-12
Scas_630.25                                                            70   2e-12
YGR065C (VHT1) [2027] chr7 complement(618079..619860) H+/biotin ...    67   1e-11
AFL158C [3037] [Homologous to ScYAL067C (SEO1) - NSH] (137788..1...    66   3e-11
CAGL0K04609g complement(437799..439628) highly similar to sp|P53...    65   6e-11
AGR235W [4546] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH] ...    64   1e-10
Kwal_26.9264                                                           59   4e-09
AEL143W [2363] [Homologous to ScYCR028C (FEN2) - SH] complement(...    57   2e-08
KLLA0D12716g complement(1084062..1085849) similar to sp|P39709 S...    56   5e-08
AFR578C [3770] [Homologous to ScYGR065C (VHT1) - SH] (1474397..1...    55   1e-07
CAGL0K04565g complement(431909..433771) similar to sp|P53241 Sac...    53   5e-07
Scas_683.23                                                            50   2e-06
YOL162W (YOL162W) [4663] chr15 (10118..10765) Protein of unknown...    45   5e-05
Scas_21.1                                                              39   0.002
Sklu_2043.2 , Contig c2043 4428-5156 reverse complement                39   0.005
YOL163W (YOL163W) [4662] chr15 (9596..10105) Protein of unknown ...    35   0.065
KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromy...    36   0.067
CAGL0I07447g 716104..717816 highly similar to sp|P30606 Saccharo...    36   0.091
Sklu_2358.2 YIL166C, Contig c2358 1699-2198                            34   0.11 
Sklu_2244.6 YOL162W, Contig c2244 14189-14881 reverse complement       34   0.20 
YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permea...    33   0.61 
AFL207C [2988] [Homologous to ScAFL207C] (44349..45968) [1620 bp...    32   1.7  
Scas_581.6                                                             31   2.4  
CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces c...    31   2.8  
Scas_637.9                                                             31   3.0  
Kwal_56.22951                                                          29   9.0  
Scas_685.5                                                             29   10.0 

>Kwal_23.3366
          Length = 526

 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/519 (94%), Positives = 491/519 (94%)

Query: 1   MSLHSKKQDTKEPFQVESGEILEIKGSASPSYDKGQLEVAGKHMVGAELFQELLEGESET 60
           MSLHSKKQDTKEPFQVESGEILEIKGSASPSYDKGQLEVAGKHMVGAELFQELLEGESET
Sbjct: 1   MSLHSKKQDTKEPFQVESGEILEIKGSASPSYDKGQLEVAGKHMVGAELFQELLEGESET 60

Query: 61  SDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIF 120
           SDKEYAPIRRKIDRWLLPVLCVTYMLQFLDK            KDLNFKGNDYSNIAAIF
Sbjct: 61  SDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKLSLNYASAYSLSKDLNFKGNDYSNIAAIF 120

Query: 121 NVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEAS 180
           NVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEAS
Sbjct: 121 NVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEAS 180

Query: 181 ISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLV 240
           ISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLV
Sbjct: 181 ISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLV 240

Query: 241 IGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALK 300
           IGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALK
Sbjct: 241 IGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALK 300

Query: 301 DLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVL 360
           DLNV                TSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVL
Sbjct: 301 DLNVIILALIGLGCGIINGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVL 360

Query: 361 ALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLN 420
           ALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLN
Sbjct: 361 ALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLN 420

Query: 421 VTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILY 480
           VTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILY
Sbjct: 421 VTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILY 480

Query: 481 YALMFYRNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519
           YALMFYRNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN
Sbjct: 481 YALMFYRNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519

>Sklu_1720.2 , Contig c1720 2063-3619 reverse complement
          Length = 518

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/513 (77%), Positives = 438/513 (85%), Gaps = 7/513 (1%)

Query: 10  TKEPFQVESGEILE---IKGSASPSYDKGQLEVAGKHMVGAELFQELLEGESETSDKEYA 66
           +KE ++V   +  +     GS+SP     Q+ +A KH VG ELFQELL+ E +T DKEYA
Sbjct: 3   SKEQYEVNVNDAEQQSVTSGSSSPD----QIPIADKHAVGVELFQELLDAELDTDDKEYA 58

Query: 67  PIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLV 126
           PIRRKIDRWLLPVLC+TYMLQFLDK            +DL  KGNDY +IAAI N GYLV
Sbjct: 59  PIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAGYLV 118

Query: 127 GSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNM 186
           GSIPANWVIQK PVAKYTGCAL+ WA+LL+AHIGA N   MMALRFLLG+MEASISPSNM
Sbjct: 119 GSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISPSNM 178

Query: 187 MMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINF 246
           MMC+MFYNKQEQPFRMCTFLSMNGVATMVG+LLAYGLGHSTS+SLKPWKLIFLVIGL+NF
Sbjct: 179 MMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGLLNF 238

Query: 247 VWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALKDLNVXX 306
           VWA +FLYMAPDSPANARFLTHEEKLKV++RVSKNQMGIKDT+LKPKQA EA KDLN   
Sbjct: 239 VWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLNSWI 298

Query: 307 XXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKK 366
                         TSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVF AG++ALFTKK
Sbjct: 299 LALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALFTKK 358

Query: 367 NIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLNVTVAGS 426
           N+R ILLF+LCIPTLAGL+GIHLIPLEHKWALVGCCWLLYIIGGPVIMCW+L+NVT+AGS
Sbjct: 359 NVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINVTIAGS 418

Query: 427 SKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMFY 486
           SKIS+ KIMWFL+YTAGNIIGSKIFYAKEAP+YITGMKGLI+SYA MMFL I+YY +M Y
Sbjct: 419 SKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCMMHY 478

Query: 487 RNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519
           RN+TRDRKYGK TPE E+EG+INGFKDYTDFEN
Sbjct: 479 RNRTRDRKYGKLTPESEREGIINGFKDYTDFEN 511

>KLLA0A04081g 366969..368552 similar to ca|CA5240|IPF3032 Candida
           albicans allantoate permease (by homology), start by
           similarity
          Length = 527

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/518 (70%), Positives = 415/518 (80%), Gaps = 6/518 (1%)

Query: 8   QDTKEPFQVESGEILEIKGSASPSYD------KGQLEVAGKHMVGAELFQELLEGESETS 61
            + KE  Q E G + + +  +   YD      K Q     +H VG +LFQE+L+ + +  
Sbjct: 3   SEIKEKEQFEIGVVGDTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLKYD 62

Query: 62  DKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFN 121
           DKEY+ IRRKID WLLPVLC+TYMLQFLDK            +DL   GN+Y NIAAIFN
Sbjct: 63  DKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFN 122

Query: 122 VGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASI 181
           VGYL+GSIPAN+VIQKLPVAKYTG AL VWA+LL+ HIGA N   MMALRFLLGLMEASI
Sbjct: 123 VGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASI 182

Query: 182 SPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVI 241
           SPSNMMMCAMFYNK+EQPFRMCTFLSMNGVATMVG+LLAYGLGH+T++SL+PWKLIFLV 
Sbjct: 183 SPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVF 242

Query: 242 GLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALKD 301
           G++N VW+ VFLY+APDSPANA+FLTHEEKLKV++ VSKNQMGIKDTK+KP Q  EA+ D
Sbjct: 243 GIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLD 302

Query: 302 LNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLA 361
           LN                 TSNFISSLIKGFGFSGLNATLLQLPTGAIELV VFAAG++A
Sbjct: 303 LNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVA 362

Query: 362 LFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLNV 421
           LFT KN+RVILLF+ CIPTL  L+GI LIPL  KW+LVGCCWLLYIIGGPVIMCWVL+NV
Sbjct: 363 LFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLINV 422

Query: 422 TVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYY 481
           TVAGSSKIST KI+WF+ YTAGNI GSKI YA EAPRY +GMKGLI+ Y+ MMFLCI+YY
Sbjct: 423 TVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIVYY 482

Query: 482 ALMFYRNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519
            LM+YRNK RD +YG+ TPE+EKEGVINGFKD TDF+N
Sbjct: 483 FLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQN 520

>Scas_687.5
          Length = 560

 Score =  225 bits (574), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 150/475 (31%), Positives = 242/475 (50%), Gaps = 19/475 (4%)

Query: 59  ETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAA 118
           + + +E   +R KID  + P++C+ Y +QF+DK             DL   G+ YS + +
Sbjct: 84  QITKEEDTRLRWKIDFCMFPLMCLLYAVQFMDKISTGSAAVMGLRTDLKMHGDQYSWVGS 143

Query: 119 IFNVGYLVGSI-PANWVIQKLP-VAKYTGCALIVWAVLLVAH-IGAKNTRDMMALRFLLG 175
            F  GYL  ++ P  ++ Q+   +AK     +I+W VLL  H + + N    +ALR LLG
Sbjct: 144 AFYFGYLFMNMGPVQFIFQRSDKMAKMLALFVIIWGVLLSLHSVPSVNYASFIALRVLLG 203

Query: 176 LMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLG-HSTSSSLKPW 234
             E+ ++P   ++ A ++  +EQ  R+C +  MNG+ +++ S +AYG+  H  S S+K W
Sbjct: 204 CAESVVTPCFTIITAQYWKTEEQFTRVCIWFGMNGLRSIILSAIAYGVYIHEDSYSIKAW 263

Query: 235 KLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQ 294
           +L+F++ G+I     F+  +  PD P+ ARFL+  EKL VVER+  NQ G  + ++K  Q
Sbjct: 264 RLLFIITGVITIFVGFLIYFWIPDDPSKARFLSKREKLMVVERIRSNQQGFGNQQIKKYQ 323

Query: 295 ALEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKG-FGFSGLNATLLQLPTGAIELVC 353
            +EALKD+                   SNF+S L+   FGFS  +  LL +PTGA+ELV 
Sbjct: 324 IIEALKDVRTWLYFLFTVSSNIPNGGISNFLSILLNSDFGFSTKDTFLLSIPTGAVELVG 383

Query: 354 VFAAGVLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPL-----EHKWALVGCCWLLYII 408
               G+LAL+       I  + L     + +L +    +       K A +   +L YI 
Sbjct: 384 CPLFGILALYAANKKVPIWKYKLSWAIFSAVLALIASCMLGFANGSKKARLAGAYLWYI- 442

Query: 409 GGPVIMCWVLLNVTV--AGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGL 466
             PV    V+ N++   +G +K  T   +  + Y A N+ G + F AK+AP+Y      +
Sbjct: 443 -SPVSYICVISNISANSSGYTKKWTVSSITLVAYAASNLAGPQTFIAKQAPKYHGAKVSM 501

Query: 467 ISSYACMMFLCILYYALMFYRNKTRDRKYGKPTPEEEKEGVING--FKDYTDFEN 519
           +  Y+CM+ + ++   +    NK RD+        E K+G+     F D TDFEN
Sbjct: 502 VVCYSCMIVILLVLLLINIRENKRRDK---MALEREGKDGIFENLEFSDITDFEN 553

>YJR152W (DAL5) [3043] chr10 (719581..721212) Allantoate and
           ureidosuccinate permease, member of the allantoate
           family of the major facilitator superfamily (MFS) [1632
           bp, 543 aa]
          Length = 543

 Score =  209 bits (532), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 144/476 (30%), Positives = 236/476 (49%), Gaps = 18/476 (3%)

Query: 57  ESETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNI 116
           E E + +E   +R KID  + P++C+ Y +QF+DK             DL   G+ YS +
Sbjct: 66  EIEVTPEEDRKLRWKIDYCMFPLMCILYAVQFMDKISTSSAAVMGLRTDLKMHGDQYSWV 125

Query: 117 AAIFNVGYLVGSI-PANWVIQKLP-VAKYTGCALIVWAVLLVAHIGAK-NTRDMMALRFL 173
            + F  GYL  ++ P  ++ Q+   ++K     +++W +LL  H          + LR L
Sbjct: 126 TSAFYFGYLFMNLGPVQFIFQRTSHMSKMLAVFIVIWGMLLALHAAPTVKYPSFIVLRVL 185

Query: 174 LGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLG-HSTSSSLK 232
           LG  E+ ++P   ++ A ++  +EQ  R+  +  MNG+ +++ + +AYG+  H  S ++K
Sbjct: 186 LGCAESVVTPCFTIITAQYWKTEEQFTRVSIWFGMNGLGSILINAIAYGVYIHQDSYAIK 245

Query: 233 PWKLIFLVIGLIN-FVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLK 291
            W+ +F++ G+I  F+   +FL++ PD P+ ARFL+  EKL VV+R+  NQ G  + ++K
Sbjct: 246 GWRTLFVITGVITIFIGILIFLWI-PDDPSKARFLSKREKLMVVQRIRSNQQGFGNHEIK 304

Query: 292 PKQALEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKG-FGFSGLNATLLQLPTGAIE 350
             Q +EALKD+                   S+F+S L+   FG+S     L+ LPTGA+E
Sbjct: 305 KYQIIEALKDVRTWLYFLFTVSSNIPNGGISSFMSILLNSDFGYSSKETLLMGLPTGAVE 364

Query: 351 LVCVFAAGVLALFTKKNIRVILLFVLCIPTLAGLLGIHL-----IPLEHKWALVGCCWLL 405
           LV     G+LA++          + L     A +L +            K A +   +L 
Sbjct: 365 LVGCPLFGILAVYAANKKIPFWKYKLSWAIFAAVLALIASCMLGFATNSKKARLAGAYLW 424

Query: 406 YIIGGPVIMCWVLLNVTV--AGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGM 463
           YI   PV    VL N++   +G SK  T   +  + Y A N+ G + F AK+AP+Y    
Sbjct: 425 YI--SPVSFICVLSNISANSSGYSKKWTVSSINLVAYAAANLAGPQTFIAKQAPKYHGAK 482

Query: 464 KGLISSYACMMFLCILYYALMFYRNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519
             ++  YA M+ L  +   +    NK RD+   +    EE E +   F D TDFEN
Sbjct: 483 VAMVVCYAVMIVLLSILLIVNLRENKRRDKIAAERGFPEETENL--EFSDLTDFEN 536

>KLLA0D02970g 252052..253704 similar to sp|P15365 Saccharomyces
           cerevisiae YJR152w DAL5 allantoate permease, start by
           similarity
          Length = 550

 Score =  201 bits (512), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 143/469 (30%), Positives = 226/469 (48%), Gaps = 12/469 (2%)

Query: 60  TSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAI 119
           T +K+ A + RKID  L P++C+ Y +QF+DK             DL   G  YS + + 
Sbjct: 78  TPEKD-AKLLRKIDLMLFPIMCIIYSVQFMDKITTSNAAIMGLQTDLKMHGEQYSYVGSA 136

Query: 120 FNVGYLVGSIPANWVIQKLP-VAKYTGCALIVWAVLLVAHIG-AKNTRDMMALRFLLGLM 177
           F  GYL G     +++QK     K     +++W ++L  H   + N    + LR LLG +
Sbjct: 137 FYFGYLGGLFILPFLMQKTKKFMKMLTSIIVIWGMVLALHAAPSVNYPSFIFLRCLLGFL 196

Query: 178 EASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLG-HSTSSSLKPWKL 236
           E++I+P+  ++ + ++ K+EQ  R+  +   NG+ ++ G  +AYGL  H  S  L  WKL
Sbjct: 197 ESAITPAFTIITSQYWKKEEQFSRITCWFGFNGLGSIWGGAIAYGLYIHKDSYPLAAWKL 256

Query: 237 IFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQAL 296
           +F++ G I  V  F+ +   PDSP  A F + EEKL +VER+ +NQ G  +  +K  Q +
Sbjct: 257 VFIITGCITIVVGFIMMIHLPDSPDKAWFFSEEEKLLLVERIRENQQGFGNHHIKKYQIV 316

Query: 297 EALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIK-GFGFSGLNATLLQLPTGAIELVCVF 355
           EA KD+                   +NF S L+K  F FS   + L+ + +GA+ELV   
Sbjct: 317 EAFKDVRTWLYFLFSVSSNIPNGGITNFSSILLKEDFQFSTDKSLLVNMGSGAVELVGCP 376

Query: 356 AAGVLALFT-KKNIRVI--LLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPV 412
             G+L+ +  K+  +V+   L      T    +G+ ++             L+     PV
Sbjct: 377 LFGMLSFWCLKRKYKVVGSRLAWAFFATAICFMGVCMLAFAKHDKSARLAGLMLFGISPV 436

Query: 413 IMCWVL--LNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSY 470
               VL  ++    G +K  T   +  L Y + NI G   F A +AP Y      L+ +Y
Sbjct: 437 SFICVLSCISSNTLGFTKKWTVSSINLLAYASANIAGPHTFIATQAPSYTGAKISLVVNY 496

Query: 471 ACMMFLCILYYALMFYRNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519
           A  M + +L Y +    NK RD+   + T E+  E +   F D TDFEN
Sbjct: 497 AAAMVIIVLIYIVNARENKRRDKIEAERTHEQVVENI--EFADLTDFEN 543

>YLR004C (YLR004C) [3422] chr12 complement(157933..159504) Member of
           the allantoate permease family of the major facilitator
           superfamily (MFS), has similarity to Dal5p [1572 bp, 523
           aa]
          Length = 523

 Score =  201 bits (510), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 137/475 (28%), Positives = 225/475 (47%), Gaps = 18/475 (3%)

Query: 51  QELLEGESET--SDKEYAP-IRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLN 107
            +++ GE        E +P + RK+D ++LP LC TY+L FLDK              L 
Sbjct: 54  DDVVAGEEANFYGSHELSPKVLRKVDLFILPFLCCTYLLMFLDKALLNYAASMGIKDHL- 112

Query: 108 FKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDM 167
            KGN++SN+  IF+  Y+       ++IQK P++K  G  + VW ++L  H   K    +
Sbjct: 113 -KGNEFSNLGTIFSAAYIFMEPVVTYLIQKFPISKILGTFITVWGIVLACHAACKTYASL 171

Query: 168 MALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHST 227
           M +R LLGL E+S +   + +  M+Y K EQ  R+  + +  G   +VG L+++G  H  
Sbjct: 172 MVVRTLLGLFESSSAVGCIAISGMYYTKSEQSARIGFWATQAGTGYIVGGLISFGFLHYH 231

Query: 228 SSSLKPWKLIFLVIGLINFVWA-FVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIK 286
            ++   W+++FLV+GL+   +    FLY+ PD+  NA FL  EEK++VVE +  NQ G++
Sbjct: 232 GTAFTSWQIMFLVVGLVTVAFGVLTFLYL-PDNVTNAWFLNKEEKIQVVEHIRANQTGLE 290

Query: 287 DTKLKPKQALEA-LKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLP 345
             K K +Q  E  L D                      F  ++   FGF      LLQLP
Sbjct: 291 TKKFKKQQVKELFLHDKFTWPMLLLTACSQISTGAIGTFSVTITGTFGFDKYETALLQLP 350

Query: 346 TGAIELVCVFAAGVLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLL 405
            GAI  + +       + ++     ++   + IP + G + +  +PL HK   +   +LL
Sbjct: 351 IGAITAMIILIT--TQMLSRWGHITLITTSMYIPAIIGCIVLISLPLSHKIGNLFSLYLL 408

Query: 406 YIIGGPVIMCWVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKG 465
           Y     +   ++  +   +G +K      +  ++Y    II  ++F A  APRYI     
Sbjct: 409 YSGSCVITNIYIWNSCNTSGYTKRVFRNAITMIVYNVSCIIAPQMFRAYSAPRYIPAKIA 468

Query: 466 LISSYACMMFLCILYYALMFYR-NKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519
           L+ +  C+     LY   +  + N+ RD++      +E +E     F D TD EN
Sbjct: 469 LLVT-QCVCVPLQLYIGYICKKENEKRDKE------QEGQERKKYQFLDLTDIEN 516

>Scas_590.10
          Length = 534

 Score =  199 bits (506), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 132/462 (28%), Positives = 215/462 (46%), Gaps = 29/462 (6%)

Query: 68  IRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVG 127
           + RK+D ++LP LC  Y+L FLDK            K L  KG+++SN+  IF+  Y+  
Sbjct: 85  VLRKVDMFILPFLCCIYLLMFLDKALLNYAASMGIKKHL--KGDEFSNLGTIFSAAYIFM 142

Query: 128 SIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMM 187
                ++IQK P++K     +  W ++L  H   K+   +M +R LLGL EAS +   + 
Sbjct: 143 EPIVTYLIQKYPISKVLSVFITTWGIVLTCHCACKSYASLMIVRTLLGLFEASSAVGCIA 202

Query: 188 MCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINFV 247
           +  M+Y K EQ  R+  +    G   +VG L+++G  H   +    W+++FLV+GL+  V
Sbjct: 203 ISGMYYTKSEQSARIGFWAIQAGTGYIVGGLISFGFLHYHGTEFTSWQIMFLVVGLVTIV 262

Query: 248 WAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEA-LKDLNVXX 306
           +  +  +  PD+  NA FLT EEK++VVE +  NQ G+++ K K +Q  E  LKD     
Sbjct: 263 FGIITFFYLPDNVTNAWFLTQEEKIQVVEHIRSNQTGLENKKFKKEQIKELFLKDKLTYP 322

Query: 307 XXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIE-LVCVFAAGVLALFTK 365
                            F +++   FGF      LLQLP GAI  L+ +    +++ +  
Sbjct: 323 MLLLTACSQISTGAIGTFSTTITATFGFDSYQTALLQLPIGAITALIILITTQMISRWGN 382

Query: 366 KNIRVILLFVLCIPTLAGLLGIHLIPLEHK--------WALVGCCWLLYIIGGPVIMCWV 417
             +    ++   IP + G + +  +PL HK            G C +  I        ++
Sbjct: 383 ITLVTTSMY---IPAIIGCIVMLALPLSHKVGNLLSLYLLYSGSCVITNI--------YI 431

Query: 418 LLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLC 477
             +   +G SK      +  ++Y    I+  ++F    APRYI     L+ + A  + L 
Sbjct: 432 WNSCNTSGYSKRVMRNAITMIVYNVSCIVAPQMFRQYSAPRYIPAKIALLVTQAVCIPLQ 491

Query: 478 ILYYALMFYRNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519
           +    +    N+ RDR+      +E KE     F D TD EN
Sbjct: 492 LYIGYICKKENQKRDRE------QEGKEVKKYQFLDMTDIEN 527

>KLLA0D11330g 970243..971808 similar to ca|CA2478|CaDAL52 Candida
           albicans allantoate permease (by homology), start by
           similarity
          Length = 521

 Score =  198 bits (503), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 147/515 (28%), Positives = 241/515 (46%), Gaps = 22/515 (4%)

Query: 12  EPFQVESGEILEIKGSASPSYDKGQLEVAGKHMVGAELFQELLEGESETSDKEYAPIRRK 71
           E  Q  + E + ++   SPS   G++ V G+    A  F +  E   E S +E   ++RK
Sbjct: 15  ESVQDATTEDVPLQTILSPS---GKVLVLGEAADEAMEFAKHHE-HIELSAEEDRKVKRK 70

Query: 72  IDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPA 131
           ID  ++P+    YM+QF+DK             D       YS   + F +GYL  S  A
Sbjct: 71  IDMIVMPLFSFLYMIQFMDKTCISFAAVMGIQTDYKMVDTMYSWTTSCFYLGYLFASPFA 130

Query: 132 NWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAM 191
              +QKLP  + +   +++W V+   H+ AK+      LR LLG++EA +SP  ++M   
Sbjct: 131 AVALQKLPSMRTSAICIVIWGVIQCLHVTAKSYATFTLLRTLLGVLEAFVSPIFVIMMNQ 190

Query: 192 FYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSS-SLKPWKLIFLVIGLINFVWAF 250
           +Y K E    +      NG+ T++ + ++YGL H+  S +++ +K++F+++G +      
Sbjct: 191 YYKKSEHFGYIGVLYGCNGLGTVILACISYGLYHNLGSYTMEAYKVLFIIVGCLTIFNGL 250

Query: 251 VFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALKDLNVXXXXXX 310
           + L++ P++PA+ARFL   EKL V+ER+  N  G      K  Q  E   D+        
Sbjct: 251 LILFIMPNTPADARFLNDREKLAVLERIRGNNQGFGSKTFKWHQMKECFMDMRTWLYFLI 310

Query: 311 XXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKKNIRV 370
                      S+F S ++KGFG+S   + L++ P GA ELV +    +++ F  K + +
Sbjct: 311 GISVAIPNGGISSFGSIILKGFGYSTEKSLLMKAPIGACELVGLVILPLISYFISKRMII 370

Query: 371 ILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIG-GPV--IMCWVLLNVTVAGSS 427
            + ++L       LL           AL G     YI G  PV  I     +    AG +
Sbjct: 371 AVFYLLVCVMSTCLLA---FSKNKNVALAG----YYITGIAPVGIITITSCVASNTAGHT 423

Query: 428 KISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMFYR 487
           K  T+  +  + Y+AGNI+G + F + +AP Y      ++  Y   + L      LM + 
Sbjct: 424 KKLTANAISLIGYSAGNIVGPQTFRSSDAPNYPKAKAAVVGCYCASIAL----MGLMSFL 479

Query: 488 NKTRDRKYGKPTPEEEKEGVI---NGFKDYTDFEN 519
           N   +R+  K   E   + V+     F D TDFEN
Sbjct: 480 NVRENRRRDKMQEELGDKYVVVENQEFADLTDFEN 514

>Kwal_33.15276
          Length = 552

 Score =  197 bits (501), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 137/507 (27%), Positives = 229/507 (45%), Gaps = 32/507 (6%)

Query: 15  QVESGEILEIKGSASPSYDKGQLEVAGKHMVGAELFQELLEGESETSDKEYAPIRRKIDR 74
             E   + E   SA  + DK      G H + ++L                    RK+D 
Sbjct: 69  HAEKVALSEDSTSAQEAVDKKAQNYFGSHELDSKLL-------------------RKVDW 109

Query: 75  WLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPANWV 134
           ++LP LC TY+L FLDK            K L  KG+++SN+  IF+  Y+       + 
Sbjct: 110 YILPFLCCTYLLMFLDKALLNYAASMGIKKHL--KGDEFSNLGTIFSAAYIFAEPFVTFC 167

Query: 135 IQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYN 194
           IQ+ PV+K  G  +++W  +L  H   K+   +M +R LLGL E+S +   + +  M+Y 
Sbjct: 168 IQRYPVSKVMGVFIMLWGAVLACHSACKSYASLMIVRTLLGLFESSSAVGCIAISGMYYT 227

Query: 195 KQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINFVWAFVFLY 254
           K EQ  R+  + +  G   +VG L+++G  H   +    W+++FLV+GL+  ++      
Sbjct: 228 KSEQSARIGFWATQAGTGYIVGGLISFGFLHYHGTEFTSWQIMFLVVGLVTVLFGIATFV 287

Query: 255 MAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALK-DLNVXXXXXXXXX 313
             PD+  NA FL  +EK++V+  +  NQ G+++ KLK  Q  E    D            
Sbjct: 288 YLPDNVTNAWFLNEDEKVEVLRHIRANQTGLENKKLKKHQLKELFCLDKLTYPMLMLTAC 347

Query: 314 XXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIE-LVCVFAAGVLALFTKKNIRVIL 372
                     F  ++ + FGF    + LLQLP GAI  ++ +    +L+ +    +  + 
Sbjct: 348 SQISTGSIGTFSVTITQTFGFDKYESALLQLPIGAITAMIILITTQMLSRWGNYTLVTVS 407

Query: 373 LFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLNVTVAGSSKISTS 432
           ++   IP + G + +  +PL HK   +   +LLY     +   ++  +   +G SK    
Sbjct: 408 MY---IPAIIGCIVMICLPLSHKIGNLFALYLLYSGSCVITNIYIWNSCNTSGYSKRVFR 464

Query: 433 KIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMFYRNKTRD 492
             +  ++Y    I+  ++F A  APRY+     L+ +    + L +    L    NK RD
Sbjct: 465 NAITMIVYNISCIVAPQMFRAYSAPRYMPAKITLLVTQCVCVPLQLYIGYLCREENKKRD 524

Query: 493 RKYGKPTPEEEKEGVINGFKDYTDFEN 519
           R+      +E KE     F D TD EN
Sbjct: 525 RE------QEGKEVPSYQFLDLTDIEN 545

>Kwal_47.17169
          Length = 576

 Score =  191 bits (486), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 134/469 (28%), Positives = 220/469 (46%), Gaps = 15/469 (3%)

Query: 63  KEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNV 122
           +E   + RKID ++ P+LC+ Y +QF+DK            +DL   G+ YS + + F  
Sbjct: 104 EEDRKLVRKIDLYMFPLLCLLYSIQFMDKISNGSAAIMGLREDLKMHGDQYSWVGSAFYF 163

Query: 123 GYLVGSI-PANWVIQKLP-VAKYTGCALIVWAVLLVAHIGAK-NTRDMMALRFLLGLMEA 179
           GYL  ++ P  ++ QK   +AK     +++W + L  H     N    + LR LLG  E+
Sbjct: 164 GYLFFNLGPGQFIFQKTRWLAKTLAVFVMIWGMFLALHAAPSVNYASFIFLRVLLGCAES 223

Query: 180 SISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGL-GHSTSSSLKPWKLIF 238
            ++P+  ++ + ++ K+EQ  R+C +   NG+  +  + LAYGL    +S S++ W+++F
Sbjct: 224 MVTPTFTIITSQYWKKEEQFMRVCMWFGFNGLGGIWANALAYGLYTRQSSYSIEAWRVLF 283

Query: 239 LVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEA 298
           ++ GLI      +  +  PD P+ A FLT  EKL VVER+  NQ G  +  +K  Q  EA
Sbjct: 284 IITGLITVAVGAMIYFHIPDDPSKAWFLTEREKLMVVERIRSNQQGFGNHHIKKYQIKEA 343

Query: 299 LKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKG-FGFSGLNATLLQLPTGAIELVCVFAA 357
             D+                   +NFI+ LIK   G+      L+ +PTGA+EL+     
Sbjct: 344 FTDVRTWLYFLFSVGNNIPNGGLTNFINILIKNELGYDTKKTLLMTMPTGAVELIACPLF 403

Query: 358 GVLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPL-----EHKWALVGCCWLLYIIGGPV 412
           G L++   +     L   L    +A  + +    +     + K   +   +LLYI     
Sbjct: 404 GYLSIVCARRQIPFLRHRLAWGIMASTVAVVATCMLAFGGDSKNTKLAGAYLLYIAPLSF 463

Query: 413 IMCWVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYAC 472
           I    +++    G +K  T   +  + Y + N+ G + F AK+AP Y      +I  YA 
Sbjct: 464 ICILSIISSNTLGYTKKWTVSSINLVSYASSNLAGPQTFIAKQAPGYTGAKIAMIVCYAS 523

Query: 473 MMFLCILYYALMFYRNKTRDRKYGKPTPEEEKEGVING--FKDYTDFEN 519
            + +    Y L +  N  RD+      P+E+   VI    F D TD EN
Sbjct: 524 TVVVLSALYILNYRENIRRDKIAAARGPDEK---VIENMEFADLTDKEN 569

>CAGL0G04081g 388383..389924 highly similar to tr|Q07904
           Saccharomyces cerevisiae YLR004c, hypothetical start
          Length = 513

 Score =  187 bits (474), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 133/453 (29%), Positives = 217/453 (47%), Gaps = 19/453 (4%)

Query: 72  IDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPA 131
           +D+++L  LCVTY+L FLDK            K  N KG+++SN++ IF+  Y+      
Sbjct: 68  LDKYILSFLCVTYLLMFLDKALLNYAAAMGIKK--NLKGDEFSNLSTIFSAAYIFMEPIV 125

Query: 132 NWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAM 191
             +IQ  P++K  G  +  W  +L  H   K    +M +R LLG+ E++ +   + +  M
Sbjct: 126 TLLIQYFPLSKIMGTFICTWGAVLACHSACKTYASLMIVRTLLGMFESASAVGCIAISGM 185

Query: 192 FYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINFVWAFV 251
           +Y K EQ  R+  + +  G   ++G L+++G  H        W+++FLV+GLI  V+  V
Sbjct: 186 YYTKSEQSARIGFWATQAGTGYVIGGLISFGFLHYHGRDFTSWQIMFLVVGLITVVFGIV 245

Query: 252 -FLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEA-LKDLNVXXXXX 309
            FLY+ PD+  NA FL H+EK+ V+E +  NQ G+++ K K     E  LKD        
Sbjct: 246 TFLYL-PDNVTNAWFLDHDEKVAVIEHIRDNQTGVENKKFKKSHIKELFLKDKLTWPMLM 304

Query: 310 XXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKKNIR 369
                        +F +++ K FGF    + LLQLP GAI    +       + ++    
Sbjct: 305 ITACSQISTGAIGSFSTTITKTFGFDSYESALLQLPIGAIVA--IIIIVTTQMISRWGHF 362

Query: 370 VILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYII--GGPVIMCWVLLNV-TVAGS 426
            ++   + IP + G + +  +PLEHK   +G  + LY++  G  VI    + N    +G 
Sbjct: 363 TLVTTSMYIPAVIGSIVLISLPLEHK---IGNLFSLYLVYSGSCVITNIYIWNTCNTSGY 419

Query: 427 SKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMFY 486
            K      +  ++Y    I+  ++F A  APRYI     L+ + A  + L +    L   
Sbjct: 420 CKRIFRNAITMIVYNISCIVAPQMFRAYSAPRYIPAKIALLVTQAVCIPLQLYVGYLSKK 479

Query: 487 RNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519
            N+ RD++     PE+        F D TD EN
Sbjct: 480 ENEKRDKEQEGQAPEKYM------FLDLTDIEN 506

>Kwal_47.16596
          Length = 504

 Score =  174 bits (441), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 128/449 (28%), Positives = 214/449 (47%), Gaps = 24/449 (5%)

Query: 54  LEGESETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDY 113
           LE  + T+++E A +R KID ++LP++C  +  Q+LDK            KDL    +D 
Sbjct: 43  LETVTFTAEEERALVR-KIDLYILPIMCFVFFSQYLDKQSLSYATVFGLTKDLKMGAHDI 101

Query: 114 SNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMAL-RF 172
           S  + IF +G L  +    +++  +P A  TG  +++W+V  +  + A NT+    + R 
Sbjct: 102 SWCSTIFYIGQLGANFVFTYLMTVIPRAPMTGACVVIWSVCCMC-LAAPNTKQGFWVGRL 160

Query: 173 LLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLK 232
            LG+ EA + P+ +++ + +Y K+EQP R   ++SMN +A ++GS L YG+G +  SS  
Sbjct: 161 FLGIFEAVVQPACVLITSYWYRKREQPMRTACWISMNAIAQIIGSYLMYGIGKTNKSSTA 220

Query: 233 PWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKP 292
            WK++F+  G I+ +   +F    P SP  ARFLT  EK   V+R+            K 
Sbjct: 221 DWKILFIACGAISLIAGVLFYLWIPISPRTARFLTKREKEIAVKRLFDESDRTATNVFKK 280

Query: 293 KQALEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIELV 352
           +Q  E LK   +                T  F S +++ FG+   +      P GA++L+
Sbjct: 281 EQLFECLKFDWLFLSAAAFGFLVTVTSGTIVFQSLMLRSFGYGKFDIMKFGSPAGAVQLL 340

Query: 353 CVFAAGVLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPV 412
            ++ A +          +I L ++CIP LAG + +  +     W ++   WL  +I   +
Sbjct: 341 FIWLAVLAVRLIPSERAMITLVLVCIP-LAGSIMVLCLSKNSGWWMIVGSWLGSVISCIM 399

Query: 413 IMCWVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGM--KGLISSY 470
            +   L++  V G++K S     +F  Y    II          P++  G    GLI + 
Sbjct: 400 SVLLSLMSSNVRGNTKKSVCSNAFFAGYCLAAII---------YPQWWIGTYRGGLIVNV 450

Query: 471 ACMMFLCILYYALMFYR------NKTRDR 493
              + L IL   L+FYR      NK RD+
Sbjct: 451 IMWVLLDIL---LIFYRFKAILENKKRDK 476

>KLLA0E09548g complement(846600..848135) similar to sgd|S0003994
           Saccharomyces cerevisiae YLR004c, start by similarity
          Length = 511

 Score =  172 bits (437), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/454 (26%), Positives = 215/454 (47%), Gaps = 11/454 (2%)

Query: 68  IRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVG 127
           + RK+D ++LP LC TY+L FLDK            KD N  G+++SN+  IF+  Y+  
Sbjct: 60  VLRKLDIFVLPFLCCTYLLMFLDKALLNYAASMGI-KD-NLVGDEFSNLGTIFSASYIFA 117

Query: 128 SIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMM 187
              A +++Q+ PV++  G  +I W V++V H   K    +M +R LLGL E+  +   + 
Sbjct: 118 EPFAVYLLQRFPVSRVLGSFIICWGVVVVCHCVCKTYASLMIVRVLLGLFESCSAVGCIT 177

Query: 188 MCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINFV 247
           +  M+Y K EQ  R+  + +  G   ++G L+++G  H   +    W+++FLV+GL+   
Sbjct: 178 VNGMYYTKSEQTQRIGYWAAQAGTGYIIGGLMSFGFLHYHGTEFTSWQIMFLVVGLVTVG 237

Query: 248 WAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALE-ALKDLNVXX 306
           +  V  +  PD+   A FL  +EK++V+E +  NQ G++  K+K  Q  E  LKD     
Sbjct: 238 FGIVTYFYLPDNVPKAWFLNEKEKVQVIEHIRSNQTGLETKKIKMHQVKELLLKDKLTWP 297

Query: 307 XXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIE-LVCVFAAGVLALFTK 365
                            F  ++   FGF     +LLQLP G +  ++ +    ++  F++
Sbjct: 298 MLLLTGCSQISTGSIGTFSVTITGTFGFDSYQTSLLQLPIGCVTIMIILITTQLIGRFSQ 357

Query: 366 KNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLNVTVAG 425
             +    ++   IP + G + +  +PL +K   +   +LLY     +   ++      +G
Sbjct: 358 FTLITTSMY---IPAIIGCIVMICLPLTNKIGNLLSLYLLYSGSCTITNIYIWNTCNTSG 414

Query: 426 SSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMF 485
            +K      +  ++Y    I+  ++F A   PRYI     L+ +      +C+     + 
Sbjct: 415 YTKRLARNGLTMIVYNIACIVAPQMFRAYSYPRYIPAKIALLVTQC----VCVPLQLYIG 470

Query: 486 YRNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519
           Y + T +R+  K   E E +     F D TD EN
Sbjct: 471 YTSYTENRRRDKEQAESETKPEQYQFLDKTDIEN 504

>Kwal_26.6658
          Length = 545

 Score =  172 bits (435), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 136/472 (28%), Positives = 214/472 (45%), Gaps = 17/472 (3%)

Query: 59  ETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAA 118
           E + +E   + RKID  + P++ + Y +QF+DK             DL   G+ YS   +
Sbjct: 73  ELTPEENKKLVRKIDLCMFPLMSLIYAIQFMDKTTLGNAAIMGLLPDLKMTGDQYSWAGS 132

Query: 119 IFNVGYLVGSIPANWVIQKLPVAKYTGCALIV-WAVLLVAHIGAK-NTRDMMALRFLLGL 176
            F  GYL G      ++QK        CA+I+ W ++L  H     N    + LR LLG 
Sbjct: 133 AFYFGYLGGLFVLPPLLQKCQYFMKLLCAIIITWGMVLALHSAPSVNYGAFIFLRCLLGF 192

Query: 177 MEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLG-HSTSSSLKPWK 235
            E++I+P+  ++ A ++ K+EQ  R+C +   NG+  M G  +AYGL   ++  S+  WK
Sbjct: 193 FESTITPAFTIITAQYWKKEEQFLRICIWFGFNGLGAMWGCSMAYGLYIRASEYSIAAWK 252

Query: 236 LIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQA 295
           ++F+  G I   +  + +   PDSP  A FL+  +K+ +  R+  NQ G  +  +K KQ 
Sbjct: 253 IVFISTGCITIFFGLLMMLHLPDSPTKAWFLSKHDKVLLTRRIRDNQQGFGNHHIKKKQI 312

Query: 296 LEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKG-FGFSGLNATLLQLPTGAIELVCV 354
            EAL D                    +NF S L K  FG++     L+ +   AI+ + +
Sbjct: 313 QEALIDPRTWLYFFYCVSASIPNGALTNFQSILFKSDFGYTTEKTLLVSIGIAAIQWIGL 372

Query: 355 FAAGVLALFTKK---NIRVILLFVLCIPTLAGLLGIHLIPL--EHKWALVGCCWLLYIIG 409
              G+ + F  K   N     L    +  L  L+G+ ++    E+K A +    L Y+  
Sbjct: 373 PLLGLASFFCAKRKINYLESRLIWSMMALLVALIGVCMLAFAKENKNAKLAGIALNYL-- 430

Query: 410 GPVIMCWVLLNVTVA--GSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLI 467
            P+    VL N++    GS+K  T   +  + Y A NI G   F + +AP Y      L+
Sbjct: 431 SPLAFICVLGNISANTLGSTKKWTVSSITLIGYAAANIAGPHTFISSQAPHYSGAKITLV 490

Query: 468 SSYACMMFLCILYYALMFYRNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519
             YA  + +    Y L    NK RD    +  P+ E       F D TDFEN
Sbjct: 491 VCYASGIAILATLYLLNARENKRRDEIVLEKLPQIENI----EFADLTDFEN 538

>Kwal_23.6486
          Length = 547

 Score =  149 bits (376), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 136/517 (26%), Positives = 225/517 (43%), Gaps = 29/517 (5%)

Query: 24  IKGSASPSYDKGQLEVAGKHMVG---AELFQELLEGESETSDKEYAPIRRKIDR---WLL 77
           I+   SP+ D+   E+    ++    A++  + LE      +   A   R++ R   W++
Sbjct: 32  IERVVSPADDRDLPELEKYKVISSRDADVTLKFLEENDHLVEPISAERERRLSRKVTWIV 91

Query: 78  PVLCV-TYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPAN-WVI 135
             L     M+ + DK            +D     N Y+N   +F VG++ G   +N + +
Sbjct: 92  VSLTAFIDMVLYADKAVMSFAAIFTFFEDTGLTQNRYNNANTLFYVGFIFGQ--SNLYFL 149

Query: 136 QKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNK 195
           QK PV K       +W +++  H  A N + + ALRF LG +E+   P+       F   
Sbjct: 150 QKFPVGKVVAVMTSLWCIIIFLHCTAFNHQGVYALRFFLGFVESIGIPALNTTMGQFLTA 209

Query: 196 QEQPFRMCTFLSMN-GVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINFVWAFVFLY 254
           +E+      F S   GV   VG  +AYG+ H TS+S+  WK+  ++IG I+ +   + + 
Sbjct: 210 EEKAATAPIFYSTCLGVTIPVG-FIAYGVLHITSTSVPTWKIFCIIIGAISLLVTILVVL 268

Query: 255 MAPDSPANARFLTHEEKLKVVERVSKNQ-MGIKDTKLKPKQALEALKDLNVXXXXXXXXX 313
           + P++P +A+FLT EEK+ V+ RV       I+  + K  Q  EAL D  +         
Sbjct: 269 IYPNNPTDAKFLTKEEKVWVIRRVQHTTGSSIEQKQFKKYQVKEALLD-PITWLFGAFFL 327

Query: 314 XXXXXXXTSNFISSLIKGF-GFSGLNATLLQLPTGAIELVCVFAAGVLALFTKKNIRVIL 372
                   +   + L KG  G S L+ATL+ + +GA ++ C   A    L  KKN+    
Sbjct: 328 LQQLANNLAYQQNLLFKGIGGISNLDATLVSVASGAFDVACAILASWF-LSYKKNMTAFS 386

Query: 373 LFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLNVTVAGSSKISTS 432
           +    IP+  G +G   +P  +K  L+    L    G P I+ +   + T +G +K  T 
Sbjct: 387 VVFWTIPSFVGSIGSIALPWSNKMGLLATMCLATPFGVPWILMFSWNSTTCSGYTKKLTR 446

Query: 433 KIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMFYRNKTRD 492
                  Y   NII  +++    APRY       I    C  F       +++Y    R+
Sbjct: 447 NAFVMFWYGIANIISPQLWQESSAPRY---YPAWIVQIVCSFFTAPALALVIWYILNKRN 503

Query: 493 RKYGKPTPEEEKEGVI--NGFK--------DYTDFEN 519
           ++       E+  GV+  +G K        D TD+EN
Sbjct: 504 KERAAALATEDTVGVVEHDGQKVKVNVAMLDLTDYEN 540

>Scas_630.15
          Length = 550

 Score =  142 bits (359), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 128/478 (26%), Positives = 211/478 (44%), Gaps = 33/478 (6%)

Query: 57  ESETSDKEYAP-----IRRKIDRWLLPVLCVTY-MLQFLDKXXXXXXXXXXXXKDLNFKG 110
           E++ S  E  P     +RRK+  W++  L  T   L + DK             D +   
Sbjct: 69  ENDASVPEITPEQEKRLRRKV-AWIIVSLTATIDFLLYSDKATLSYASIFELWDDTHLTQ 127

Query: 111 NDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMAL 170
           N Y+N   +F VGY++G +   WV QK  + K        W +++  H  A N + + AL
Sbjct: 128 NRYNNANTLFYVGYIIGLVNLIWV-QKFSIRKVMAFMCTTWTIIIFLHCVAYNYQGIYAL 186

Query: 171 RFLLGLMEASISPS-NMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSS 229
           RF LG +EA   P+ N+ M       ++  +    + S  G    V SL+AYG+ H+  S
Sbjct: 187 RFFLGFVEAIAVPTLNISMNQFLTPDEKNAYAPIFYSSCIGCGVFV-SLIAYGILHA-HS 244

Query: 230 SLKPWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSK-NQMGIKDT 288
            +  WKL  ++IG + F+   V  Y+ P +P +A+FL  EEK+ V+ RV K +   I+  
Sbjct: 245 HVHTWKLFMIIIGGMTFLMTAVVYYIYPSNPTDAKFLNKEEKVWVIRRVQKSSNSSIEQK 304

Query: 289 KLKPKQALEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFG-FSGLNATLLQLPTG 347
            +K  Q +EALKD  V                 +   + L +  G  + L+ T++ + +G
Sbjct: 305 VIKKYQIIEALKD-PVSWLFSAFFLLQQLANNLTYMQNLLFENIGHITNLDTTIVSIASG 363

Query: 348 AIELVCVFAAGVLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWA-----LVGCC 402
               VC   A +  L+ KKN     +    +P+LA  + +  I    +W      L   C
Sbjct: 364 GFASVCAIIATIFLLY-KKNFTAFSVVFWTLPSLAACIAMVSI----RWGDNIPLLTMLC 418

Query: 403 WLLYIIGGPVIMCWVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITG 462
               + G P ++ +     + +G +K  T   M    Y   NII  +++   +APR++  
Sbjct: 419 LASPLFGIPWVLMFSWSVTSCSGYTKRVTRNAMVMFWYCIANIISPQLWQEHDAPRFVPA 478

Query: 463 -MKGLISSYACMMFLCILYYALMFYRNKTRDRKYGKPTPEEEKEGVINGFKDYTDFEN 519
            +  ++ S+     L ++ Y ++  RN  R +       EE       GF DY D EN
Sbjct: 479 WITQIVLSFFLAPSLALVIYFILRRRNVKRLQNIQNSKDEE-------GFIDY-DGEN 528

>YLL055W (YLL055W) [3368] chr12 (30109..31704) Member of the
           allantoate permease family of the major facilitator
           superfamily (MFS) [1596 bp, 531 aa]
          Length = 531

 Score =  142 bits (357), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 109/444 (24%), Positives = 205/444 (46%), Gaps = 8/444 (1%)

Query: 59  ETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAA 118
           E + ++   ++RK+   +   +    +L ++DK            +D     N Y+ +  
Sbjct: 42  EITPEQEKKLKRKLFLTIFTFVSAINLLLYMDKATLSYDSILGFFEDTGLTQNTYNTVNT 101

Query: 119 IFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLME 178
           +F VG+ +G  P  ++ QKLP+ K+ G  L  W +L+     A N   ++ALRF LGL E
Sbjct: 102 LFYVGFAIGQFPGQYLAQKLPLGKFLGGLLATWTILIFLSCTAYNFSGVVALRFFLGLTE 161

Query: 179 ASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIF 238
           + + P  +    MF++  E+      F +    + +    +AYG+ H T+ S+  WK+  
Sbjct: 162 SVVIPILITTMGMFFDASERAAAQPFFFAACMGSPIPTGFIAYGVLHITNPSISLWKIFT 221

Query: 239 LVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQ-MGIKDTKLKPKQALE 297
           ++IG + F+   V +   P++PA+ +F + +E++ ++ RV  +    I+    K  Q  E
Sbjct: 222 IIIGGLTFIMTVVVILWFPNNPADVKFFSIQERVWIIRRVQASTGSSIEQKVFKKSQFRE 281

Query: 298 ALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGF-GFSGLNATLLQLPTGAIELVCVFA 356
           A+KD  +                     + L +G  G   L +TL+ +      +VC F 
Sbjct: 282 AMKDY-ITWLFGLFFLLQQLANNLPYQQNLLFEGMGGVDALGSTLVSVAGAGFAVVCAFI 340

Query: 357 AGVLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWA-LVGCCWLLYIIGGPVIMC 415
           A  L L   KNI  +      +P L G +    +P ++K   L   C    I G P I+ 
Sbjct: 341 A-TLMLAKWKNISALTAIFWTLPALVGSIAAAALPWDNKIGILANICMAGQIFGIPFIIA 399

Query: 416 WVLLNVTVAG-SSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITG-MKGLISSYACM 473
               + + +G + K++ S +  F M  A NII  +I+  K++PR++   +  ++ S++  
Sbjct: 400 LSWASSSASGYTKKLTRSSVSLFAMGIA-NIISPQIWREKDSPRFLPAWIVQIVLSFSLA 458

Query: 474 MFLCILYYALMFYRNKTRDRKYGK 497
             + +L + ++  RN  R + Y +
Sbjct: 459 PAILLLIHFILKRRNNQRLKNYDE 482

>KLLA0F00286g 14519..16138 some similarities with sp|Q9C0U9
           Schizosaccharomyces pombe Putative membrane transporter,
           hypothetical start
          Length = 539

 Score =  128 bits (322), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 116/452 (25%), Positives = 206/452 (45%), Gaps = 31/452 (6%)

Query: 88  FLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCA 147
           F+DK             D      D++N+ +IF  GYL+   P + ++QKLP+ KY   +
Sbjct: 92  FMDKSTIGYTTILGIYTDTGISKGDFNNLNSIFYAGYLIAQWPCHILMQKLPLGKYLAGS 151

Query: 148 LIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLS 207
           +  WA+++       N   +MA RF LG  EA + P+  +   MF   +++      F +
Sbjct: 152 IFSWAIIVGLTGICNNYGSLMACRFFLGATEAVVVPACEITLGMFLTTEQREIVQPVFWA 211

Query: 208 MNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLT 267
               A ++ S +++GL H T++S  PW++   +   ++ + A + L + PD+PANA+FL+
Sbjct: 212 ATAAAPLLSSFISFGLMH-TNTSTYPWRIFMAINAGLSLILAIIVLLLYPDNPANAKFLS 270

Query: 268 HEEKLKVVERVSKN-QMGIKDTKLKPKQALEALKDLNVXXXXXXXXXXXXXXXXTSNFIS 326
            +EK+ ++++V ++ +  I+   +K  Q  E  KD  V                 +   +
Sbjct: 271 TKEKVYLIKQVQRSTESSIEQKTIKKYQIYETFKD-PVSWLFFFQSFTLMLSNSLTYQQN 329

Query: 327 SLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKKNIRVILLFVLCIPTLAGLLG 386
            L    G   L ++L+       +++       + L        I    L +P +A  + 
Sbjct: 330 QLYVDIGVDNLGSSLVSAAGSVWDILLYLIFAFVILNYPNQSGYIAAGCLILP-IASSIA 388

Query: 387 IHLIPLEHKWALVGCCWL-------LYIIGGPVIMCWVLLNVTVAGSSKISTSKIMWFLM 439
           +  I   +K+AL+ C  L        YII     + W     + AG +K     +M+ L 
Sbjct: 389 MVTIDWSNKYALLACMILAGSSKGITYIIA----LGWT--TSSAAGYTKKLYRNVMFMLA 442

Query: 440 YTAGNIIGSKIFYAKEAPRYITG--MKGLISSYACMMFLCILYYALMFYRNKTRDRKYGK 497
           Y A NII  +++  K+APRY     ++ ++S +  ++ L  + Y L   RNK R  ++ +
Sbjct: 443 YGAANIISPQLWNPKDAPRYYPSWIIQIVVSFFLNIVILLTIRYILA-KRNKER-YQWVQ 500

Query: 498 PTPEEE------KEGV---IN-GFKDYTDFEN 519
             PE+        EGV   +N    D TDFEN
Sbjct: 501 EHPEDNFGIVSFTEGVNERVNLAMLDLTDFEN 532

>KLLA0C18678g complement(1655735..1657387) similar to sgd|S0003978
           Saccharomyces cerevisiae YLL055w, start by similarity
          Length = 550

 Score =  127 bits (319), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 111/472 (23%), Positives = 203/472 (43%), Gaps = 17/472 (3%)

Query: 60  TSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAI 119
           T+++E   + RK+   ++ +     ++ + DK            +++    N Y+N   +
Sbjct: 77  TAEQE-KRLSRKVTWIIVSLTAFINLILYSDKATASYASILGLWEEVGITQNQYNNSNTL 135

Query: 120 FNVGYLVGSIPAN-WVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLME 178
           F VG++VG   AN + +Q  P+         +W +++  H    N R    LRF LG +E
Sbjct: 136 FYVGFIVGQ--ANLYFVQTYPLKYVVSVMTALWTIVIFLHCACTNYRSFYVLRFFLGFVE 193

Query: 179 ASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIF 238
           +   P        F    E+      F S     T+    +AYG+ + TS+S+  WK+  
Sbjct: 194 SVAIPCLNTTMGQFLTADEKAASAPMFYSTCVGVTIPVGFIAYGVLNITSTSVSLWKIFM 253

Query: 239 LVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQ-MGIKDTKLKPKQALE 297
           ++IG   F+   + L++ P++P +A+FL   EK+ V+ RV +     I+   +K  Q  E
Sbjct: 254 MIIGACTFLLTILVLFIYPNNPTDAKFLNTNEKVWVIRRVQQTTGSSIEQKVVKKHQIKE 313

Query: 298 ALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFG-FSGLNATLLQLPTGAIELVCVFA 356
           AL D  +                     + L K  G  S L++TL+ + +G   + C   
Sbjct: 314 ALLD-PISWLFAAFFLLQQLANNLPYQQTLLFKSIGNISSLDSTLVSVASGGFAVACCIL 372

Query: 357 AGVLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVG-CCWLLYIIGGPVIMC 415
           A    L+ K      ++F   IP+  G + +  IP +   AL+   C      G P I+ 
Sbjct: 373 ATTFLLYFKNYTAFSVVF-WTIPSFVGSIAMVSIPFDKHIALLAMLCMASPAFGVPWILM 431

Query: 416 WVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITG-MKGLISSYACMM 474
           +   + T +G +K  T   +    +   N+I  +++  K+ PRYI   +  ++ S++   
Sbjct: 432 FSWNSTTCSGYTKKLTRNAIVMFFFCVANLISPQLWQEKDGPRYIPAWIVQIVLSFSIAP 491

Query: 475 FLCILYYALMFYRNKTR-------DRKYGKPTPEEEKEGVINGFKDYTDFEN 519
            + I+ + ++  RN+ R       ++K+G      E         D TD EN
Sbjct: 492 SIAIVIWYILRKRNQERAINLEAEEKKFGLIEVNGESIKANIAMLDLTDHEN 543

>KLLA0C19019g 1689555..1691090 weakly similar to sp|P53322
           Saccharomyces cerevisiae YGR260w TNA1}, start by
           similarity
          Length = 511

 Score =  116 bits (290), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 96/386 (24%), Positives = 172/386 (44%), Gaps = 28/386 (7%)

Query: 51  QELLEGES-ETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFK 109
           QE LE E+ E   KE A   RK+D  LLP+L   Y L  LD+            +DL   
Sbjct: 46  QESLENENLEIDPKEEAAFVRKLDTRLLPMLAFMYFLSSLDRSNIGNAYTSGMREDLQLT 105

Query: 110 GNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMA 169
              YSN  ++F   YL   +P   +++K     Y    ++ W+++ + +   ++   ++A
Sbjct: 106 SKQYSNAVSVFYSTYLAAELPTTLILKKTKPKYYMSFLVLSWSIITLCNAFVQSYASLIA 165

Query: 170 LRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGH-STS 228
           LR LLG  E    P+  ++ ++ Y KQEQ  R+  F   + ++   G L+A GL     +
Sbjct: 166 LRVLLGAFEGGFFPAMTLIISILYKKQEQGKRIAFFFGSSALSGAFGGLIATGLASMKPA 225

Query: 229 SSLKPWKLIFLVIGLINF---VWAFVFLYMAPDSPANARFLTHEE----KLKVVERVSKN 281
             L+ W+ ++++ GLI+    VW F+ L   P    N  +L+  E    K++  +RV+  
Sbjct: 226 GGLEGWRWLYIIEGLISVCASVWLFLEL---PKDFDNIPYLSARETEILKIRAKQRVA-- 280

Query: 282 QMGIKDTKLKPKQALEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIK-GFGFSGLNAT 340
            MG  D + +     +ALKD                    S F+++++K G G++   A 
Sbjct: 281 YMG--DGRFEWSYVFDALKDFKTYISFTIQFCQDVILYGFSTFVTAILKLGLGYTSREAQ 338

Query: 341 LLQLPTGAIELVCVFAAGV--LALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWAL 398
            + +P      V + AA V  ++ +    ++V     +C   +  +  I L+ + +    
Sbjct: 339 YMSVP------VYILAAIVFLISAYISDRLKVRAPIFVCYNVIGAVGYILLLSVHNNSVK 392

Query: 399 VGCCWLLYI---IGGPVIMCWVLLNV 421
              C+L+      G  + + W+  NV
Sbjct: 393 YFACYLITFSLYTGTGLNIAWLTNNV 418

>Kwal_47.16586
          Length = 502

 Score =  114 bits (286), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 124/505 (24%), Positives = 213/505 (42%), Gaps = 53/505 (10%)

Query: 22  LEIKGSASPSYDKGQLE-VAGKHMVGAELFQELLEGESETSDKEYAPIRRKIDRWLLPVL 80
           LE KGSAS        E VA  H V   LF + LE            I  K D  +LP++
Sbjct: 14  LEGKGSASLRGSVSDRELVAIDHDV---LFDDALERS----------ICWKFDVRILPMI 60

Query: 81  CVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPV 140
            V Y+   LDK            KDL  +G +++N+ +IF + +++ + P + VI+K   
Sbjct: 61  AVMYLFNALDKGNISNAKTDHIDKDLGIEGQEWNNMLSIFYIPFVLFAFPLSLVIKKYNA 120

Query: 141 AKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPF 200
           A      +  +  + +      N   +MA R+ LG+ E++  P  +   + FY + E   
Sbjct: 121 ANVIPALMFTFGSISLLSATVFNYGSLMAARWFLGICESAFFPGIIYYLSTFYRRHELAR 180

Query: 201 RMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINFVWAFV-FLYMAPDS 259
           R+  F +   +A     LL++G+    +S LK W+++FLV G +  ++A V FLY+ P S
Sbjct: 181 RLSIFYAAANIANAFSGLLSFGIFQIKNSKLKGWQILFLVEGSLTVIFAVVAFLYL-PRS 239

Query: 260 PANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALKDLNVXXXXXXXXXXXXXXX 319
           P  + FL+  EK     R+  +     D K+  K A++  K                   
Sbjct: 240 PEKSHFLSENEKECARWRIEIDSSAKSDEKVSFKDAIKVFKHPVAIAWMFQEILIGVPLN 299

Query: 320 XTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKKNIRVILLFVLCIP 379
             +N+   +++  G   ++  L  +       V   AA ++  F+    RV  +F++ I 
Sbjct: 300 SINNWFPQIVQSLGKGTVHTNLYTVAPN----VWGAAALIILCFSSDYARVRSVFIM-IG 354

Query: 380 TLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLL---------------NVTVA 424
               L+G         + + GC      +G     C+++                N T  
Sbjct: 355 VSVTLIG---------FVVFGCIDTKAHLGVAYFSCFLMTTGSSVSSVLTSTWYNNNTPN 405

Query: 425 GSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSY-ACMMFLCILYYAL 483
            + ++  S I   L   AG +I + IF AK+AP+YI  + G+ + +    + L     A 
Sbjct: 406 ENRRVVISAIGVPLANAAG-LISTNIFRAKDAPKYIPAL-GITAGFGGAAILLIAAILAY 463

Query: 484 MFYRNKTRDRKYG-----KPTPEEE 503
           M + N+ R+++ G     K  P  E
Sbjct: 464 MIFDNRRRNKRQGVNLTYKDVPTSE 488

>ABR113C [705] [Homologous to ScYLL055W - NSH] (601035..602474)
           [1440 bp, 479 aa]
          Length = 479

 Score =  114 bits (286), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 113/467 (24%), Positives = 204/467 (43%), Gaps = 11/467 (2%)

Query: 61  SDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIF 120
           ++ E   + RK+  +++ +      + ++DK            +D+N   N Y+N+  +F
Sbjct: 9   TEAEEKKLARKVMWYIVGLTASINFITYIDKAQLSYSTLLGFFEDVNMSLNRYNNVNTLF 68

Query: 121 NVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEAS 180
            VGY+ G I   + IQK P+       L +W ++++      + + +  LR  LG  EA 
Sbjct: 69  YVGYITGQINLLF-IQKFPLKNVVIVLLTIWCIIMMVQCAMTDYKGVYVLRLCLGFTEAI 127

Query: 181 ISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLV 240
           I P+      MF  + E+      F+      ++   +L+Y +    + ++  WK++ ++
Sbjct: 128 IIPALNNTMLMFLTENEKAATAPIFVIATVSVSIPMGVLSYLILLIKNPAISHWKILSII 187

Query: 241 IGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQ-MGIKDTKLKPKQALEAL 299
           IG + FV A V LY+ P++P +A+FL+ +EK+ V+ RV       I+  K+K  Q +E L
Sbjct: 188 IGSLTFVVALVALYLYPNNPTDAKFLSLKEKVWVIRRVQDTTGSSIEQKKIKKHQIIEGL 247

Query: 300 KDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFG-FSGLNATLLQLPTGAIELVCVFAAG 358
           +D  +                 S   + L+K  G    ++A+L+   +G + ++    A 
Sbjct: 248 RD-PISWLFLLFFATQQLANNLSYQRNLLLKSAGHIDDMHASLISSSSGGLAVIGSLVAS 306

Query: 359 VLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLE-HKWALVGCCWLLYIIGGPVIMCWV 417
            + +F KKN     + +  IP+  G + +  +P   H   +V  C      G P IM   
Sbjct: 307 FI-MFKKKNFTAYTVVLWSIPSFIGCVAMMALPDNAHIAMVVMICIASSTDGIPWIMMIS 365

Query: 418 LLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLIS-SYACMMFL 476
               + +G SK  T   M  + Y+  N+I  +++     PRY       +S S+     L
Sbjct: 366 WSTTSTSGYSKRLTRIGMVMVGYSISNLISPQLWQEAHGPRYYPAWAVQLSLSFFFAPAL 425

Query: 477 CILYYALMFYRNKTRDRKYGKPTPEEEKEGVIN----GFKDYTDFEN 519
            IL   ++  RNK R           E +G +        D TD EN
Sbjct: 426 AILIRIILARRNKERLALASDNLGAVEIDGDLVKTNLAMLDLTDLEN 472

>KLLA0A09449g 825574..827106 similar to sp|P53322 Saccharomyces
           cerevisiae YGR260w TNA1, start by similarity
          Length = 510

 Score =  114 bits (285), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 110/451 (24%), Positives = 188/451 (41%), Gaps = 16/451 (3%)

Query: 68  IRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYL-V 126
           + RK+D +L+P++C+ Y L  LDK            + LN  GN Y N   +F   Y+  
Sbjct: 60  VVRKMDLYLVPLMCMLYFLSNLDKSNIGNAEVAGLSESLNLTGNQYGNCVTVFYATYIFF 119

Query: 127 GSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNM 186
             I AN +    P    TGC LI +  + +     K+   ++ +R LLG  EA+I PS  
Sbjct: 120 DPIGANLLKIIGPKYMMTGC-LICFGAISLGTAWVKDYGHLLLVRVLLGAFEATIYPSIN 178

Query: 187 MMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINF 246
           M  ++ Y +++   R         +++  G L++YG     + SL  W+ I++V G I+ 
Sbjct: 179 MYLSICYRREQYAIRFAWVFFAACISSSFGGLISYGCS-KINGSLNAWQYIYIVEGCISL 237

Query: 247 VWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALKDLNVXX 306
            +A  +     ++   + F T EE+  +V+R           K +  Q   A+KDL    
Sbjct: 238 GFAPFYALGLANNLEESWFWTAEERQYIVDRYETMSTFNPADKFEWSQVWLAVKDLKTWV 297

Query: 307 XXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKK 366
                          + F+  +I   GFS +NA L+ +P   +  +  FA      +   
Sbjct: 298 SAVALFCIDMTAFGLTVFMPIIITSMGFSSVNAQLMTVPVYFLTAITFFACA----YVSD 353

Query: 367 NIRVILLFVL--CIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLNVTVA 424
            IR+   F++  CI    G L I L    H   L G   L   I     M  + L+    
Sbjct: 354 RIRIRSPFIVGACISCATG-LAIVLGSDVHGVRLFGIFVLALGIYVNASMNCLWLSGNNG 412

Query: 425 GSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALM 484
              K +T+  +   + ++  ++  +IF A++ PRY  G+   +        L ++ Y + 
Sbjct: 413 NYFKRATALGINLFVGSSSGLVSGQIFRAEDKPRYALGLAICLGLQVFAAMLTVVQYYMY 472

Query: 485 FYRNKT------RDRKYGKPTPEEEKEGVIN 509
              NK       R  +  +P P +E    +N
Sbjct: 473 RRLNKQKQALIKRCEELDEPIPHDEHLSDMN 503

>CAGL0F08371g 835733..837322 highly similar to sp|P53322
           Saccharomyces cerevisiae YGR260w TNA1, hypothetical
           start
          Length = 529

 Score =  114 bits (285), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 122/533 (22%), Positives = 222/533 (41%), Gaps = 35/533 (6%)

Query: 1   MSLHSKKQDTKEPFQVESGEILE----IKGSASPSYDKGQLEVAGKHMVGAELFQELLEG 56
           M+L  +  D  E  +V SG   +    +    SP  +  + E   K ++ +   +E+L G
Sbjct: 1   MTLRMRGHDNIEE-EVSSGHDFDDGRKVVKVESPLRETDESESDEKKVLESANEREVL-G 58

Query: 57  ESETSDKEYAP---------IRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLN 107
            +   D    P         I +K+D +++P+L + Y L  LDK            K + 
Sbjct: 59  TTTDDDGYMLPSLDHPMEKKILKKMDLFIIPLLGLMYFLSNLDKSNIGNAEVAGLSKSIG 118

Query: 108 FKGNDYSNIAAIFNVGYLV-GSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRD 166
            KG +Y+    +F   Y+V   + AN +    P    + C L   A+ L      KN   
Sbjct: 119 LKGKEYNIAVTVFFGTYIVFDPVGANLLKIMGPNRMMSSCLLCFGAISLATAF-IKNYGQ 177

Query: 167 MMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHS 226
           ++A+R LLG+ E  I P+  M  ++ Y +++   R     +   +++  G L+AYG    
Sbjct: 178 LLAVRLLLGMFEGMIYPAINMYLSVCYRREQYAVRFAFVFTAAALSSAFGGLIAYGCS-K 236

Query: 227 TSSSLKPWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIK 286
              SL+ W+ I++V G I+  +  V+++       ++ F T EE+  V+ER +       
Sbjct: 237 IHGSLEAWQYIYIVEGAISIGFVPVYIWGLGRKLEDSWFFTEEEREYVIERYNTMNTFNP 296

Query: 287 DTKLKPKQALEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPT 346
           D K +  Q   A+KD+                   + F+  ++   GFS + A L+ +P 
Sbjct: 297 DEKFEWFQVWLAVKDIKTWVSAIALFGIDLTTFGLTVFLPIIVTSLGFSHVRAQLMTVPV 356

Query: 347 GAIELVCVFAAGVLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGC---CW 403
             +  V  F   + +   K  +R   +   C+ T  G L I L    H     G    C 
Sbjct: 357 YFLTAVVFFVCAIWS--DKLKLRSPFIIGACLTTSIG-LAIVLGSTVHGVRYFGVFILCM 413

Query: 404 LLYIIGGPVIMCWVL-LNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITG 462
            +Y+       C  L L+       K +T+  +   + +   ++  +IF AK+ PRYI G
Sbjct: 414 GIYVNAA----CNCLWLSGNNGNYFKRATALGINLFIGSGSGLVSGQIFLAKDKPRYIMG 469

Query: 463 MKGLISSYACMMFLCILYYALMFYRNKTRDR------KYGKPTPEEEKEGVIN 509
           +   +      + +  L + L +  N+ + +      + G+P P +E+   +N
Sbjct: 470 LSLCLGFQVLSIVMTALQFYLYYRSNQQKQKIIDHCHEIGEPIPYDERLSDLN 522

>Kwal_14.782
          Length = 491

 Score =  110 bits (275), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 129/298 (43%), Gaps = 5/298 (1%)

Query: 52  ELLEGESETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGN 111
           +  E E     +E   +  K+DR LLP+L   Y L  LD+            +DL     
Sbjct: 28  DFFEAEYYIDPREERALVSKLDRRLLPMLAFMYFLSSLDRSNIGNAYTSGMKEDLRLTSR 87

Query: 112 DYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALR 171
            YSN  ++F   YL   +PA W+++      Y    +  W+V+ ++    ++   ++A R
Sbjct: 88  QYSNAVSVFYSTYLAAELPAVWLLKIAKPRYYMSTLVFCWSVITLSSGFVQSYGSLLATR 147

Query: 172 FLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSS- 230
            LLG  E    P+  ++  M Y  +EQ  R+  F   + ++   G L+A GL    S+S 
Sbjct: 148 ILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAFFFGSSALSGAFGGLIATGLASVKSTSG 207

Query: 231 LKPWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEE--KLKVVERVSKNQMGIKDT 288
           L+ W+ ++++ GLI+        +  PD+    +FL   E   +K+ E+     MG  + 
Sbjct: 208 LEGWRWLYIIEGLISVCATAWLFFGLPDNLDEMKFLNDRELAVMKIREKQRVQYMG-ANP 266

Query: 289 KLKPKQALEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIK-GFGFSGLNATLLQLP 345
                Q L A KD                    S F+++++K G G++   A  + +P
Sbjct: 267 AFSWSQVLLAFKDFKTYFAFVIQFCQDIILYGFSTFLTAILKLGLGYTSREAQYMSVP 324

>YGR260W (TNA1) [2206] chr7 (1012490..1014094) Nicotinic acid
           permease, member of the allantoate permease family of
           the major facilitator superfamily (MFS) [1605 bp, 534
           aa]
          Length = 534

 Score =  108 bits (271), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 112/513 (21%), Positives = 207/513 (40%), Gaps = 30/513 (5%)

Query: 5   SKKQDTKEPFQVESGEILEIKGSASPSYDKGQLEVAGKHMVGAELFQELLEGESETSDKE 64
           S+++ T+  FQ + G    +      S+DK       + ++      + +   S   +K 
Sbjct: 27  SEEKPTEVTFQEDEGHDASLHNR---SHDKKSELATEREIMATTTDDDGIPSPSHPMEKR 83

Query: 65  YAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGY 124
              + RK+D +L+P++ + Y L  LDK            KD++  G  Y+    +F   Y
Sbjct: 84  ---VLRKMDIYLIPLMGMLYFLSNLDKSNIGNAEVAGLSKDIHLVGTQYNTCVTVFFATY 140

Query: 125 -LVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISP 183
            L   I  N +    P    + C L  +  + +     KN   ++ +R LLG  E  I P
Sbjct: 141 VLFDPIGTNLLKIMGPPLMMSIC-LTCFGAISLGTAWVKNYAQLIVVRLLLGAFEGMIYP 199

Query: 184 SNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGL 243
           +  M  ++ Y +++   R     S   +++  G L+AYG     S SLK W+ I++V G 
Sbjct: 200 AINMYLSVCYRREQYALRFAFVFSAACLSSSFGGLIAYGCS-KISGSLKDWQYIYIVEGC 258

Query: 244 INFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALKDLN 303
           I+  +   + +    +  ++ F   EEK  + ER         D K +  Q  +A+KD+ 
Sbjct: 259 ISLGFVPFYAFGLSKNLEDSWFFNKEEKEYISERYKTMNTFDPDEKFEWFQVWQAVKDVK 318

Query: 304 VXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALF 363
                             + F+  +I   GF+ + A L+ +P   +  +  F   V +  
Sbjct: 319 TWASAVALFGIDLTTFGLTVFLPIIITSMGFTNVRAQLMTVPIYFLTAIVFFICAVWS-- 376

Query: 364 TKKNIRVILLFVLCIPTLAGL---LGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLN 420
            +  +R   +   C+ T  G+   LG  +  + +    + C  +   +       W  L+
Sbjct: 377 DRIKLRSPFILGACLTTSIGIAIVLGSQVHGVRYFGVYILCMGIY--VNAACNCLW--LS 432

Query: 421 VTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILY 480
                  K +T+  +     +   ++  +IF AK+ PRYI   KGL  S A  +F   + 
Sbjct: 433 GNTGNYFKRATALGINLFFGSGSGLVSGQIFVAKDKPRYI---KGLSISLAFQVFSIFMT 489

Query: 481 YALMFYRNKTRDRK---------YGKPTPEEEK 504
              +F   +  D+K          G+P P +E+
Sbjct: 490 VVQIFLYKRENDKKKAIIDRCNELGEPIPYDER 522

>ADR330W [2071] [Homologous to ScYGR260W (TNA1) - SH]
           complement(1283989..1285470) [1482 bp, 493 aa]
          Length = 493

 Score =  103 bits (257), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 104/443 (23%), Positives = 185/443 (41%), Gaps = 16/443 (3%)

Query: 68  IRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLV- 126
           I RK+D  LLP++C+ Y L  LDK            +DL   GN Y N   +F   Y+  
Sbjct: 45  IVRKMDLCLLPLMCILYFLSNLDKSNIGNAAIAGMTEDLKLVGNQYGNCVTVFFATYITF 104

Query: 127 GSIPANWV-IQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSN 185
             I AN + I   PV   TGC +I + ++ +     KN   ++ +R LLG  E +I P+ 
Sbjct: 105 DPIGANLMNIVGAPVMM-TGC-IIGFGLISLCTAWVKNYWQLLLIRILLGAFEGNIYPAI 162

Query: 186 MMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLIN 245
            M  ++ Y +++   R         V++  G L++YG  H    SL  W+ I++V G + 
Sbjct: 163 NMYLSVCYRREQYAIRFAWVFFAACVSSSFGGLISYGCAH-IKGSLNAWQYIYIVEGALT 221

Query: 246 FVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALKDLNVX 305
                 + +    +  ++ F   EE+  ++ R         + + + +Q   A++D+   
Sbjct: 222 LAVVPFYWFGLSKNLQDSWFFNKEEREYIIRRYETMYTYNPNERFEWRQLWLAVRDVKTW 281

Query: 306 XXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLP----TGAIELVCVFAAGVLA 361
                           + F+  +I G GF+ + A L+ +P    T     +C + +  L 
Sbjct: 282 ISAISLFCIDLTTFGLTIFMPIIISGMGFTHIRAQLMTVPVYFFTAITFFICAYLSDKLR 341

Query: 362 LFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLNV 421
           L   ++  ++   V C   LA +LG H   ++     V    L   +       W  L+ 
Sbjct: 342 L---RSPFIVGACVTCAIGLAIVLGSHSNAVKFFGIFVLA--LGIYVNASTNCLW--LSG 394

Query: 422 TVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYY 481
            V+   K +T+  +     ++  ++  +IF   E P Y TG+   +S     +FL +L  
Sbjct: 395 NVSNYYKRATALGINLFSGSSSGLVAGQIFTEAEKPGYKTGLTLCMSLQIAAIFLTLLQL 454

Query: 482 ALMFYRNKTRDRKYGKPTPEEEK 504
              +  NK +     +   EE K
Sbjct: 455 FCYYRLNKKKKAMLAQSDKEELK 477

>Kwal_27.12832
          Length = 508

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/316 (22%), Positives = 139/316 (43%), Gaps = 10/316 (3%)

Query: 55  EGESETSD-----KEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFK 109
           E ++ +SD      E   + RK+DR  +PVL   Y LQ LDK            +DL   
Sbjct: 43  EEQTASSDLYIDPDEEKALMRKLDRRFVPVLAFAYFLQSLDKTNIGNAYTSGMKEDLQLT 102

Query: 110 GNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMA 169
            + YSN  ++    +LV  +P    ++ +P   +    +  W+V+ + +   ++   ++A
Sbjct: 103 PHQYSNAVSVLYSTFLVAQVPTVLYLKIIPSRYFLSAMVFCWSVITLGNGFIQSYHSLIA 162

Query: 170 LRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGH-STS 228
           LR LLG  E    P+ +++ +M Y  +EQ  R+  F     +A   G L+A GL   + +
Sbjct: 163 LRVLLGAFEGGYFPAMILLVSMIYKPEEQAKRIALFFGCAALAGAFGGLIATGLATVNGA 222

Query: 229 SSLKPWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDT 288
           S L  W+ ++++ GLI+   +    +  P       FL  +E+  ++   +K ++    +
Sbjct: 223 SGLNGWRWLYIIEGLISITASIWIYFGLPTDIEKPAFLNEQEQ-AIMHIRAKQRLQYVGS 281

Query: 289 KLKPKQAL--EALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIK-GFGFSGLNATLLQLP 345
           K         +ALKD  V                 + F+ +++K G G++   A  + +P
Sbjct: 282 KPDFSWTFVWDALKDYKVYTGLVIQFCQNIILYAFTTFLPAILKLGMGYTSREAQYMSVP 341

Query: 346 TGAIELVCVFAAGVLA 361
              +  +   ++  L+
Sbjct: 342 VYILAAIVFLSSAYLS 357

>ACL203C [846] [Homologous to ScYIL166C - NSH; ScYOL162W - NSH]
           (4853..6466) [1614 bp, 537 aa]
          Length = 537

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 110/485 (22%), Positives = 194/485 (40%), Gaps = 39/485 (8%)

Query: 54  LEGESETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDY 113
            + E + S  E   + R++D  +  + C+ +     D+            ++LN   NDY
Sbjct: 55  FDPELKWSKDEEKRLVRRLDFKVAFIACILFCAMEADRFNYFQGTSDEMLEELNVTTNDY 114

Query: 114 SNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFL 173
           +    +FNV +L+G++P   + ++  V +   C +I+W  + +A  G +N   ++ LR  
Sbjct: 115 NLGNQLFNVFHLLGTVPVQLIAKRYGVERVVPCQMIIWGCVAMAQAGMRNKVGLIILRVF 174

Query: 174 LGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTS-SSLK 232
           +GL EA  +   +     FY  +E   R+  F    G+   V  L +YG+        L 
Sbjct: 175 MGLAEAGFAAIMVTWLTSFYTAKELGMRVSYFWVAQGLMNSVLPLASYGIFRMRGICGLS 234

Query: 233 PWKLIFLVIGLINFVWA-FVFLYMAPDSPANARFL------THEEKLKVVERV-----SK 280
            W+ +FL  G+I  V   F F Y  P        L      T  ++L  V R+     SK
Sbjct: 235 GWQWLFLFEGVITCVMGIFGFFYFVPSIVETKSLLHPKGWFTERQELIAVNRLLRDDPSK 294

Query: 281 NQMGIKDTKLKPKQALEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNAT 340
             M  K T +  K  +EAL D ++                   ++  ++K  GFS     
Sbjct: 295 GDMNNK-TGVSAKLFIEALLDYDLWPLYLLALVHFFPEAAAGPYMLIILKDVGFSTFTVQ 353

Query: 341 LLQLPTGAIELVCVFAAGVLALFTKKNIRVILLFVLCIPTLA--GLLGIHLIPLEHKW-- 396
           LL +       V +    +L ++   + R +L  V C+  L   G L       E +W  
Sbjct: 354 LLSISNFFSNTVAILV--MLKIYEVVDERSLLSLVSCVWKLVLLGFLRWWKGAFETRWET 411

Query: 397 -----ALVGCCWLLYIIGGPVIMCWVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIF 451
                 L+ C ++      P++  W   N     +  +S + +  F     G + G++I+
Sbjct: 412 YALMVVLLACPYIF-----PMMFSWASRNSHSIKTRSVSAAVLQVF--NVIGFVCGNQIY 464

Query: 452 YAKEAPRYITGMKGLISSYACMMFLCI---LYYALMFYRNKTRDRKYGKPTPEEEKEGVI 508
              +AP Y  G   L       + + I   LYY    +RN+ R+  +   T E++++  I
Sbjct: 465 RMDDAPLYHRGNTILFFLMLANIPIFIGVKLYY---MWRNRRRELVWNAMT-EQDRQSYI 520

Query: 509 NGFKD 513
               D
Sbjct: 521 ENTTD 525

>YIL166C (YIL166C) [2512] chr9 complement(30938..32566) Member of
           the allantoate permease family of the major facilitator
           superfamily (MFS) [1629 bp, 542 aa]
          Length = 542

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 108/470 (22%), Positives = 200/470 (42%), Gaps = 40/470 (8%)

Query: 60  TSDKEYAPIRRKIDRWLLPVLCVTYMLQFLD--KXXXXXXXXXXXXKDLNFKGNDYSNIA 117
           T D+E   + RK+D  L   L V  M  FLD  +             DL    NDY+   
Sbjct: 66  TKDEE-KKLVRKMD--LKIFLWVFIMFAFLDLIRKNIARAVSDNFIVDLKMNTNDYNLGQ 122

Query: 118 AIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLM 177
            ++ V +L   +P N + ++    +     +++W+V+ +   G KN    +A R LLG++
Sbjct: 123 TVYLVIFLASELPGNLLSKRFGPERVIPVQIVLWSVICITQAGLKNRGQFIATRCLLGMV 182

Query: 178 EASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTS-SSLKPWKL 236
           +    P N++  + +Y   E  FR+  F     +  ++GSLLA G+       +L  W+ 
Sbjct: 183 QGGFIPDNILYLSYYYTGAELTFRLSFFWCAIPLFQILGSLLASGIIEMRGIHNLAGWQY 242

Query: 237 IFLVIGLINFVWAFVFLYMAPDSPAN----------ARFLTHEEKLKVVERVSKNQMGIK 286
           +F++ G ++        Y+    P            + F  +EEK+ +V R+ ++     
Sbjct: 243 LFIIEGFLSLSVGVASFYLMRRGPTQTGESAFHKGKSLFTEYEEKI-MVNRILRDDPSKG 301

Query: 287 D-TKLKP---KQALEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLL 342
           D +  +P   K+ L  L + ++                  +++S ++K   +S   + +L
Sbjct: 302 DMSNRQPVTFKEILYTLTEFDLWPLFIQGITAFISLQTVGSYLSLILKSLNYSTFLSNIL 361

Query: 343 QLPTGAIELVCVFAAGVLAL-FTKKNIRVILLFVLCIPTLAGLLGIHLIPLE-HKWALVG 400
            +P  A+ L+ +  A +L+    +K++ V +  V  +P +  L+    +P + + W  + 
Sbjct: 362 AIPGQALLLINLPLAALLSRKLKEKSLCVGIANVWVLPFIVSLVA---LPTDTNPW--IK 416

Query: 401 CCWLLYIIGGP----VIMCWVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEA 456
              L  I+G P    ++  WV        S  + T+  ++ +    G II S ++   + 
Sbjct: 417 YILLTGILGLPYTHSILAGWVSEISNSVRSRTVGTA--LYNMSAQVGAIIASNMYRNDDK 474

Query: 457 PRYITGMK---GLISSYACMMFLCILYYALMFYRNKTRDRKYGKPTPEEE 503
           P Y  G K   G      CM      YY     RNK +DRK+   T EE+
Sbjct: 475 PYYTRGNKILLGFTCFNICMAVATKFYY---ISRNKYKDRKWNSMTKEEQ 521

>Scas_645.7
          Length = 546

 Score = 89.7 bits (221), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 92/452 (20%), Positives = 180/452 (39%), Gaps = 18/452 (3%)

Query: 68  IRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGY-LV 126
           I +K+D +L+P++ + Y L  LDK             D+   G  Y+    +F   Y L 
Sbjct: 96  ILKKMDIFLIPLMGILYFLSNLDKSNIGNAEVAGLSDDIGLVGTQYNTCVTVFFGTYILF 155

Query: 127 GSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNM 186
             I +N +    P    + C L  + V+ +     KN   ++ +R LLG  E  I P+  
Sbjct: 156 DPIGSNLLKIMGPPTMMSIC-LFCFGVISLGTAWIKNYAQLIVVRLLLGAFEGMIYPAIN 214

Query: 187 MMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINF 246
           M  ++ Y +++   R     S   +++  G L+AYG       SL  W+ I++V G I+ 
Sbjct: 215 MYLSVCYRREQYAMRFAFVFSAAALSSSFGGLIAYGCSQ-IHGSLHSWQYIYIVEGAISI 273

Query: 247 VWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALKDLNVXX 306
            +   + +    +  +  F   EE+  +VER         D K +  Q   A+KD+    
Sbjct: 274 GFVPFYYFGLNKNLEDTWFFNKEEREYIVERYKTMNTYNPDEKFEWFQVWLAVKDIKTWV 333

Query: 307 XXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKK 366
                          + F+  +I   GF+ + A L+ +P   +     F   + +   K 
Sbjct: 334 SAVALFGIDLTTFGLTVFLPIIITSLGFTNVRAQLMTVPVYFLTAFVFFGCALWS--DKL 391

Query: 367 NIRVILLFVLCIPTLAGL---LGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLNVTV 423
            +R   +   C+ T  G+   LG  +  + +    + C  +   +       W  L+   
Sbjct: 392 RLRSPFIIGACLTTAVGISIVLGSKVHGVRYFGVFILCMGIY--VNAACNCLW--LSGNN 447

Query: 424 AGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYAL 483
               K +T+  +   + +   ++  +IF A + P Y+ G+   ++     + +  + + L
Sbjct: 448 GNYFKRATALGINLFIGSGSGLVSGQIFVAADKPGYVKGLSICLAFQILSIIMTFIQFIL 507

Query: 484 MFYRNKTRD------RKYGKPTPEEEKEGVIN 509
               N  ++       + G+P P +E+   +N
Sbjct: 508 YKRANAKKEAIIIHCEEIGEPIPYDERLSDMN 539

>KLLA0F09405g 867882..869513 similar to sp|P40445 Saccharomyces
           cerevisiae YIL166c, start by similarity
          Length = 543

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 94/445 (21%), Positives = 178/445 (40%), Gaps = 24/445 (5%)

Query: 79  VLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKL 138
           V C  ++   LD+            +DL+   ND++    +F + + +  +P+  + ++L
Sbjct: 86  VACFLFIALQLDRGNLSQAVADNLLEDLHMDTNDFNLGNQLFYLSFFLAELPSQLISKRL 145

Query: 139 PVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQ 198
               +    +  W+V+ +A     N    +  R L+G +E       ++    F+  +E 
Sbjct: 146 GPDIFIPIQICAWSVVAMAQAAMHNKAGFLICRCLIGALEGGFIADLVLWLTYFFTSKEL 205

Query: 199 PFRMCTFLSMNGVATMVGSLLAYG-LGHSTSSSLKPWKLIFLVIGLINFVWAFVFLY-MA 256
             R+  F +   +  +V +LLAYG L       L  W+ +FL+ G++ F+      Y M 
Sbjct: 206 SIRLSWFWTSLSIVQVVSALLAYGILRMRGIGGLAGWQYLFLLEGILTFLIGLSGFYLMV 265

Query: 257 PDSPANARFL------THEEKLKVVERVSKNQMGIKDTKLKP----KQALEALKDLNVXX 306
           P +     ++      T  E+  VV RV ++     D   +     K    A+ D ++  
Sbjct: 266 PGAVQTKNWMHPKGWFTEREEKIVVNRVLRDDPSKGDMHNRQPISFKLLWSAISDYDLWP 325

Query: 307 XXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKK 366
                          S +++  +K  GFS LN  LL +P   I +  +      A    +
Sbjct: 326 IYLIGLIAYVPMNTVSTYLTLTLKSVGFSTLNVQLLSIPYQVIHITLLIGVTWYAERIDQ 385

Query: 367 NIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVI----MCWVLLNVT 422
              + ++  +      G+L      L   W     C LL  +GGP +    + WV  N  
Sbjct: 386 RAYMGVIASIWNALFLGVLRWWKGSLVEAWPTFALCTLL--LGGPYVHAICVSWVSRNSN 443

Query: 423 VAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGL--ISSYACMMFLCILY 480
              +  +S++  ++ +    G I  ++I+   +AP Y TG   L  IS     +FL   +
Sbjct: 444 SIKTRALSSA--LYNMAVQVGAIYSTQIYRKNDAPLYHTGNTVLFAISIAGIPVFLFAKW 501

Query: 481 YALMFYRNKTRDRKYGKPTPEEEKE 505
           Y     RNK ++  + + + +E  E
Sbjct: 502 YYRT--RNKRKEAIWSQMSEDERVE 524

>AER444W [2944] [Homologous to ScYIL166C - NSH]
           complement(1487859..1489502) [1644 bp, 547 aa]
          Length = 547

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 108/476 (22%), Positives = 186/476 (39%), Gaps = 35/476 (7%)

Query: 61  SDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIF 120
           + +E   I RK+D  +  V C+      +D              DLN   N Y+    +F
Sbjct: 72  TKEEERRIVRKLDIHVALVACILLGAFQIDSGNLSQAVADNMLDDLNMDTNQYNLGNQLF 131

Query: 121 NVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEAS 180
           ++  L+  IP   + +++ +       ++ W+V+ ++    KN       R  +GL E  
Sbjct: 132 SIIVLLAEIPVQLLSKRIGLDIVIPSQVVCWSVVAMSQTAMKNYTGFFITRMFIGLFEGG 191

Query: 181 ISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTS-SSLKPWKLIFL 239
              +  +  + FY  +E   R+  F +    A M+ SL A+G+       +L  W+ +FL
Sbjct: 192 FMSNLTLWLSYFYTSRELAVRVSLFFATMSTAHMMTSLGAFGIFRMRGLCNLAGWQWMFL 251

Query: 240 VIGLINFVWAFVFLYMAPDSPANAR-------FLTHEEKLKVVERVSKNQMGIKDTKLKP 292
           + GLI      +   +   S    +       + +  E L  V RV ++     D   + 
Sbjct: 252 LEGLITLCIGMIGYMLVVPSIVQTKNKLYRKGWFSESEMLIAVNRVLRDDPSKGDMHNRQ 311

Query: 293 KQALEA----LKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGA 348
             +L A    L+D ++                 S ++   ++  GFS LN  L+ LP  A
Sbjct: 312 GLSLGAFLNTLRDYDLWPVYLIGLIQYITEATVSPYLLLTLRNAGFSRLNVQLMALPNSA 371

Query: 349 IELVCVFAAGVLALFTKKNI---RVILLFVLCI--PTLAGLLGIHLIPLEHKWALVGCCW 403
                 ++ GVL +     I   R ++  + C+    L G+L        + W       
Sbjct: 372 -----SYSIGVLVITKFAQIIDERALVGLIPCVWKAVLLGMLRWWPGTFVNAWGTYAIMI 426

Query: 404 LLYI--IGGPVIMCWVLLNVTVAGSSKISTSKIMWFLM-YTAGNIIGSKIFYAKEAPRYI 460
           +L       P+ + WV  N   A S K  T     F M Y  G I  ++I+ A +AP Y 
Sbjct: 427 VLLAAPFTNPICVGWVSKN---ANSIKTRTVACATFQMFYRTGIIAATQIYRADDAPLYH 483

Query: 461 TGMKGLISSYACMMFLCI---LYYALMFYRNKTRDRKYGKPTPEEEKEGVINGFKD 513
            G   L       + + I   LYY    +RNK+RD+ +     E+E+   I+   D
Sbjct: 484 RGNSILFWIIIANIPVIISTKLYY---IWRNKSRDKIW-DAMSEDERRNYIHTTTD 535

>KLLA0D07370g complement(630095..631894) similar to
           ca|CA4956|IPF4583 Candida albicans putative allantoate
           permease (by homology), start by similarity
          Length = 599

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 97/475 (20%), Positives = 187/475 (39%), Gaps = 26/475 (5%)

Query: 54  LEGESETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDY 113
            + E   + +E   + RK++  +  V C  ++   LD+            +DL    NDY
Sbjct: 117 FDPEFTWTKEEEQKVVRKLNIRVALVACYLFVALQLDRGNLSQAVVDNLLEDLGMNRNDY 176

Query: 114 SNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFL 173
           +    IF + +L+  IP+  + ++L    +    +  W+V+ +A     N       R L
Sbjct: 177 NLGNQIFYISFLLAEIPSQLISKRLGPDIFIPIQICSWSVVAMAQAAMHNKTGFFICRCL 236

Query: 174 LGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYG-LGHSTSSSLK 232
           +G +E       ++    F+  +E   R+  F +   +  ++ ++LAYG L       L 
Sbjct: 237 IGALEGGFIADLVLWLTYFFTSKEFSIRLSWFWTSLSLVQILSAILAYGILRMRGIGGLA 296

Query: 233 PWKLIFLVIGLINFVWAFVFLYMAPDSPANAR--------FLTHEEKLKVVERVSKNQMG 284
            W+ +FL+ G++ F       Y+   S    +        F   EEK+ VV RV ++   
Sbjct: 297 GWQYLFLLEGILTFFIGLTGFYLMVPSAVQTKNWMHPKGWFTEREEKI-VVNRVLRDDPS 355

Query: 285 IKDTKLKP----KQALEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNAT 340
             D   +     K    A+ D ++                 + +++  +K  GFS  N  
Sbjct: 356 KGDMHNRQPISFKLIWSAISDYDLWPIYFIGLIAYVPTNVLTTYLTLTLKSVGFSTFNVQ 415

Query: 341 LLQLPTGAIELVCVFAAGVLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVG 400
           LL +P   I ++ +      +   K+   + ++  +       +L      L   W    
Sbjct: 416 LLSIPYQVIHIIFLLGITWFSERVKQRAYMGIISAVWNAFFLAILRWWKGSLVEAWPTFA 475

Query: 401 CCWLLYIIGGPVI----MCWVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEA 456
            C LL  +G P +    + WV  N     +  +S++  ++ +    G I  ++I+   + 
Sbjct: 476 LCTLL--LGSPYVHAICVSWVSRNSNSIKTRALSSA--LYNMAVQVGAIYSAQIYRENDK 531

Query: 457 PRYITGMKGLIS--SYACMMFLCILYYALMFYRNKTRDRKYGKPTPEEEKEGVIN 509
           P Y TG   L S       +FL + +Y     RNK ++  + K + +E  E + N
Sbjct: 532 PLYHTGNTVLFSLAVVTTPIFLFVKWY--YHKRNKDKEAIWSKMSEDERIEYIHN 584

>AFR229C [3421] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH]
           (853001..854608) [1608 bp, 535 aa]
          Length = 535

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 104/471 (22%), Positives = 186/471 (39%), Gaps = 32/471 (6%)

Query: 61  SDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIF 120
           + +E   + RK+D  +    CV +    +D+             D+    NDY+    +F
Sbjct: 60  THEEERKLVRKLDLRVALTSCVLFAALQIDRGNLGQAVADNMLDDIKMNTNDYNLGNQLF 119

Query: 121 NVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEAS 180
            V +L+  +P+  + +KL    +    ++ W+V+ ++     N    +  R ++GL+E  
Sbjct: 120 YVFFLLAEVPSQLISKKLGPDIFIPIQMVAWSVVAMSQAALSNKTGYLITRSVIGLLEGG 179

Query: 181 ISPSNMMMCAMFYNKQEQPFRMCTF-LSMNGVATMVGSLLAYGLGHSTSSSLKPWK---- 235
                ++  + FY   E P R+  F  +M+ V      L          + L  W+    
Sbjct: 180 FIADLVLWLSYFYTATELPIRLSFFWTTMSLVEVCTSLLAFLLFRLRGIAGLTGWQWLFL 239

Query: 236 ---LIFLVIGLINFVWAFVFLYMAPDSPANARFL------THEEKLKVVERVSKNQMGIK 286
              L+ L+IGL        F  M P +      L      T  E+L VV RV ++     
Sbjct: 240 LEGLLTLIIGLSG------FYLMVPSAVQTKNMLHPQGWFTEREELIVVNRVLRDDPSKG 293

Query: 287 D----TKLKPKQALEALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLL 342
           D      L PK   +AL D ++                 S +++  +K  GFS     LL
Sbjct: 294 DMHNRQALTPKLIWQALTDYDLWPIYVIGLVHYLPDGTVSPYLTLTLKSVGFSKFTVQLL 353

Query: 343 QLPTGAIELVCVFAAGVLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCC 402
            +P   I ++ +      +    +   + L+  +   TL GLL      L   W      
Sbjct: 354 AIPRSIIFIIFLLGITRFSEKISQRALLGLIPSVWNTTLLGLLRWWSGSLVKAWPTYTIL 413

Query: 403 WLLYIIGGPVI----MCWVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPR 458
            LL  +G P I    + W   N     +  IS +  ++ +    G+II ++++   +AP 
Sbjct: 414 TLL--LGAPYIHAICVSWASRNSNSIKTRAISAA--VYNMFVQMGSIISNQLYREDDAPL 469

Query: 459 YITGMKGLISSYACMMFLCILYYALMFYRNKTRDRKYGKPTPEEEKEGVIN 509
           Y  G + L    A  + L IL      +RNK+RD+K+   T  +++  ++N
Sbjct: 470 YHRGNEILFWIMATNIPLFILVKLYYMHRNKSRDKKWNSMTECQQRAYIVN 520

>CAGL0F00209g complement(22109..23731) weakly similar to sp|P53322
           Saccharomyces cerevisiae YGR260w TNA1, hypothetical
           start
          Length = 540

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/324 (21%), Positives = 134/324 (41%), Gaps = 22/324 (6%)

Query: 48  ELFQELLEGESETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLN 107
           E  ++    E E  DK+    RRK+D  +L +LC  Y+  +LD+            +DL+
Sbjct: 66  ESLKDYTTEELEILDKK---TRRKMDLRILIMLCWIYICNYLDRSNIASARLGGLEEDLH 122

Query: 108 FKGNDYSNIAAIFNVGYLVGSIPANWVIQKL-PVAKYTGCALIVWAVLLVAHIGAKNTRD 166
                Y    +I  VGY+   IP N ++ +L   + +    +  W ++       ++   
Sbjct: 123 LSSQQYQTAISILFVGYITMQIPCNIILNRLGRPSVFLSVIMTAWGIVSTCTGAVQSYGG 182

Query: 167 MMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHS 226
           ++A+R +LG +E+     ++   + +Y K+E   R     S + ++     L++ G+   
Sbjct: 183 LLAIRVILGFVESGFFGCSLYYLSCWYTKKELGLRNSILYSGSLISGAFSGLISAGIIEH 242

Query: 227 TSSS--LKPWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMG 284
              +  L+ W+  F++ G I      +  ++ PD+P N++FLT  E+  V+ ++   +M 
Sbjct: 243 MDGTRGLRAWRWCFIIEGAITVGTVPLAYFILPDNPDNSKFLTETERDLVMWKL---RME 299

Query: 285 IKDTKLKPKQALE------------ALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGF 332
           + D+    +   E            AL D  V                T NF  S++K  
Sbjct: 300 VGDSDSDKEMLGESGHNSFWYALKLALTDTKVWLLTGCLTFLVAAAGVT-NFFPSVVKTL 358

Query: 333 GFSGLNATLLQLPTGAIELVCVFA 356
            +  +    L  P   I ++  F 
Sbjct: 359 NYGRIKTLCLTAPPYLIAIITTFG 382

>Sklu_1875.1 YAL067C, Contig c1875 643-2361 reverse complement
          Length = 572

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 98/431 (22%), Positives = 166/431 (38%), Gaps = 35/431 (8%)

Query: 81  CVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPV 140
           C+ Y +++LD             ++L FKGND      +F VG ++  IP  + + K+P+
Sbjct: 131 CMAYWVKYLDTVNLNNAYVSGMKEELKFKGNDLVQTQVMFTVGNIIFQIPFLFFLNKVPL 190

Query: 141 AKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPF 200
                   I W++L +      +   + A+RF +G  EA    +   +   FY K ++  
Sbjct: 191 NYLLPALDICWSILTIGASQVDSVPHLKAIRFFIGAFEAPAYLAYQYLFGCFY-KHDEMV 249

Query: 201 RMCTFLSMNGVATMVGSLLAYGLGHSTSSSLK------PWKLIFLVIGLINFVWAFVFLY 254
           R   F  +   A   G L A G+  +  +SL        W+  F++  +++ V   +  Y
Sbjct: 250 RRSAFYYLGQYA---GILSAGGIQSAVFASLDGVNGLSGWRWNFIIDAIVSIVIGILGFY 306

Query: 255 MAPDSPAN--ARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALKDLNVXXXXXXXX 312
           M P  P N  + FLT +E     +R+ +N     D   K    LE  K +          
Sbjct: 307 MLPGDPYNCYSIFLTDDEIRLARKRLKENNTEKSDFASKVFD-LEVWKRIVFDWKVYILT 365

Query: 313 XXXXXXXXTSNFISSL-------IKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTK 365
                    +N  S         +K +    LN   L + T  + +V +F  GV A   K
Sbjct: 366 LWNIFCWNNNNGSSGAYLLWLKSLKKYSIPKLNK--LSMITPGLGMVYLFVTGVFA--DK 421

Query: 366 KNIRVILLFVLCIPTLAG--LLGIHLIPLEHKWALVGCCWLLYIIG---GPVIMCWVLLN 420
            + R   +    +    G  +L +  +P   KW      ++L   G    PV+  W    
Sbjct: 422 SHSRWGAIIFTQVFNFMGNVILAVWDVPEGAKW----YAFMLQYFGWAMAPVLYSWQNDI 477

Query: 421 VTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILY 480
                 ++  T  IM  L  T+   I   ++   EAPRY+ G      +  C+    ++ 
Sbjct: 478 CRKDAQARAVTLVIMNMLAQTSTAWISVLVWKTPEAPRYLKGFTWTAVASFCLSVWTLV- 536

Query: 481 YALMFYRNKTR 491
             L FY+   R
Sbjct: 537 -VLWFYKRDER 546

>KLLA0A06193g 566780..568096 similar to sp|P25621 Saccharomyces
           cerevisiae YCR028c FEN2 high affinity H+/pantothenate
           symporter, hypothetical start
          Length = 438

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 85/203 (41%), Gaps = 2/203 (0%)

Query: 71  KIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIP 130
           ++D  +L  +C+ Y + ++D+            +DL FK N ++     F VGYL+G IP
Sbjct: 6   RVDLTVLSFVCLQYWINYVDRIGFTNAYVSGMKEDLGFKSNQFNIANTCFTVGYLLGMIP 65

Query: 131 ANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCA 190
            N ++ ++    +       W +L ++     +      +RF     E+       ++  
Sbjct: 66  HNLILLRIKPRIWLSFCTFAWGILTLSMFSIDSVWQCYVIRFFQAWFESCTFSGTHLILG 125

Query: 191 MFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTS--SSLKPWKLIFLVIGLINFVW 248
            +Y   + P R   F S   +  M    L   +  S +  + L  WK +F++ GLI    
Sbjct: 126 SWYTPSQLPIRTAIFTSSGLLGAMTSGFLQVAIHDSLNGKAGLPGWKWLFIIDGLITIPI 185

Query: 249 AFVFLYMAPDSPANARFLTHEEK 271
           A   L+  P+  A+AR   H+  
Sbjct: 186 ALYGLFFFPEPDADARESNHKNS 208

>CAGL0L08052g complement(878996..880450) similar to sp|P25621
           Saccharomyces cerevisiae YCR028c FEN2 high affinity
           H+/pantothenate symporter, start by similarity
          Length = 484

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 102/247 (41%), Gaps = 6/247 (2%)

Query: 55  EGESETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYS 114
           E + E  +K +  +  KID ++L  +C+ Y + ++D+             DL   G D S
Sbjct: 17  ESKKEPVNKRW--VIAKIDLFVLSFVCLQYWINYVDRIGFTNAYVSGMKADLKMVGKDLS 74

Query: 115 NIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLL 174
                F VGY+VG IP N ++ K+P   +       W +L +      +   +  LRF  
Sbjct: 75  IANTCFTVGYVVGMIPHNLILLKVPPRIWLSFCTFAWGILTLGMYHVTHFHQVCVLRFFQ 134

Query: 175 GLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTS--SSLK 232
            L E+       ++   +Y ++E P R   F S   V +M    +   + H  +  + L 
Sbjct: 135 ALFESCTFSGTHLILGSWYLEKELPIRSAIFTSSGLVGSMFSGFMQSSIFHHLNGRNGLA 194

Query: 233 PWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKP 292
            W+ +F++   I    A   L   P  P +    +     KV+   +++++     +L P
Sbjct: 195 GWRWLFIIDFCITIPIALYGLLFFPGMPESTNDNSRLSMTKVI--FNEHELQYARRRLPP 252

Query: 293 KQALEAL 299
           +    +L
Sbjct: 253 RDETTSL 259

>Kwal_33.13267
          Length = 550

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 106/481 (22%), Positives = 188/481 (39%), Gaps = 44/481 (9%)

Query: 61  SDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIF 120
           +++E   I RK+D  +    C  +    +D+            +DL    NDY+    IF
Sbjct: 75  TEQEEKKIIRKLDWRVAIPACFMFAALQIDRGNLGQAVADNMLEDLKMTTNDYNAGMQIF 134

Query: 121 NVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEAS 180
              +++  +P+  + +K+    +    ++ W+V+ +A     N       R LLGL+E  
Sbjct: 135 YACFVIAEVPSQLMSKKIGPDLFIPMQMMGWSVVAMAQSAITNKGGYFVTRALLGLLEGG 194

Query: 181 ISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYG-LGHSTSSSLKPWKLIFL 239
                ++  + FY  +E   R+  F +   +  +  +LLA+  L       L  W+ + L
Sbjct: 195 FIADLVLWLSYFYTSKELTIRLSWFWTSYSLVQICTALLAFAILRMRGIGGLTGWQWLLL 254

Query: 240 VIGLINFVWAFVFLYMAPDSPANAR--------FLTHEEKLKVVERVSKNQMGIKDTKLK 291
           + G +  +      Y+   S    R        F   EEKL VV RV ++     D  + 
Sbjct: 255 LEGALTLLMGASAFYLMVPSAVQTRNWLHPKGWFTEREEKL-VVNRVLRDDPSKGD--MN 311

Query: 292 PKQALE------ALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLP 345
            +QAL       AL D ++                 + +++  +K  GFS  N  LL +P
Sbjct: 312 NRQALSFRKLWAALTDFDLWPIYAIGIIAYIPVNTLTPYLTLNLKHLGFSTFNVQLLTIP 371

Query: 346 TGAIELVCVFAAGVLALFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGC-CWL 404
              + +       +L  +  +  +   L  L  P  +       + L   W   G   W 
Sbjct: 372 YNILHI----ILLLLVTWITERFQERALVCLSAPVFSSF----FLALIRWWPGSGTKAWP 423

Query: 405 LYII-----GGPVI----MCWVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKE 455
            Y+I     G P I    + WV  N     S  IS++  ++ +    G+I  ++I+ A +
Sbjct: 424 TYVITTLFLGQPYIHAICVSWVSRNSNSIKSRSISSA--LYNMFVQLGSIAANQIYRADD 481

Query: 456 APRYITG-MKGLISSYAC--MMFLCILYYALMFYRNKTRDRKYGKPTPEEEKEGVINGFK 512
            P Y  G M+    S A   ++ L  LYY    YRNK +D  +   + +E    ++    
Sbjct: 482 KPLYHRGNMQLFFISVALIPILLLTKLYYV---YRNKKKDEIWNTMSEDERANYILTSRD 538

Query: 513 D 513
           D
Sbjct: 539 D 539

>Sklu_2010.5 YCR028C, Contig c2010 7036-8589
          Length = 517

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 87/196 (44%), Gaps = 10/196 (5%)

Query: 71  KIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIP 130
           K+D ++L  +C+ Y + ++D+            +DL   GND++ I   F VGY++G +P
Sbjct: 46  KVDLFVLSFVCLQYWINYVDRVAFANAYVSGMKQDLGLHGNDFNLINTCFTVGYVIGMVP 105

Query: 131 ANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCA 190
            N ++  +P   +     + W VL ++     +     A+RF   L E+       ++  
Sbjct: 106 NNLMLLVVPPRIWLSFCTLAWGVLTLSMYRVSSFNQCCAIRFFQALFESCTFSGTHLILG 165

Query: 191 MFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLK------PWKLIFLVIGLI 244
            +Y + E   R   F S    + +VGSL +  +  S  SSL        W+ +F++  LI
Sbjct: 166 SWYREDELSVRSAIFTS----SGLVGSLFSGFMQVSIHSSLDGRRGLAGWRWLFIIDFLI 221

Query: 245 NFVWAFVFLYMAPDSP 260
               A       PD+P
Sbjct: 222 TLPIAVYGFVCFPDTP 237

>YAL067C (SEO1) [2] chr1 complement(7236..9017) Member of the
           allantoate permease family of the major facilitator
           superfamily (MFS) [1782 bp, 593 aa]
          Length = 593

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 102/483 (21%), Positives = 190/483 (39%), Gaps = 43/483 (8%)

Query: 32  YDKGQLEVAGKHMVGAELFQELLEGESETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDK 91
           +D+ +  +  K     + +    +G   TS KE   +  K+D  L    C+ Y +++LD 
Sbjct: 99  FDEQEYRINEKERSHNKWYSWFKQG---TSFKE-KKLLIKLDVLLAFYSCIAYWVKYLDT 154

Query: 92  XXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVW 151
                       +DL F+GND  +   ++ VG ++  +P    + KLP+        + W
Sbjct: 155 VNINNAYVSGMKEDLGFQGNDLVHTQVMYTVGNIIFQLPFLIYLNKLPLNYVLPSLDLCW 214

Query: 152 AVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGV 211
           ++L V      +   + A+RF +G  EA    +   +   FY K ++  R   F  +   
Sbjct: 215 SLLTVGAAYVNSVPHLKAIRFFIGAFEAPSYLAYQYLFGSFY-KHDEMVRRSAFYYL--- 270

Query: 212 ATMVGSLLAYGLGHSTSSS------LKPWKLIFLVIGLINFVWAFVFLYMAPDSPAN--A 263
              +G L A G+  +  SS      L+ W+  F++  +++ V   +  Y  P  P N  +
Sbjct: 271 GQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYSLPGDPYNCYS 330

Query: 264 RFLTHEEKLKVVERVSKNQMGIKDTKLKP---KQALEALKDLNVXXXXXXXXXXXXXXXX 320
            FLT +E     +R+ +NQ G  D + K    K       D  +                
Sbjct: 331 IFLTDDEIRLARKRLKENQTGKSDFETKVFDIKLWKTIFSDWKIYILTLWNIFCWNDSNV 390

Query: 321 TSN----FISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKKNIRVILLFVL 376
           +S     ++ SL K +    LN   L + T  + +V +   G++A   K + R    F +
Sbjct: 391 SSGAYLLWLKSL-KRYSIPKLNQ--LSMITPGLGMVYLMLTGIIA--DKLHSR---WFAI 442

Query: 377 CIPTLAGLLGIHLIPLEHKWALV-GCCWLLYIIG------GPVIMCWVLLNVTVAGSSKI 429
               +  ++G  ++     W +  G  W  +++        PV+  W          ++ 
Sbjct: 443 IFTQVFNIIGNSILA---AWDVAEGAKWFAFMLQCFGWAMAPVLYSWQNDICRRDAQTRA 499

Query: 430 STSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMFYRNK 489
            T   M  +  ++   I   ++  +EAPRY+ G      S  C+     +   L FY+  
Sbjct: 500 ITLVTMNIMAQSSTAWISVLVWKTEEAPRYLKGFTFTACSAFCLSIWTFV--VLYFYKRD 557

Query: 490 TRD 492
            R+
Sbjct: 558 ERN 560

>AGL026W [4285] [Homologous to ScYGR260W - NSH]
           complement(664335..665975) [1641 bp, 546 aa]
          Length = 545

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 125/307 (40%), Gaps = 10/307 (3%)

Query: 58  SETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIA 117
           +E  +K  +  R ++D  +L +LC  Y+   LD+            +DL      Y    
Sbjct: 80  TEELEKLASKTRLRMDFRILIMLCWIYICNQLDRTNIASARLGGLEEDLKLTSLQYQTAV 139

Query: 118 AIFNVGYLVGSIPANWVIQKLPVAK-YTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGL 176
           +I  VGY +  +P+N V+ +L   + +    + +W  +      A +   +  LR L+G+
Sbjct: 140 SILFVGYTIFQVPSNIVLNRLGKPRLFISVLMTLWGGISACCAAAHSFASLAVLRVLIGV 199

Query: 177 MEASISPSNMMMCAMFYNKQEQPFRMCT-FLSMNGVATMVGSLLAYGLGHSTSSSLKPWK 235
           +E+      +   + +Y K+E  FR    F        +     A   G      L+PW+
Sbjct: 200 VESGFFVCCLYYLSCWYTKKELTFRNAILFSGSLLSGALSLLASAIIRGMEGVGGLQPWR 259

Query: 236 LIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQ- 294
             FL+ GL+  V       + PD+P+N RFL+  EK  V+ ++  +     D +    + 
Sbjct: 260 WCFLLEGLLTVVTVPFSYIVLPDNPSNTRFLSQMEKDIVIWKLKMDVGEYDDDEAVLHEH 319

Query: 295 -----ALE-ALKDLNVXXXXXXXXXXXXXXXXTSNFISSLIKGFGFSGLNATLLQLPTGA 348
                AL+ A++D  V                  NF  S+++   +S     LL  P   
Sbjct: 320 NNYRFALKLAVRDPKV-WLIAGTVSCLVASSGVQNFYPSVVETLNYSRTKTLLLTAPPFF 378

Query: 349 IELVCVF 355
           I ++C +
Sbjct: 379 IAMICTW 385

>Kwal_33.13713
          Length = 500

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 93/215 (43%), Gaps = 8/215 (3%)

Query: 71  KIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIP 130
           KID ++L  +C+ Y + ++D+            +DL  KG+ ++ I   F VGY++G IP
Sbjct: 51  KIDLFVLSFVCLQYWINYVDRVGFSNAYVSGMKEDLGLKGDQFNLINTCFTVGYVLGMIP 110

Query: 131 ANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCA 190
            N ++  +    +     + W +L  +     + +   A+RF   + E+       ++  
Sbjct: 111 NNLILLVVQPRIWLSFCTLAWGLLTFSMYKVTSFQQCCAIRFFQAVFESCTFSGTHLILG 170

Query: 191 MFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSS--SLKPWKLIFLVIGLINF-- 246
            +Y ++E   R   F S   V ++    +   +  S      L  W+ +F+V  LI    
Sbjct: 171 SWYKERELTIRTAIFTSSGLVGSIFSGFMQVAIHKSLDGHRGLAGWRWLFIVDFLITLPV 230

Query: 247 -VWAFVFLYMAPDSPANARF---LTHEEKLKVVER 277
            V+ F+F    PD     R    L  E++L+  +R
Sbjct: 231 AVYGFIFFPTTPDHINRKRHGPSLFSEQELQFAKR 265

>YCR028C (FEN2) [562] chr3 complement(170881..172419) High affinity
           H[+]/pantothenate symporter, member of the allantoate
           permease family of the major facilitator superfamily
           (MFS) [1539 bp, 512 aa]
          Length = 512

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 102/238 (42%), Gaps = 15/238 (6%)

Query: 55  EGESETSDKEYAPIRR----KIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKG 110
           E E E+   + A  +R    KID ++L  +C+ Y + ++D+            +DL   G
Sbjct: 12  EVERESVSSKRAIKKRLLLFKIDLFVLSFVCLQYWINYVDRVGFTNAYISGMKEDLKMVG 71

Query: 111 NDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMAL 170
           ND +    +F +GY+VG +P N ++  +P   +       W +L +      + + + A+
Sbjct: 72  NDLTVSNTVFMIGYIVGMVPNNLMLLCVPPRIWLSFCTFAWGLLTLGMYKVTSFKHICAI 131

Query: 171 RFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGL-GH-STS 228
           RF   L E+        +   +Y + E P R   F     V +M    +   +  H +  
Sbjct: 132 RFFQALFESCTFSGTHFVLGSWYKEDELPIRSAIFTGSGLVGSMFSGFMQTSIFTHLNGR 191

Query: 229 SSLKPWKLIFLV---IGLINFVWAFVFLYMAPDSPAN------ARFLTHEEKLKVVER 277
           + L  W+ +F++   I L   ++ F+F    PD  +        R++ +E++L    R
Sbjct: 192 NGLAGWRWLFIIDFCITLPIAIYGFIFFPGLPDQTSAVSKFSMTRYIFNEQELHYARR 249

>KLLA0B07953g 703782..705578 similar to sp|P53241 Saccharomyces
           cerevisiae YGR065c VHT1 plasma membrane H+-biotin
           symporter, start by similarity
          Length = 598

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 95/206 (46%), Gaps = 7/206 (3%)

Query: 104 KDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKN 163
           +DLN KGNDY N + I NVG +V  +P  +V+ + P         + W     A   A N
Sbjct: 154 EDLNMKGNDYINTSVISNVGAIVFQLPFMYVLPRFPAHIILPIMDMGWTWFTFACFRANN 213

Query: 164 TRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGL 223
              + A RFLL    A+  P +  +   +Y   E   R+C F     +  +   LL   +
Sbjct: 214 LASLRAYRFLLSAFGAAYYPVSQYVLGSWYAPDEISSRVCLFFFGQLLGGVTSGLLQARI 273

Query: 224 GHSTSSSL--KPWKLIFLVIGL-INFVWAFVFLYMAPDSPAN--ARFLTHEEKLKVVERV 278
             S +  L    W+ +FL+  + I+   AF+  ++ P  P+   + FLT EE +    R 
Sbjct: 274 FKSLNGVLGHAGWRWMFLIDSMAISLPTAFIGFFVIPGIPSKCYSLFLTDEEIVIARRRN 333

Query: 279 SKNQM--GIKDTKLKPKQALEALKDL 302
            +NQ+  G++ ++L    +L+  K +
Sbjct: 334 LRNQIKDGVQKSQLPSLLSLKLWKKV 359

>Scas_689.11
          Length = 508

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/218 (20%), Positives = 93/218 (42%), Gaps = 11/218 (5%)

Query: 71  KIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIP 130
           KID ++L  +C+ Y + ++D+            +DLN K +D +     F VGY+VG +P
Sbjct: 36  KIDVFVLSFVCLQYWINYVDRVGFNNAYVSGMKEDLNMKKDDLNVTLTCFTVGYVVGMLP 95

Query: 131 ANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCA 190
            N ++  +P   +       W +L +      +     A+RF   L E+       ++  
Sbjct: 96  NNLILLVVPPRLWLSFCTFSWGLLTLGMFKITSFEQACAIRFFQALFESCTFSGTHLILG 155

Query: 191 MFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTS--SSLKPWKLIFLVIGLINF-- 246
            +Y + E P R   F S   + ++    +   +        +L+ W+ +F++   I    
Sbjct: 156 SWYKEDELPLRSAIFTSSGLIGSIFSGFMQVAIHTRLDGVGNLEGWRWLFIIDFCITIPI 215

Query: 247 -VWAFVFLYMAPDSPANA------RFLTHEEKLKVVER 277
            ++  +F    PD  +++      R++  E++L+   R
Sbjct: 216 SIYGLIFFPGVPDHTSSSSKFSMTRYIFTEQELQYARR 253

>Kwal_56.24353
          Length = 582

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 107/497 (21%), Positives = 189/497 (38%), Gaps = 57/497 (11%)

Query: 51  QELLEGESETSDKEY--------APIRRKI----DRWLLPVLCVTYMLQFLDKXXXXXXX 98
           QE    E + SD+++        +P  +K+    D  L    C+ Y +++LD        
Sbjct: 99  QEYRMNEKQASDRKWYQWFGSDVSPQEKKLLVKLDILLAFYSCLAYWVKYLDTANLNNAY 158

Query: 99  XXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAH 158
                ++LNFKGN       ++ +G +V  +P  + + K+P+        I W++L +  
Sbjct: 159 VSGLKEELNFKGNQLVETQVMYTIGNIVFQLPFIFFLDKVPLNFVLPALDICWSILTIGA 218

Query: 159 IGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSL 218
                   +  +RF +G+ EA    +   +   FY K ++  R   F  +   A   G L
Sbjct: 219 AKVDTVPHLKVIRFFIGVFEAPAYLAYQYLFGSFY-KHDEMVRRSAFYYLGQYA---GIL 274

Query: 219 LAYGLGHSTSS------SLKPWKLIFLVIGLINFVWAFVFLYMAPDSPAN--ARFLTHEE 270
            A GL  +  +       L  W+  F++ G+I+ V   +  Y+ P  P N  + FLT +E
Sbjct: 275 SASGLQSAIYAVLDGKRGLSGWRWNFIIDGVISVVVGIIGFYVLPGDPYNCYSIFLTDDE 334

Query: 271 KLKVVERVSKNQMGIKDTKLK---PKQALEALKDLNVXXXXXXXXXXXXXXXXTSNFISS 327
                +R+ +N     D   K    K  +  L +  +                TS     
Sbjct: 335 IRLARKRLRENNTEKPDFASKVFDKKVWIRILTNWKIYVLTLWNIFCWNNNNGTSGAYLL 394

Query: 328 LIKGFG-FSGLNATLLQLPTGAIELVCVFAAGVLALFTKKNIRVILLFVLCIPTLAG--L 384
            +K    +S  +   L + T A+ +V +F   + A   K + R   + V  +    G  +
Sbjct: 395 WLKSLKRYSIPHVNRLGMVTPALGMVYLFLTSLFA--DKLHSRWGAIIVTQVFNFIGNVI 452

Query: 385 LGIHLIPLEHKWALVGCCWLLYIIG---GPVIMCWVLLNVTVAGSSKISTSKIMWFLMYT 441
           L    +P   KW      ++L   G    PV+  W         S++  T  IM  L  T
Sbjct: 453 LAAWNVPEGAKW----FAFMLQYFGWAMAPVLYSWQNDICRRDASARAITLVIMNMLAQT 508

Query: 442 AGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMFYRNKTRDRKYGKPT-- 499
               +   ++   EAPR++ G     +  A   F    +  L+ +  K  +R++ K    
Sbjct: 509 TTAFMSVLVWKTTEAPRFLKGY----TWTAVAAFSLSAWTMLVLWLYKREERQHAKENGI 564

Query: 500 ------------PEEEK 504
                       PEE+K
Sbjct: 565 ILYNSKTGENYPPEEQK 581

>Scas_630.25
          Length = 582

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 94/212 (44%), Gaps = 12/212 (5%)

Query: 81  CVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPV 140
           C+ Y +++LD             ++LNFKGND  +   ++ VG ++  +P  + + K+P+
Sbjct: 140 CIAYWVKYLDTVNLNNAYVSGMKEELNFKGNDLVHTQVMYTVGNIIFQLPFLFYLNKIPL 199

Query: 141 AKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPF 200
                   + W++L +      +   + A+RF +G  EA    +   +   FY K ++  
Sbjct: 200 NYLLPGLDMAWSLLTIGAAYVNSVPHLKAIRFFIGGFEAPSYLAYQYLFGCFY-KHDEMV 258

Query: 201 RMCTFLSMNGVATMVGSLLAYGLGHSTSSSLK------PWKLIFLVIGLINFVWAFVFLY 254
           R   F  +      VG L + G+  +  S+L        W+  F++  +I+     +  Y
Sbjct: 259 RRSAFYYL---GQYVGILSSGGIQSAVYSNLDGRNGLSGWRWSFIIDAIISVFVGILGFY 315

Query: 255 MAPDSPANAR--FLTHEEKLKVVERVSKNQMG 284
           + P  P N    FLT +E     +R+SKNQ  
Sbjct: 316 VLPGDPDNCYSIFLTDDEIRLARKRISKNQTA 347

>YGR065C (VHT1) [2027] chr7 complement(618079..619860) H+/biotin
           symporter, member of the allantoate permease family of
           the major facilitator superfamily (MFS) [1782 bp, 593
           aa]
          Length = 593

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 89/196 (45%), Gaps = 7/196 (3%)

Query: 104 KDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKN 163
           +DLN KGNDY   + I NVG +V  +P  +++ + P         + W     A   A +
Sbjct: 157 EDLNMKGNDYVYTSTIANVGAIVFQLPFMYLLPRFPSHIILPVMDLGWTWFTFACYRANS 216

Query: 164 TRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGL 223
             ++ A RF+L    A+  P +  +   +Y   E   R+C F     + ++   LL   +
Sbjct: 217 LAELRAYRFILSAFGAAYYPVSQYILGCWYAPDEINSRVCLFFCGQQLGSVTSGLLQSRI 276

Query: 224 GHSTS--SSLKPWKLIFLVIGL-INFVWAFVFLYMAPDSPAN--ARFLTHEEKLKVVERV 278
             S +    L  W+ +FL+  + I+   A +  ++ P  P+   + FLT EE      R 
Sbjct: 277 FKSLNGVHGLAGWRWMFLIDAIAISLPTAIIGFFVIPGVPSKCYSLFLTDEEIRIARARN 336

Query: 279 SKNQM--GIKDTKLKP 292
            +NQ+  G+  +KL P
Sbjct: 337 KRNQIKDGVDKSKLAP 352

>AFL158C [3037] [Homologous to ScYAL067C (SEO1) - NSH]
           (137788..139482) [1695 bp, 564 aa]
          Length = 564

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 106/234 (45%), Gaps = 14/234 (5%)

Query: 71  KIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIP 130
           K+D  L    C+ Y +++LD             ++L   GND  N  A+F VG ++  +P
Sbjct: 117 KLDVLLAFYSCLAYWVKYLDTVNLNNAYVSGMKEELGMSGNDLVNTQAMFTVGAVIFQLP 176

Query: 131 ANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCA 190
             +++ K+P+        + W+VL +      N   + A+RFL+G+ EA    S   +  
Sbjct: 177 FIFILNKVPLNYVLPALDLGWSVLTLGAAHVNNVGQLKAIRFLIGVFEAPAYLSYQYLFG 236

Query: 191 MFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLK------PWKLIFLVIGLI 244
            FY K ++  R   F  +   A   G L + G+  + S++L        W+  F++  +I
Sbjct: 237 CFY-KHDEIVRRSAFYYLGQYA---GILSSGGIQSAVSATLDGKNGLSGWRWSFIIDAII 292

Query: 245 NFVWAFVFLYMAPDSPAN--ARFLTHEEKLKVVERVSKNQMGIKD--TKLKPKQ 294
           + +   +  YM P  P N  + FLT +E      R+ ++ +   D  +K+  KQ
Sbjct: 293 SIIVGIIGFYMLPGDPNNCYSIFLTDDEIRLARRRLEESNIDKSDFSSKIFDKQ 346

>CAGL0K04609g complement(437799..439628) highly similar to sp|P53241
           Saccharomyces cerevisiae YGR065c H+/biotin symporter,
           hypothetical start
          Length = 609

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 124/292 (42%), Gaps = 22/292 (7%)

Query: 15  QVESGEILEIKGSASPS----YDKGQLEVAGKHMVGAELFQELLEGESETSDKEYAPIRR 70
           +++ G   E++  A+ S    +D+ +  +  ++    + ++ L       S  E    RR
Sbjct: 80  KLQKGIPYELRDEANKSRWKFFDEYEYRLNKEYRKSRKWYEFLYPNHISQSKAE----RR 135

Query: 71  KIDRWLLPVLCVTYML-----QFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYL 125
            + +  L ++   Y L     + +D             +DL+FKGNDY   + I NVG +
Sbjct: 136 LLYK--LDIIVALYFLIVNWSRSVDSSNYTNAYVSHMKEDLHFKGNDYIYTSTIANVGSI 193

Query: 126 VGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSN 185
           V  +P  +++ + P           W+    A   AK+  ++ A RF+L    A+  P  
Sbjct: 194 VFQLPFIYILPRFPAHYVLPIMDFGWSWFTFACYRAKSLPELRAYRFILSSFGAAYYPVA 253

Query: 186 MMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTS--SSLKPWKLIFLVIGL 243
             +   +Y   E   R+C F     + ++   LL   +  S +    L  W+ +FL+  +
Sbjct: 254 QYLMGCWYAPDEISSRVCLFFCGQLLGSVTSGLLQARIFKSLNGVHGLAGWRWMFLIDAI 313

Query: 244 -INFVWAFVFLYMAPDSPAN--ARFLTHEEKLKVVERVSKNQM--GIKDTKL 290
            I+   A +  ++ P  P+   + FLT EE      R  +NQ+  G+  +KL
Sbjct: 314 AISIPTAILGFFVIPGIPSKCYSLFLTDEEIRIARARNKRNQIVDGVDRSKL 365

>AGR235W [4546] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH]
           complement(1187805..1189493) [1689 bp, 562 aa]
          Length = 562

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 110/543 (20%), Positives = 199/543 (36%), Gaps = 55/543 (10%)

Query: 1   MSLHSKKQ--DTKEPFQVESG----------EILEIKGSASPS--------YDKGQLEVA 40
           MS  SK++  + KEP   +            +  E+   + P+        YDK Q E  
Sbjct: 18  MSFDSKREVENEKEPVSTKEATEPCSDLDAIKSHEVHAFSDPAIAEYYRREYDKVQYECR 77

Query: 41  GKHMVGAELFQELLEGESETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXX 100
                  + F   L    E    E   + RK+D  ++ ++ + Y    LD          
Sbjct: 78  -------QFFDPTLTWTKE----EERQVLRKLDIHIVGLIVIVYFACQLDYGSLGQATAD 126

Query: 101 XXXKDLNFKGNDYS--NIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAH 158
               +L+   N Y+  N  +IF    L   +P   VI++    K     +++W  +++  
Sbjct: 127 NMLNELHMDANQYNLGNQLSIFVA--LAFELPMQLVIRRYGADKAIPYQMLIWGAIVLCQ 184

Query: 159 IGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSL 218
            G KN     A R L G+  A +  +  +    FY   E  FR     + + +  +  +L
Sbjct: 185 AGMKNCYGFYATRVLSGIAAAGLLTTVTVWLTYFYTSGELAFRTAFLFATSTMDQVFSAL 244

Query: 219 LAYG-LGHSTSSSLKPWKLIFLVIGLINFVWAFVFLYMAPDSPANAR-------FLTHEE 270
           +AYG L      +L  W+ +F+V G+I F       +    S A  +       +L+  +
Sbjct: 245 IAYGVLRLRGVCNLSGWQWLFIVEGIITFSAGLYVCFTMVPSIAQTKGVMYPKGWLSERQ 304

Query: 271 KLKVVERV-----SKNQMGIKDTKLKPKQALEALKDLNVXXXXXXXXXXXXXXXXTSNFI 325
           +L  V R+     SK  M  +   +  ++ L +L D +                    ++
Sbjct: 305 QLIAVNRLLRDDPSKGTMNNRQ-GITIREFLRSLSDYDFWPLYAISLIVSIPEAAVVPYL 363

Query: 326 SSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLA-LFTKKNIRVILLFVLCIPTLAGL 384
              ++  GFS L   +L +P   I  + +     L+ ++ ++ +  I   +    TL G 
Sbjct: 364 PLNLRSLGFSSLKVQILIIPAFFIHAISMLIFTKLSDVWDERALMEIFPLIWKGITL-GC 422

Query: 385 LGIHLIPLEHKWALVGCCWLLYIIG--GPVIMCWVLLNVTVAGSSKISTSKIMWFLMYTA 442
           L         KW        L  +    P+   W   N     +  ++ +   +F     
Sbjct: 423 LRWWSGSFVDKWGTYALLITLRAVPSYSPIYTGWSSKNANSVRTRAVAAAAGQFF--NKI 480

Query: 443 GNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMFYRNKTRDRKYGKPTPEE 502
           G I+ ++ +   +AP Y  G   L       + L I       +RNK RD  + K T +E
Sbjct: 481 GYILANQTYRKDDAPAYHRGNLLLFCINLITIPLMIGSKLYFVWRNKRRDELWNKMTEKE 540

Query: 503 EKE 505
            + 
Sbjct: 541 RQH 543

>Kwal_26.9264
          Length = 614

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 87/195 (44%), Gaps = 9/195 (4%)

Query: 104 KDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKN 163
           KDL    NDY N  AI NVG +V  +P  + + + P         + W++  +A   A++
Sbjct: 174 KDLKMTKNDYINTTAISNVGAIVLQLPFMYFLPRFPAHYILPFMDLGWSMFTLACYRAQS 233

Query: 164 TRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLS---MNGVATMVGSLLA 220
             ++ A RF +    ++  P +  +   +Y   E   R+C F     + G+ +  G L A
Sbjct: 234 LPELRAYRFFVSAFGSAYYPVSQYVLGSWYAPDEISSRVCLFFCGQLLGGITS--GLLQA 291

Query: 221 YGLGH-STSSSLKPWKLIFLVIGL-INFVWAFVFLYMAPDSPAN--ARFLTHEEKLKVVE 276
               H +    L  W+ +FL+  + I+   A +  ++ P  P+   + FLT EE      
Sbjct: 292 STFKHLNGVRGLAGWRWMFLIDAVAISIPCAVIGFFVIPGVPSKCYSLFLTDEEIRVARA 351

Query: 277 RVSKNQMGIKDTKLK 291
           R  +NQ+  K  K K
Sbjct: 352 RNKRNQIHDKVDKEK 366

>AEL143W [2363] [Homologous to ScYCR028C (FEN2) - SH]
           complement(358539..360098) [1560 bp, 519 aa]
          Length = 519

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/227 (20%), Positives = 98/227 (43%), Gaps = 9/227 (3%)

Query: 71  KIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIP 130
           KID ++L  +C+ Y + ++D+            K+L   GN ++ I   F VGY++G +P
Sbjct: 63  KIDLFVLSFVCLQYWINYVDRVSFGNAYVSGMDKELGLHGNQFNVINTCFTVGYILGMLP 122

Query: 131 ANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCA 190
            N ++  LP   +     + W +L +A   A +     A+RF   + E+       ++  
Sbjct: 123 NNLLLLVLPPRIWLSVCTLGWGLLTLAMYRATSFEYCCAVRFFQAVFESCTFSGTHLILG 182

Query: 191 MFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGL--GHSTSSSLKPWKLIFLVIGLINF-- 246
            +Y + E   R   F +   + +M   ++   +         +  W+ +F++  L+    
Sbjct: 183 SWYKENELALRSAVFTASGLIGSMCSGMMQVAIFDAMDGRRGISGWRWLFIIDFLVTVPI 242

Query: 247 -VWAFVFLYMAPDSPANARFLTHEEKLKVVE-RVSKNQMGIKDTKLK 291
            ++ F+F    P +P + R  T        E R ++ ++  +D + +
Sbjct: 243 AIYGFIFF---PGTPDHNRADTSALVFSKAELRYARARLPARDERAR 286

>KLLA0D12716g complement(1084062..1085849) similar to sp|P39709
           Saccharomyces cerevisiae YAL067c SEO1 suppressor of
           sulfoxyde ethionine resistance, start by similarity
          Length = 595

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 6/211 (2%)

Query: 82  VTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPVA 141
           + Y +++LD             +++ FKGND  N   ++ VG ++  IP  +++ K+P+ 
Sbjct: 144 IAYWVKYLDTVNLNNAYVSGMKEEIGFKGNDLVNTQVMYTVGNIIFQIPFIFILNKVPLN 203

Query: 142 KYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFR 201
                  I W++L +          + A+RF +G  EA    +   +   FY K ++  R
Sbjct: 204 YVLPGLDICWSLLTLGAAYVDTVPHLKAIRFFIGAFEAPSYLAYQYLFGCFY-KHDEMVR 262

Query: 202 MCTFLSMNGVATMVGSLLAYGLGHSTSSSL---KPWKLIFLVIGLINFVWAFVFLYMAPD 258
              F      A ++ S       H+T + L     W+  F++  +I+     +  YM P 
Sbjct: 263 RSAFYYFGQYAGVLSSGGIISAVHATMNGLHGKSGWRWNFIIDAVISVAVGLLGFYMLPG 322

Query: 259 SPAN--ARFLTHEEKLKVVERVSKNQMGIKD 287
            P N  + FLT +E     +R+ +N     D
Sbjct: 323 DPYNCYSIFLTDDEIRLARKRLRENNTEKSD 353

>AFR578C [3770] [Homologous to ScYGR065C (VHT1) - SH]
           (1474397..1476274) [1878 bp, 625 aa]
          Length = 625

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/287 (20%), Positives = 117/287 (40%), Gaps = 19/287 (6%)

Query: 15  QVESGEILEIKGSASPSYDKGQLE----VAGKHMVGAELFQELLEGESETSDKEYAPIRR 70
           Q+E G   E++  A   + +   E    V   ++   +  Q L   +S  S  E   +  
Sbjct: 94  QLEPGRCYELRDEAGRKWWRFFFEYEYRVNKAYLTERKWHQFLYPNQSTKSPAERT-LLY 152

Query: 71  KIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIFNVGYLVGSIP 130
           K+D +L     +    + LD             +DL   GND    + I  +G +V  +P
Sbjct: 153 KLDIFLGLYFLILCWCKSLDSNNLTNTYISGMREDLGMHGNDLIYTSTISKIGAIVFQLP 212

Query: 131 ANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCA 190
             +++ + P         + W+   +    A+   ++ A RFL+    A+  P +  +  
Sbjct: 213 FVYLLPRYPSVYILPLMDLGWSFFTIMCAFARTVPELQAYRFLISAFGAAYYPVSQYVLG 272

Query: 191 MFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSL--KPWKLIFLVIGL-INFV 247
           ++Y   E   R+C F     +  +   +L   +  S ++++    W+ +FL+ GL I+  
Sbjct: 273 LWYAPDELSSRVCLFFCGQLLGGVTSGVLQARIYKSLNNAMGFAGWRWMFLIDGLAISIP 332

Query: 248 WAFVFLYMAPDSPAN--ARFLTHEE---------KLKVVERVSKNQM 283
              +  ++ P  P+   + FLT EE         +  +V+ VS NQ+
Sbjct: 333 TVILGFFVLPGIPSKCYSLFLTDEEIRIARQRNRQNHIVDNVSANQL 379

>CAGL0K04565g complement(431909..433771) similar to sp|P53241
           Saccharomyces cerevisiae YGR065c Vitamin H transporter,
           hypothetical start
          Length = 620

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 94/235 (40%), Gaps = 5/235 (2%)

Query: 41  GKHMVGAELFQELLEGESETSDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXX 100
            K    +  + E L     T  K    +  KID  +     V    + +D          
Sbjct: 124 NKEYRKSRRWYEFLYPNHATKSKAERRLLYKIDFLIGFYFLVVSWTRSVDSANYVNAYVS 183

Query: 101 XXXKDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIG 160
              +DL+  GNDY   + I  +G +V  IP  +++ ++P         + W+   +A   
Sbjct: 184 NMKEDLHMGGNDYVYTSTISTIGQIVFQIPFMYLMPRVPPHYLLPFMDLGWSAFTLACFR 243

Query: 161 AKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLA 220
           AK  ++M   RF++G   A+  P +  +   +Y   E   R+  F     + ++   LL 
Sbjct: 244 AKTLKEMQGYRFMVGSFGAAYYPVSQYIFGSWYAPDELTSRVLLFSYGQLLGSVTSGLLQ 303

Query: 221 YGLGHSTSS--SLKPWKLIFLVIGL-INFVWAFVFLYMAPDSPAN--ARFLTHEE 270
             +  S      L  W+ +FL+  + I+   A +  ++ P  P+   + FLT EE
Sbjct: 304 AKIFKSLDGVCGLAGWRWMFLIDAIAISIPTAIMGFFLIPGIPSKCYSLFLTDEE 358

>Scas_683.23
          Length = 601

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 129/321 (40%), Gaps = 28/321 (8%)

Query: 2   SLHSKKQDTKEPFQVESGEIL------EIKGSASPS----YDKGQLEVAGKHMVGAELFQ 51
            LHS   + K      S  +L      E++  A+      +D+ +  V  +++   + ++
Sbjct: 57  DLHSDDAEAKLSLSSSSVNMLQKDIPYELRDEANRKWWKYFDEFEYRVNKEYLTSRKWYE 116

Query: 52  ELLEGESETSDKEYAPIRRKIDRWLLPVLCVTYMLQF-----LDKXXXXXXXXXXXXKDL 106
            L    +  S  E    RR + +  L ++   Y L       LD             +DL
Sbjct: 117 FLYPNHTTHSKAE----RRLLYK--LDLVIGVYFLALCWSKSLDSNNFTNAYVSNMKEDL 170

Query: 107 NFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRD 166
           + +GNDY +  +I NVG +V  +P  +++ + P         + W+    A   AK   +
Sbjct: 171 HMEGNDYIHTTSIANVGAIVFQLPFMYLLPRYPAHIILPAMDMGWSWFTFACYRAKTLAE 230

Query: 167 MMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHS 226
           +   +F+L    A+  P +  +   +Y   E   R+  F     +  +   LL   +  +
Sbjct: 231 LRGYQFILNAFGAAYYPVSQYILGCWYAPDEISSRVFLFFCGQLLGGVTSGLLQARIFEN 290

Query: 227 TS--SSLKPWKLIFLVIGL-INFVWAFVFLYMAPDSPAN--ARFLTHEEKLKVVERVSKN 281
               + L  W+ +FL+  + I+   A +  ++ P  P+   + FLT EE      R  +N
Sbjct: 291 LDGVNGLAGWRWMFLINAIAISIPTAIMGFFVIPGIPSKCYSLFLTDEEIRIARARNRRN 350

Query: 282 QM--GIKDTKLKPKQALEALK 300
           Q+  G+  +KL     L+  K
Sbjct: 351 QINDGVDTSKLTSLFKLDVWK 371

>YOL162W (YOL162W) [4663] chr15 (10118..10765) Protein of unknown
           function [648 bp, 215 aa]
          Length = 215

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 93/198 (46%), Gaps = 13/198 (6%)

Query: 322 SNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKKNIRV---ILLFVLCI 378
           + +++ +++  GF+   A LL +P   + ++ +F  G+     K N R+   +L  +  +
Sbjct: 13  ATYLTLVLRSIGFTTFQANLLAIPNFVLHILLLF--GLTWSTEKCNNRLGLSLLQPLYTV 70

Query: 379 PTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVI--MCWVLLNVTVAGSSKISTSKIMW 436
           P LA +L      + +KW       L  I+  P I  +C  L +         + S  ++
Sbjct: 71  PLLA-VLRFWKGTMFNKWGTYAIITL--ILDNPYIHAICVSLCSRNSQSVKTRTVSTCLY 127

Query: 437 FLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMF-YRNKTRDRKY 495
            +   AG II S I+   +AP Y  G  G++   A  MF  ++   L++ Y NK RD+++
Sbjct: 128 NMFVQAGLIISSNIYAKSDAPLYRKG-NGVLFGLALFMFPILIGSKLIYVYINKQRDKRW 186

Query: 496 GKPTPEEEKEGVINGFKD 513
              + EEEK+  ++   D
Sbjct: 187 NAMS-EEEKDHYLSTTSD 203

>Scas_21.1
          Length = 140

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 407 IIGGPVIMCWVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITG-MKG 465
           + G P I+ +   + + +G SK  T   M    +   NII  +++ AK+ PRYI   +  
Sbjct: 13  VFGVPWILMFSWNSTSCSGYSKKLTRNAMVLFWFGIANIISPQLWQAKDGPRYIPAWIVQ 72

Query: 466 LISSYACMMFLCILYYALMFYRNKTRDRKYGKPTP---------EEEKEGVINGFKDYTD 516
           ++ S+     L ++ + ++  RN++R     + T          E+ K  V     D TD
Sbjct: 73  IVLSFFIAPLLALVIWFILSRRNRSRISNLDEDTKVIGFIDRGGEKIKANV--ALLDLTD 130

Query: 517 FEN 519
            EN
Sbjct: 131 LEN 133

>Sklu_2043.2 , Contig c2043 4428-5156 reverse complement
          Length = 242

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 48/115 (41%), Gaps = 4/115 (3%)

Query: 104 KDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKN 163
           +DL   GN+ +   + F  G+++G IP   +  KLP+  Y      +  +  +      N
Sbjct: 111 EDLRMFGNELTYQNSCFMAGFIIGQIPLTMLAMKLPIYWYLPIMDSIRELFTLFIYKIDN 170

Query: 164 TRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSL 218
              + ALRF  GL  +   P    +   +  K E   R   +     VA+ VGS+
Sbjct: 171 YHQLCALRFCAGLFGSFFFPKVQFVIGRWCKKTEINLRSAMYF----VASQVGSI 221

>YOL163W (YOL163W) [4662] chr15 (9596..10105) Protein of unknown
           function [510 bp, 169 aa]
          Length = 169

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 30/161 (18%), Positives = 63/161 (39%), Gaps = 10/161 (6%)

Query: 148 LIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLS 207
           +I W+++                R L+GL E       ++  + FY+  E   R+  F  
Sbjct: 1   MIAWSLVATLQCKMTGKSSFYTCRALMGLFEGGFVADLVLWMSYFYSSSELSIRLSFFWV 60

Query: 208 MNGVATMVGSLLAYGLGHSTS-SSLKPWKLIFLVIGLINFVWAF-VFLYMAPDSPANAR- 264
              +  ++ S++A+G+ H      +  W+ +FL+  +   V     +  M P      + 
Sbjct: 61  TLSLTQIITSIVAFGVFHMRGIGGMAGWQWLFLIERIFTLVIGISAYFLMVPSVVQTKKP 120

Query: 265 ------FLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEAL 299
                 F   EEK+ +V ++ ++     D   +   +L+ L
Sbjct: 121 WSKKGWFTEREEKI-IVNKILRDDPTKGDMNNRQGMSLKML 160

>KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromyces
           lactis YGL104C, start by similarity
          Length = 528

 Score = 36.2 bits (82), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 87/186 (46%), Gaps = 17/186 (9%)

Query: 116 IAAIFNVGYLVGSIPANWVIQ---KLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRF 172
           I ++F+VG L+GS+ A  +     + P++ +     I+ AV L +   + N   M+  R 
Sbjct: 97  ITSVFSVGGLIGSLVAGPLADSYGRKPISYWNCSVGILGAVCLFS---SNNYLGMLFGRL 153

Query: 173 LLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLK 232
           L G+   S+    +++  +F N+        +  SMN V+   G L+   L    ++ L+
Sbjct: 154 LAGISCGSL----IVVTPLFINEMSPVHLKGSLGSMNQVSINCGILVTQSLAMLWANMLQ 209

Query: 233 PWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKP 292
            W+ I L  GLI+ +  F  L+   +SP   R+L  +  +   E V     G  +++ + 
Sbjct: 210 -WRWILLFGGLISLL-NFGLLFRINESP---RWLVSKGNMTDAEDVLSQLRG--NSRQES 262

Query: 293 KQALEA 298
           +Q ++ 
Sbjct: 263 RQEIDG 268

>CAGL0I07447g 716104..717816 highly similar to sp|P30606
           Saccharomyces cerevisiae YOL103w ITR2 myo-inositol
           permease, minor, hypothetical start
          Length = 570

 Score = 35.8 bits (81), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 87/204 (42%), Gaps = 19/204 (9%)

Query: 104 KDLNFKGNDYSNIAAIFNVGYLVGSIPANWVIQ---KLPVAKYTGCALIVWAVLLVAHIG 160
           K+L +   + +  A   ++G L+ ++ A + +    + P   ++    ++ A+L V    
Sbjct: 108 KELTYGEKEITTAAT--SLGALIFALVAGFSVDIFGRKPCLMFSNIMFLIGAILQVT--- 162

Query: 161 AKNTRDMMALRFLLGLMEASISPSNMMMCAMFYNKQEQPFRMCTFLS-MNGVATMVGSLL 219
           A     M A RF++G      S     + A  Y  +  P  +   L+ +N +    G L+
Sbjct: 163 AHKFWQMTAGRFIMGFGVGIGS-----LIAPLYISEIAPKMIRGRLTVINSLWLTGGQLI 217

Query: 220 AYGLGHSTSSSLKPWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVS 279
           AYG G   +     W+ I + + LI  V  FVF    PD+P         EK K V + S
Sbjct: 218 AYGCGAGLNHVHNGWR-ILVGLSLIPTVLQFVFFIFLPDTPRYYVMKGDYEKAKSVLKRS 276

Query: 280 KNQMGIKDTKLKPKQALEALKDLN 303
            N  G+ D  +  K  +E L  LN
Sbjct: 277 YN--GVSDELIDRK--IEELLALN 296

>Sklu_2358.2 YIL166C, Contig c2358 1699-2198
          Length = 167

 Score = 34.3 bits (77), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 36/78 (46%)

Query: 61  SDKEYAPIRRKIDRWLLPVLCVTYMLQFLDKXXXXXXXXXXXXKDLNFKGNDYSNIAAIF 120
           +++E   + RK+D  L    C  ++   +D+             DLN   NDY+    IF
Sbjct: 77  TEEEGKNLIRKLDWRLALTDCFMFVALQVDRGNLSQAVADNLLDDLNMTTNDYNVGNQIF 136

Query: 121 NVGYLVGSIPANWVIQKL 138
            V +LV  +P+  + +KL
Sbjct: 137 FVCFLVAEVPSQLISKKL 154

>Sklu_2244.6 YOL162W, Contig c2244 14189-14881 reverse complement
          Length = 230

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 77/192 (40%), Gaps = 17/192 (8%)

Query: 330 KGFGFSGLNATLLQLPTGAIELVCVFAAGVLALFTKKNIRVILLFVLCIPTLAGLLG--I 387
           K  GFS  N  LL +P      V      ++  +  + +    L  L  P  + +L   I
Sbjct: 36  KQLGFSTFNVQLLTIPYN----VLHIILLLIITWVTERVGDRSLVSLAAPVYSTILMGFI 91

Query: 388 HLIP--LEHKWALVGCCWLLYIIGGPVI----MCWVLLNVTVAGSSKISTSKIMWFLMYT 441
              P  L   W     C L   +G P I    + WV  N     S  +S++  ++ +   
Sbjct: 92  RCWPGSLVQPWPTYVLCTLF--LGTPYIHAICVSWVSRNSNSIKSRAVSSA--LYNMFVQ 147

Query: 442 AGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYYALMFYRNKTRDRKYGKPTPE 501
            G+I  ++I+ A + P Y  G          ++ L +L      +RNK R RK+  P  E
Sbjct: 148 LGSIAANQIYRADDKPFYHRGNVQSFWISFYLILLLLLVKVYYVWRNKVRARKW-DPMTE 206

Query: 502 EEKEGVINGFKD 513
           +EKE  I   +D
Sbjct: 207 DEKETYILTTQD 218

>YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permease
           (minor), closely related to Itr1p, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1830 bp, 609 aa]
          Length = 609

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 85/209 (40%), Gaps = 24/209 (11%)

Query: 104 KDLNFKGNDYSN---IAAIFNVGYLVGSIPANW---VIQKLPVAKYTGCALIVWAVLLVA 157
           +DL+ K   Y     I A  ++G L+ S+ A     V  + P   ++    ++ A+L   
Sbjct: 139 RDLDNKVLTYGEKELITAATSLGALITSVGAGTAADVFGRRPCLMFSNLMFLIGAIL--- 195

Query: 158 HIGAKNTRDMMALRFLLGL---MEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATM 214
            I A     M A R ++G    + + ISP       +F ++            +N +   
Sbjct: 196 QITAHKFWQMAAGRLIMGFGVGIGSLISP-------LFISEIAPKMIRGRLTVINSLWLT 248

Query: 215 VGSLLAYGLGHSTSSSLKPWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKV 274
            G L+AYG G   +     W+ I + + LI  V  F F    PD+P   R+   +  LK 
Sbjct: 249 GGQLIAYGCGAGLNHVKNGWR-ILVGLSLIPTVLQFSFFCFLPDTP---RYYVMKGDLKR 304

Query: 275 VERVSKNQMGIKDTKLKPKQALEALKDLN 303
            + V K      + ++   Q +E L  LN
Sbjct: 305 AKMVLKRSYVNTEDEI-IDQKVEELSSLN 332

>AFL207C [2988] [Homologous to ScAFL207C] (44349..45968) [1620 bp,
           539 aa]
          Length = 539

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/178 (19%), Positives = 78/178 (43%), Gaps = 8/178 (4%)

Query: 116 IAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLG 175
           I AIFN+G  VG I    ++ +L         L++ +++ V  I  + + +    ++ +G
Sbjct: 97  IVAIFNIGCAVGGI----ILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKWYQYCIG 152

Query: 176 LMEASISPSNMMMCAMFYNKQEQPFRM-CTFLSMNGVATMVGSLLAYGLGHSTSSSLKPW 234
            + + +    + + +     +  P  +  T +S   +    G LL Y   + T S     
Sbjct: 153 RVISGLGVGGIAVLSPMLISETSPKHLRGTLVSCYQLMITAGILLGYCANYGTKSRYDDS 212

Query: 235 KLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVER--VSKNQMGIKDTKL 290
           +   + +GL  F+WA   +      P + R+L  ++K++  +R   + N++ + D  +
Sbjct: 213 RQWRIPLGLC-FLWAIFMITGMAFVPESPRYLIEKDKIEEAKRSLATSNKVPVDDPAI 269

>Scas_581.6
          Length = 587

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 68/174 (39%), Gaps = 17/174 (9%)

Query: 112 DYSNIAAIFNVGYLVGSI---PANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMM 168
           D   I A  ++G L+ SI    A  +  + P   ++    ++ A+L    I A     M 
Sbjct: 128 DKEIITAATSLGALISSIFAGTAADIFGRKPCLMFSNVLFVIGAIL---QITAHRFWQMN 184

Query: 169 ALRFLLGL---MEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGH 225
           A R ++G    + + ISP       +F ++            +N +    G L+AYG G 
Sbjct: 185 AGRLIMGFGVGIGSLISP-------LFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGA 237

Query: 226 STSSSLKPWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVS 279
             +     W+ I + + LI  V  F F    PD+P         E  K V R S
Sbjct: 238 GLNHVHNGWR-ILVGLSLIPTVLQFSFFLFLPDTPRYYVMKGDYENAKAVLRRS 290

>CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces
           cerevisiae YDR387c, hypothetical start
          Length = 547

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 122 VGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASI 181
           VG L+GS  A+   +++ +A +  C L + A L +A   A N   ++  RF++G     I
Sbjct: 106 VGSLLGSPLADKYGRRITLAIF--CVLFIVAALWMAL--ASNLVLLVFGRFVVG-----I 156

Query: 182 SPSNMMMCAMFYNKQEQPFRM-CTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLV 240
           +      C   Y  +  P ++    L++N +A   G  L+Y   +        W+++F  
Sbjct: 157 AVGTAAQCTPVYLCEISPAKIRGQILALNSIAVTGGQFLSYIFAYELYDVNGSWRILF-- 214

Query: 241 IGLINFVWAFVFLYMAPDSPANARFLTHEEK 271
            GL + V A +FL M    P + R+L    K
Sbjct: 215 -GL-SAVPAIIFLSMLDFIPESPRWLVSMSK 243

>Scas_637.9
          Length = 607

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 7/89 (7%)

Query: 216 GSLLAYGLGHSTSSSLKPWKLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVV 275
           G L+AYG G   +     W+ I + + LI  V  F F    PD+P   R+   + +    
Sbjct: 251 GQLIAYGCGAGLNHVNNGWR-ILVGLSLIPTVLQFSFFLFLPDTP---RYYVMKGRYDDA 306

Query: 276 ERV-SKNQMGIKDTKLKPKQALEALKDLN 303
           + V  ++  G  D  ++ K  +E L++LN
Sbjct: 307 KSVLHRSYKGASDDIIERK--VEELRELN 333

>Kwal_56.22951
          Length = 596

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 3/83 (3%)

Query: 193 YNKQEQPFRMC---TFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVIGLINFVWA 249
           Y    QP+        L M  +   +G+ L  GLG S +S      + FL++GL+ F   
Sbjct: 73  YELANQPYEKSLSQRHLMMISIGGTLGTGLFIGLGFSLASGPGSLLIGFLIVGLMMFCVV 132

Query: 250 FVFLYMAPDSPANARFLTHEEKL 272
                MA   P +  F TH  + 
Sbjct: 133 QSAAEMACQYPVSGSFSTHVSRF 155

>Scas_685.5
          Length = 560

 Score = 29.3 bits (64), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 75/179 (41%), Gaps = 9/179 (5%)

Query: 116 IAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNT-RDMMALRFLL 174
           I +IFN+G  +G +  N +  ++   K     +I++ V +V  + + N        R + 
Sbjct: 105 IVSIFNLGGCIGCLTLNNLAGRVGRKKALVIVVIIYMVGIVIEMASINKWYQYFIGRIIS 164

Query: 175 GLMEASISPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPW 234
           G+   +IS  + M+ +    K  +      +  M      +G    YG  H  +SS   W
Sbjct: 165 GMGVGAISIFSPMLLSEVSPKHLRGTLGSVYQLMVTFGIFLGDCTNYGTRHKHNSS--QW 222

Query: 235 KLIFLVIGLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERV--SKNQMGIKDTKLK 291
           +     +GL +F WA   +      P + R+L    K++  +R   + N++   D  ++
Sbjct: 223 R---APLGL-SFAWALFMIAGMSFVPESPRYLLEIGKVEEAKRSVGTSNKLSADDPAVQ 277

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.139    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,462,579
Number of extensions: 610195
Number of successful extensions: 2158
Number of sequences better than 10.0: 86
Number of HSP's gapped: 2094
Number of HSP's successfully gapped: 86
Length of query: 519
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 413
Effective length of database: 12,926,601
Effective search space: 5338686213
Effective search space used: 5338686213
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 64 (29.3 bits)