Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.31601100106854800.0
AGL097C1096106239810.0
KLLA0F20658g1082106738910.0
KLLA0E14630g1082106638850.0
CAGL0K12034g1087106637310.0
YDR039C (ENA2)1091107136510.0
YDR038C (ENA5)1091107136450.0
YDR040C (ENA1)1091107136420.0
Scas_569.0d46837715930.0
CAGL0I04312g95110429821e-116
CAGL0J01870g94610169331e-109
YGL167C (PMR1)9509219181e-107
AEL301W95710428901e-103
Scas_707.48*7418118701e-102
Kwal_14.14989399158561e-98
CAGL0A00517g11229876213e-66
Kwal_47.1754712409695904e-62
AFL011W12429515574e-58
KLLA0A08910g12809625541e-57
KLLA0A03157g9383865303e-55
YGL006W (PMC1)11733864542e-45
Scas_297.18002463314e-31
KLLA0A09031g8993623137e-29
YPL036W (PMA2)9473733002e-27
Kwal_47.175228993632993e-27
CAGL0A00495g9023722984e-27
YGL008C (PMA1)9183602913e-26
Scas_710.419043622815e-25
AGL085C9093612744e-24
Scas_688.19133122663e-23
CAGL0M11308g14527712593e-22
YIL048W (NEO1)11518442388e-20
Scas_665.3014397832333e-19
Kwal_26.920714698552315e-19
CAGL0L00715g11447332181e-17
Sklu_2193.111437312182e-17
ADL079C11667282082e-16
YOR291W14724212031e-15
KLLA0C08393g11488062021e-15
Kwal_23.578911337762021e-15
Scas_704.3811617442002e-15
KLLA0B08217g14393201967e-15
AFR567W14493201806e-13
AFR354C12102861798e-13
YEL031W (SPF1)12152861761e-12
Scas_583.14*8753041715e-12
Kwal_26.707013158451725e-12
KLLA0A04015g13438011663e-11
YAL026C (DRS2)13555951628e-11
Kwal_55.215759892801573e-10
Scas_615.99421821521e-09
ADR350W13113461511e-09
CAGL0M08602g10122811483e-09
CAGL0L01419g12142671466e-09
KLLA0D04092g11522271449e-09
YDR270W (CCC2)10041901393e-08
KLLA0E22352g12062861384e-08
KLLA0F07447g9752801278e-07
Scas_89.12711851212e-06
CAGL0G06270g13283121242e-06
AFL191W15752781224e-06
AGL041C12331501199e-06
CAGL0H04477g16264091162e-05
YBR295W (PCA1)12161581109e-05
CAGL0G08085g15786241091e-04
Kwal_23.355615972711091e-04
ACR086C8101841072e-04
Scas_505.410253401045e-04
Scas_669.316381251010.001
KLLA0E01650g15502931000.001
Scas_636.161554522940.007
YMR162C (DNF3)1656128900.024
YDR093W (DNF2)1612191890.027
YGR208W (SER2)309169870.032
Scas_227.0d30783860.037
CAGL0L11814g1576410870.043
YER166W (DNF1)1571407850.074
KLLA0C17644g1576186840.10
AGR120C1547448830.14
Scas_576.81591432790.41
YOR273C (TPO4)65981760.80
Scas_499.334693722.0
YBR047W17569692.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.3160
         (1084 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.3160                                                         2115   0.0  
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....  1538   0.0  
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...  1503   0.0  
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...  1501   0.0  
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...  1441   0.0  
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...  1410   0.0  
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...  1408   0.0  
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...  1407   0.0  
Scas_569.0d                                                           618   0.0  
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   382   e-116
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...   363   e-109
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...   358   e-107
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...   347   e-103
Scas_707.48*                                                          339   e-102
Kwal_14.1498                                                          334   1e-98
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   243   3e-66
Kwal_47.17547                                                         231   4e-62
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...   219   4e-58
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   218   1e-57
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....   208   3e-55
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   179   2e-45
Scas_297.1                                                            132   4e-31
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...   125   7e-29
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   120   2e-27
Kwal_47.17522                                                         119   3e-27
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...   119   4e-27
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   116   3e-26
Scas_710.41                                                           112   5e-25
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   110   4e-24
Scas_688.1                                                            107   3e-23
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...   104   3e-22
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    96   8e-20
Scas_665.30                                                            94   3e-19
Kwal_26.9207                                                           94   5e-19
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    89   1e-17
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          89   2e-17
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    85   2e-16
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    83   1e-15
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    82   1e-15
Kwal_23.5789                                                           82   1e-15
Scas_704.38                                                            82   2e-15
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    80   7e-15
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    74   6e-13
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    74   8e-13
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    72   1e-12
Scas_583.14*                                                           70   5e-12
Kwal_26.7070                                                           71   5e-12
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    69   3e-11
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    67   8e-11
Kwal_55.21575                                                          65   3e-10
Scas_615.9                                                             63   1e-09
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    63   1e-09
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    62   3e-09
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    61   6e-09
KLLA0D04092g complement(344666..348124) some similarities with s...    60   9e-09
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    58   3e-08
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    58   4e-08
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    54   8e-07
Scas_89.1                                                              51   2e-06
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    52   2e-06
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    52   4e-06
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    50   9e-06
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    49   2e-05
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    47   9e-05
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    47   1e-04
Kwal_23.3556                                                           47   1e-04
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    46   2e-04
Scas_505.4                                                             45   5e-04
Scas_669.3                                                             44   0.001
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    43   0.001
Scas_636.16                                                            41   0.007
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    39   0.024
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    39   0.027
YGR208W (SER2) [2158] chr7 (911886..912815) Phosphoserine phosph...    38   0.032
Scas_227.0d                                                            38   0.037
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    38   0.043
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    37   0.074
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    37   0.10 
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    37   0.14 
Scas_576.8                                                             35   0.41 
YOR273C (TPO4) [5059] chr15 complement(834449..836428) Polyamine...    34   0.80 
Scas_499.3                                                             32   2.0  
YBR047W (YBR047W) [238] chr2 (331793..332320) Protein of unknown...    31   2.8  

>Kwal_23.3160
          Length = 1100

 Score = 2115 bits (5480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1023/1068 (95%), Positives = 1023/1068 (95%)

Query: 17   QIQHPAFHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQI 76
            QIQHPAFHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQI
Sbjct: 17   QIQHPAFHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQI 76

Query: 77   CNAMILVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSA 136
            CNAMILVLFISMVITLAIRDWIS               SYQEYKASKTMNSLKSLSTPSA
Sbjct: 77   CNAMILVLFISMVITLAIRDWISGGVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSA 136

Query: 137  HVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEA 196
            HVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEA
Sbjct: 137  HVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEA 196

Query: 197  SQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKD 256
            SQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKD
Sbjct: 197  SQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKD 256

Query: 257  ENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVN 316
            ENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSK                MATQKFVVN
Sbjct: 257  ENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFVVN 316

Query: 317  KEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDK 376
            KEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDK
Sbjct: 317  KEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDK 376

Query: 377  TGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGII 436
            TGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGII
Sbjct: 377  TGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGII 436

Query: 437  TSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFA 496
            TSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFA
Sbjct: 437  TSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFA 496

Query: 497  HKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLD 556
            HKLDMPRNALT              LGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLD
Sbjct: 497  HKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLD 556

Query: 557  EDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLA 616
            EDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLA
Sbjct: 557  EDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLA 616

Query: 617  FATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVH 676
            FATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVH
Sbjct: 617  FATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVH 676

Query: 677  MLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVI 736
            MLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVI
Sbjct: 677  MLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVI 736

Query: 737  ARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVL 796
            ARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVL
Sbjct: 737  ARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVL 796

Query: 797  SDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPV 856
            SDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPV
Sbjct: 797  SDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPV 856

Query: 857  EVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACCLA 916
            EVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACCLA
Sbjct: 857  EVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACCLA 916

Query: 917  CFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSFFK 976
            CFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSFFK
Sbjct: 917  CFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSFFK 976

Query: 977  MQPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGLAV 1036
            MQPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGLAV
Sbjct: 977  MQPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGLAV 1036

Query: 1037 AYTIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKYNT 1084
            AYTIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKYNT
Sbjct: 1037 AYTIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKYNT 1084

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 1538 bits (3981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/1062 (69%), Positives = 861/1062 (81%), Gaps = 9/1062 (0%)

Query: 23   FHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMIL 82
            FH + A + A +L TDL+ GL + EA AR+   G+N+LG++  I+ ++ILL Q+CNAMIL
Sbjct: 21   FHALPAHEVARLLGTDLRRGLTAEEARARLEVVGDNTLGEEEGINVRAILLKQMCNAMIL 80

Query: 83   VLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDG 142
            VL ISMVI LAI+DWIS               +YQEY A KTMNSLK LSTPSA VIR+G
Sbjct: 81   VLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNG 140

Query: 143  NDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYPA 202
             D  + S Q+VPGD+  V+ GDTVPADLRL+E +N ETDEALLTGE+LP+AK+ + V+  
Sbjct: 141  EDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVF-- 198

Query: 203  TEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFW 262
             +DTPVGDRLNLAFASSTVSKGRATGIVV+TGL +EIGKIA+SL+G  SLIS+DENK+  
Sbjct: 199  EQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGL 258

Query: 263  ANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIY 322
             N  +T+ A++GSFLGT  GTPLHRKL+K                MATQKF+VN+EVAIY
Sbjct: 259  QNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQKFIVNREVAIY 318

Query: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQ 382
            AICVA+SMIPSSLVVVLTITMS GAK+M+TRNV+VR+LDSLEALGAVND+CSDKTGTLTQ
Sbjct: 319  AICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQ 378

Query: 383  GKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNK 442
            GKMI+KQ WVP FGT+ V+ S+ PFDPT G + LIPRFSP +Y+HD  EDVGII +FK +
Sbjct: 379  GKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQR 438

Query: 443  FYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMP 502
            + ++ LP GLN + F +WL TA LANIA V++D +++EW+AHGDPTEIAIQVFA ++D P
Sbjct: 439  WQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHP 498

Query: 503  RNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHR 562
             +ALT                 + +     Y+H AEFPFDSSIKRMSAVY++L + N   
Sbjct: 499  HHALTTEQDEEDSD------SSQQNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRH 552

Query: 563  VFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSF 622
            VFTKGAFERVL CCT+W  D        P+TE+D E + KNV+TLS+EGLRVLAFATK+ 
Sbjct: 553  VFTKGAFERVLKCCTRWKLDP-GTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTI 611

Query: 623  TESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDF 682
               +A  + E L K+RDFVESDLIFQGLVGIYDPPR ETAGAVK+ H+AGINVHMLTGDF
Sbjct: 612  PAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDF 671

Query: 683  PGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQ 742
            PGTAKAIAQEVGILP NLYHYPKEVVD MVMTA QFD LTDEE+D L +LPLVIARCAPQ
Sbjct: 672  PGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQ 731

Query: 743  TKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFA 802
            TKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFA
Sbjct: 732  TKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFA 791

Query: 803  SILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWII 862
            SILNAVEEGRRMSDNIQKFVLQLLA NVAQA+YLM+GL FLDED+LSVFPLSPVEVLWII
Sbjct: 792  SILNAVEEGRRMSDNIQKFVLQLLAANVAQAIYLMLGLTFLDEDKLSVFPLSPVEVLWII 851

Query: 863  VVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACCLACFITVI 922
            VVTSC PAMGLGLEK+APDIMEK P DSKAGIFTWE+I+DM++YG  MA CCL CF+++I
Sbjct: 852  VVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLGCFVSII 911

Query: 923  YGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSFFKMQPETD 982
            Y  G+G LG NCN  YS+SC +V+ GRAATFA+MTWCALILAWEVIDMRRSFF M+PETD
Sbjct: 912  YKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMRRSFFAMKPETD 971

Query: 983  TPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGLAVAYTIAF 1042
            TPYTQ  KDIWSN+FLFWSVIFGF SVFPVVYIPVIN  VF H GIGYEWG+A A+++ F
Sbjct: 972  TPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYEWGIAFAFSLVF 1031

Query: 1043 WIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKYNT 1084
            W+ AE +K+ KR Y++NK RA NPE DLE+RR+HDPFEKY++
Sbjct: 1032 WLVAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYSS 1073

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 1503 bits (3891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/1067 (68%), Positives = 844/1067 (79%), Gaps = 23/1067 (2%)

Query: 23   FHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMIL 82
            FH ++A     +L T +  GL + +   R+S  GEN+LGDD+KI+ K IL+ QICNAMI+
Sbjct: 19   FHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIM 78

Query: 83   VLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDG 142
            VL ISMVITLAI+DWIS               +YQEY ASKTMNSLKSLSTPSAHVIRDG
Sbjct: 79   VLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDG 138

Query: 143  NDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYPA 202
            ND TI SK+LVPGD+C++K GDTVPADLRL+E +N ETDEALLTGESLP+AK  S+VY  
Sbjct: 139  NDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAKSHSEVY-- 196

Query: 203  TEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFW 262
             +DTPVGDRLNLAFA+STV+KGRATGIV+KT LNTEIGKIA+SLK + S ISKDENK+F 
Sbjct: 197  EKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFG 256

Query: 263  ANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIY 322
             N  ITL  TIGSFLGT  GTPLHRKLS+                M TQK+ VNK+VAIY
Sbjct: 257  QNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKYRVNKQVAIY 316

Query: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQ 382
            AICVA+SMIPSSLVVVLTITMS GAK+MATRNV+VRKLDSLEALGAVND+CSDKTGTLTQ
Sbjct: 317  AICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQ 376

Query: 383  GKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNK 442
            GKMI KQ W+P FGTITV  S+ PF+PT G I LIP+FSP+QYKHD  EDVGII  FK+K
Sbjct: 377  GKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSK 436

Query: 443  FYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMP 502
            +   +L   LN  LF  WL TA LANIA V+QD ET++WKAHGDPTEIAIQVFA ++D+P
Sbjct: 437  YLAGEL-GPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLP 495

Query: 503  RNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNA-- 560
            R+ LT                EK +     ++H+AEFPFDSS+KRMSA+Y +  ED A  
Sbjct: 496  RHVLTGEDKD----------DEKDARANSSFEHVAEFPFDSSVKRMSAIYKN-TEDPATP 544

Query: 561  -HRVFTKGAFERVLDCCTKWL--PDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAF 617
             + VFTKGAFERVL CC  W   PDG       P+++ED E + KNV+TLSSEGLRVLAF
Sbjct: 545  IYEVFTKGAFERVLQCCDSWYTTPDG----KPSPLSKEDLETIQKNVDTLSSEGLRVLAF 600

Query: 618  ATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHM 677
            A KSF ES+     + L K RDFVE  L F GL+GIYDPPRQE+  AVK+ H+AGINVHM
Sbjct: 601  AKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHM 660

Query: 678  LTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIA 737
            LTGDFPGTAK+IAQEVGILP NLYHYPKEVV+ MVM A  FD L+D+EID+L +LPLVIA
Sbjct: 661  LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIA 720

Query: 738  RCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLS 797
            RCAPQTKVRMI+ALHRR KFCAMTGDGVNDSPSLK ANVGIAMGINGSDVAKDASDIVLS
Sbjct: 721  RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780

Query: 798  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVE 857
            DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLM+GLCF+D++  SVFPLSPVE
Sbjct: 781  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE 840

Query: 858  VLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACCLAC 917
            VLWIIVVTSCFPAMGLGLEK++ D+MEK P+D+KA +FTWE+I+DML+YG  MAACC+AC
Sbjct: 841  VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC 900

Query: 918  FITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSFFKM 977
            F+TV+YG G+G LG +CN++  E+C  V+ GRAA FA+MTWCALILAWEV+DMRRSFF M
Sbjct: 901  FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM 960

Query: 978  QPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGLAVA 1037
             PE++TPYTQ  KDIWSNQFLFWS++ GF SVFPVVYIPVIN  VF H  I YEWG A+ 
Sbjct: 961  NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIG 1020

Query: 1038 YTIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKYNT 1084
            ++ AFW G ELYKY KR YF  K R  NPE DLE R VHDPFE+Y T
Sbjct: 1021 FSFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQYTT 1067

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 1501 bits (3885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/1066 (68%), Positives = 848/1066 (79%), Gaps = 21/1066 (1%)

Query: 23   FHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMIL 82
            FH++S      +L T +  GL + +   R+   GEN+LGDDSKI+ K I + QICNAMI+
Sbjct: 19   FHSLSVSRVETLLSTHINQGLNTTQIAERLGLIGENTLGDDSKINIKGIFISQICNAMIM 78

Query: 83   VLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDG 142
            VL ISMVI+ AI+DWIS               +YQEY ASKTMNSLKSLSTPSAHVIR G
Sbjct: 79   VLIISMVISFAIKDWISGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRAG 138

Query: 143  NDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYPA 202
            ND TI SK+LVPGD+C+++ GDTVPADLRL E +N ETDEALLTGESLP+AK   +VY  
Sbjct: 139  NDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLETDEALLTGESLPVAKSHGEVY-- 196

Query: 203  TEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFW 262
             +DTPVGDRLNLAFA+STV+KGRATGIV+KT LNTEIGKIA+SLK + SLIS+D++K+F 
Sbjct: 197  EQDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSEASLISRDKSKSFG 256

Query: 263  ANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIY 322
             N  ITL  +IG+FLGT+ GTPLHRKLS+                M TQKF VNK+VAIY
Sbjct: 257  RNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKFKVNKQVAIY 316

Query: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQ 382
            AICVA+SMIPSSLVVVLTITMS GAK+MATR+V++RKLDSLEALGAVND+CSDKTGTLTQ
Sbjct: 317  AICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGAVNDICSDKTGTLTQ 376

Query: 383  GKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNK 442
            GKMI KQ W+P FGTI V NS+ PF+PT G I+LIP+FSP+QYKHD  EDVG+IT FK+K
Sbjct: 377  GKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEEDVGMITDFKSK 436

Query: 443  FYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMP 502
            +Y D+L   LN  LF  WL TA LANIA V++DPET++WKAHGDPTEIAIQVFA ++D+P
Sbjct: 437  YYADEL-GPLNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDPTEIAIQVFATRMDLP 495

Query: 503  RNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNA-- 560
            R  LT                EK    +  ++H+AE+PFDSS+KRMSA+Y +++E  A  
Sbjct: 496  RRVLTGEDND----------DEKNIHNDITFEHVAEYPFDSSVKRMSAIYKNVEEPKAPI 545

Query: 561  HRVFTKGAFERVLDCCTKWL--PDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFA 618
            + VFTKGAFERVL CC  W   PDG      +P+TEED E V KNV+TLSSEGLRVLAFA
Sbjct: 546  YEVFTKGAFERVLQCCNSWYTTPDG----SPQPLTEEDLETVQKNVDTLSSEGLRVLAFA 601

Query: 619  TKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHML 678
             K+F ESQ     + L K RDFVE++L F GLVGIYDPPR+E+  AVK+ H AGINVHML
Sbjct: 602  KKTFNESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHML 661

Query: 679  TGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIAR 738
            TGDFPGTAK+IAQEVGILP NLYHYPKEVV+ MVMTA  FD L+D+EID L +LPLVIAR
Sbjct: 662  TGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLVIAR 721

Query: 739  CAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSD 798
            CAPQTKVRMI+ALHRR +FCAMTGDGVNDSPSLK ANVGIAMGINGSDVAKDASDIVLSD
Sbjct: 722  CAPQTKVRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSD 781

Query: 799  DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEV 858
            DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLM+GLCFLDE+  SVFPLSPVEV
Sbjct: 782  DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSPVEV 841

Query: 859  LWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACCLACF 918
            LW+IVVTSCFPAMGLGLEK+  D+MEK P+D+KA IFTWE+I+DML+YG  +AACC+ACF
Sbjct: 842  LWVIVVTSCFPAMGLGLEKANVDVMEKPPKDAKAVIFTWEVIVDMLVYGVIIAACCMACF 901

Query: 919  ITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSFFKMQ 978
            +TVIYG G+G LG  CNN + +SC  V+ GRAA FA+MTWCALILAWEV+DMRRSFF M 
Sbjct: 902  VTVIYGTGDGNLGRGCNNGFDDSCRLVFKGRAAAFATMTWCALILAWEVVDMRRSFFMMN 961

Query: 979  PETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGLAVAY 1038
            PET+TPYTQ  KD+WSNQFLFWS++ GF SVFPVVYIPVIN  VF H  I YEWG ++ +
Sbjct: 962  PETETPYTQVFKDVWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYDITYEWGFSLGF 1021

Query: 1039 TIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKYNT 1084
            ++AFW GAELYKY KR YF +K R +NPE DLE R V DPFE+Y T
Sbjct: 1022 SLAFWAGAELYKYGKRRYFGSKDRVENPESDLEKRSVQDPFEQYTT 1067

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 1441 bits (3731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/1066 (64%), Positives = 843/1066 (79%), Gaps = 9/1066 (0%)

Query: 23   FHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMIL 82
            +H +S  DT   L TD   G+   E  AR++Q GENSLGDD+KID+K++L+HQICNAMIL
Sbjct: 13   YHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAMIL 72

Query: 83   VLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDG 142
            VL ISM+I+ AIRDWI+                 QEYKASKTMN+L++LS+P+AHVIR+G
Sbjct: 73   VLIISMIISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNG 132

Query: 143  NDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYPA 202
            N E + S  +VPGDL VVK GDT+PADLRL+   NFETDEALLTGESLP++K+A++++  
Sbjct: 133  NSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIF-- 190

Query: 203  TEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFW 262
             ++TPVGDR+NLAF+SSTV KGRA GI +KTGLNTEIGKIA+SL+G N LIS+D  KT++
Sbjct: 191  DDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWY 250

Query: 263  ANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIY 322
             NA I+   T+G+FLGTT GTPLHRKLSK                MA+QKF V++ VAIY
Sbjct: 251  QNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIY 310

Query: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQ 382
            A+CVA+SMIPSSLVVVLTITMSVGA +MA+RNV++RKLDSLEALGAVND+CSDKTGTLTQ
Sbjct: 311  AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQ 370

Query: 383  GKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNK 442
            GKMI KQ WVP FGT+ V  S+ P +P  G I  IP  SP++Y H+ TEDVGI+ +FK+K
Sbjct: 371  GKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDK 430

Query: 443  FYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMP 502
            +    +P     +LF  WL+TA+LANIA V+ DPET+EWKAHGDPTEIAIQVFA ++D+P
Sbjct: 431  YEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLP 490

Query: 503  RNALTXXX--XXXXXXXXXXXLGEK-TSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDN 559
            R+ LT                L EK  ++    ++H AEFPFDS+IKRMS+VY S D   
Sbjct: 491  RHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRDY-K 549

Query: 560  AHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFAT 619
             + ++TKGAFE VL+CCT W   G + + A  MT+ D + + +N++++SSEGLRVLAFA 
Sbjct: 550  TYEIYTKGAFESVLNCCTHWY--GRDPNTATVMTDADVDTIKENIDSMSSEGLRVLAFAN 607

Query: 620  KSFTESQALKVS-EDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHML 678
            KS+ +S   +   + + K RD+ E+ L F GL+GIYDPPR+ETAGAVK+FH+AGINV ML
Sbjct: 608  KSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRML 667

Query: 679  TGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIAR 738
            TGDFPGTAKAIAQEVGILP NLYHY KEVVD MVMT  QFD L+++EIDNL +LPLVIAR
Sbjct: 668  TGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIAR 727

Query: 739  CAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSD 798
            C+PQTKVRMI+ALHRREKFCAMTGDGVNDSPSLK ANVGIAMGINGSDVAKDASDIVLSD
Sbjct: 728  CSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSD 787

Query: 799  DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEV 858
            DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYL++GL F D++  SVFPL+PVEV
Sbjct: 788  DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVEV 847

Query: 859  LWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACCLACF 918
            LWIIVVTSCFPAMGLGLEK+A D+M++ P DSKAGIFTWEII+DM +YG WMAA C+A F
Sbjct: 848  LWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMAASCMATF 907

Query: 919  ITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSFFKMQ 978
            +T+IYG+ +G LG NCN  YSESC +V+  R+A FA+MTWCALILAWEVID+RRSFF+M 
Sbjct: 908  VTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLRRSFFRMH 967

Query: 979  PETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGLAVAY 1038
            P+TD P  Q+ KDI+ N+FLF+SV+FGF SVFPVVYIPVIN DVF HK IG+EWG+A+A+
Sbjct: 968  PDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWEWGIAIAF 1027

Query: 1039 TIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKYNT 1084
            ++ FWIG EL+KYFKR Y++NK RA NPE DLE++    PF+ Y+T
Sbjct: 1028 SVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAYST 1073

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 1410 bits (3651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/1071 (63%), Positives = 831/1071 (77%), Gaps = 17/1071 (1%)

Query: 22   AFHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMI 81
            A+HT++  + A  + T L  GL   E+  R+   GEN+LGDD+KID+K+++LHQ+CNAMI
Sbjct: 16   AYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMI 75

Query: 82   LVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRD 141
            +VL ISM I+ A+RDWI+                 QEYKA+KTMNSLK+LS+P+AHVIR+
Sbjct: 76   MVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRN 135

Query: 142  GNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYP 201
            G  ETI SK +VPGD+C+VK GDT+PADLRLIE  NF+TDE+LLTGESLP++K+A+ V+ 
Sbjct: 136  GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFG 195

Query: 202  ATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTF 261
              E+T VGDRLNLAF+SS V KGRA GIV+KT LN+EIGKIA+SL+GD+ LIS+D +K++
Sbjct: 196  KEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSW 255

Query: 262  WANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAI 321
              N  I+     G+FLGT  GTPLHRKLSK                MA+QKF V+K VAI
Sbjct: 256  LQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAI 315

Query: 322  YAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLT 381
            YAICVA+SMIPSSLVVVLTITMSVGA +M +RNV+VRKLDSLEALGAVND+CSDKTGTLT
Sbjct: 316  YAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLT 375

Query: 382  QGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKN 441
            QGKM+ +Q W+P FGTIT+SNS +PF+P +G + LIPRFSP++Y H+   DVGI+ +FK+
Sbjct: 376  QGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKD 435

Query: 442  KFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDM 501
            + Y   LP  ++  LF  WL+TA LANIA V++D  T+ WKAHGDPTEIAIQVFA K+D+
Sbjct: 436  RLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDL 495

Query: 502  PRNALTXXXXXXXX----XXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDE 557
            P NALT                    EK  S +  ++HIAEFPFDS++KRMS+VY + + 
Sbjct: 496  PHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQ--FEHIAEFPFDSTVKRMSSVYYN-NH 552

Query: 558  DNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAF 617
            +  + ++ KGAFE ++ CC+ W   G +     P+T+ D E + KNV +LS+EGLRVL F
Sbjct: 553  NETYNIYGKGAFESIISCCSSWY--GKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGF 610

Query: 618  ATKSFTESQALKVSEDLRKN----RDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGI 673
            A+KSFT+ Q   V++D  KN    R   ESDL+F GL+GIYDPPR ETAGAVK+FH+AGI
Sbjct: 611  ASKSFTKDQ---VNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGI 667

Query: 674  NVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLP 733
            NVHMLTGDF GTAKAIAQEVGILP NLYHY +E+VDSMVMT +QFD L++EE+D+L +LP
Sbjct: 668  NVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLP 727

Query: 734  LVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASD 793
            LVIARC+PQTKVRMI+ALHRR+KFCAMTGDGVNDSPSLK ANVGIAMGINGSDV+K+ASD
Sbjct: 728  LVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASD 787

Query: 794  IVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPL 853
            IVLSDDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYL+IGL F DE+  SVFPL
Sbjct: 788  IVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPL 847

Query: 854  SPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAAC 913
            SPVEVLWIIVVTSCFPAMGLGLEK+APD+M++ P DS+ GIFTWE+I+D   YG  M   
Sbjct: 848  SPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGS 907

Query: 914  CLACFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRS 973
            C+A F   +YG  +G LG +C+ +Y+ SC +VY  R+A FA+MTWCALILAWEV+DMRRS
Sbjct: 908  CMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRS 967

Query: 974  FFKMQPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWG 1033
            FF+M P+TD+P  ++ + IW NQFLFWS+IFGFVS FPVVYIPVIN  VF HK IG EWG
Sbjct: 968  FFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWG 1027

Query: 1034 LAVAYTIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKYNT 1084
            LA+A+TIAFWIGAELYK  KR YFK + RA NPE DLES    DPFE Y+T
Sbjct: 1028 LAIAFTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPFEAYST 1077

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 1408 bits (3645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/1071 (63%), Positives = 830/1071 (77%), Gaps = 17/1071 (1%)

Query: 22   AFHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMI 81
            A+HT++  + A  + T L  GL   E+  R+   GEN+LGDD+KID+K+++LHQ+CNAMI
Sbjct: 16   AYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMI 75

Query: 82   LVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRD 141
            +VL ISM I+ A+RDWI+                 QEYKA+KTMNSLK+LS+P+AHVIR+
Sbjct: 76   MVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRN 135

Query: 142  GNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYP 201
            G  ETI SK +VPGD+C+VK GDT+PADLRLIE  NF+TDE+LLTGESLP++K+A+ V+ 
Sbjct: 136  GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFG 195

Query: 202  ATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTF 261
              E+T VGDRLNLAF+SS V KGRA GIV+KT LN+EIGKIA+SL+GD+ LIS+D +K++
Sbjct: 196  KEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSW 255

Query: 262  WANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAI 321
              N  I+     G+FLGT  GTPLHRKLSK                MA+QKF V+K VAI
Sbjct: 256  LQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAI 315

Query: 322  YAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLT 381
            YAICVA+SMIPSSLVVVLTITMSVGA +M +RNV+VRKLDSLEALGAVND+CSDKTGTLT
Sbjct: 316  YAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLT 375

Query: 382  QGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKN 441
            QGKM+ +Q W+P FGTIT+SNS +PF+P +G + LIPRFSP++Y H+   DVGI+ +FK+
Sbjct: 376  QGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKD 435

Query: 442  KFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDM 501
            + Y   LP  ++  LF  WL+TA LANIA V++D  T+ WKAHGDPTEIAIQVFA K+D+
Sbjct: 436  RLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDL 495

Query: 502  PRNALTXXXXXXXX----XXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDE 557
            P NALT                    EK  S +  ++HIAEFPFDS++KRMS+VY + + 
Sbjct: 496  PHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQ--FEHIAEFPFDSTVKRMSSVYYN-NH 552

Query: 558  DNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAF 617
            +  + ++ KGAFE ++ CC+ W   G +     P+T+ D E + KNV +LS+EGLRVL F
Sbjct: 553  NETYNIYGKGAFESIISCCSSWY--GKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGF 610

Query: 618  ATKSFTESQALKVSEDLRKN----RDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGI 673
            A+KSFT+ Q   V++D  KN    R   ESDL+F GL+GIYDPPR ETAGAVK+FH+AGI
Sbjct: 611  ASKSFTKDQ---VNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGI 667

Query: 674  NVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLP 733
            NVHMLTGDF GTAKAIAQEVGILP NLYHY +E+VDSMVMT +QFD L++EE+D+L +LP
Sbjct: 668  NVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLP 727

Query: 734  LVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASD 793
            LVIARC+PQTKVRMI+ALHRR+KFCAMTGDGVNDSPSLK ANVGIAMGINGSDV+K+ASD
Sbjct: 728  LVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASD 787

Query: 794  IVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPL 853
            IVLSDDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYL+IGL F DE+  SVFPL
Sbjct: 788  IVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPL 847

Query: 854  SPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAAC 913
            SPVEVLWIIVVTSCFPAMGLGLEK+APD+M++ P DS+ GIFTWE+I+D   YG  M   
Sbjct: 848  SPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAYGIIMTGS 907

Query: 914  CLACFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRS 973
            C+A F   +YG  +G LG +C+ +Y+ SC +VY  R+A FA+MTWCALILAWEV+DMRRS
Sbjct: 908  CMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRS 967

Query: 974  FFKMQPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWG 1033
            FF+M P+TD+P  ++ + IW NQFLFWS+IFGFVS FPVVYIPVIN  VF HK IG EWG
Sbjct: 968  FFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWG 1027

Query: 1034 LAVAYTIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKYNT 1084
            LA+A+TIAFWIGAELYK  KR YFK + RA N E DLE    HDPFE Y+T
Sbjct: 1028 LAIAFTIAFWIGAELYKCGKRRYFKTQ-RAHNSENDLERSSKHDPFEAYST 1077

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 1407 bits (3642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/1071 (63%), Positives = 830/1071 (77%), Gaps = 17/1071 (1%)

Query: 22   AFHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMI 81
            A+HT++A + A  + T L  GL   E   R+   GEN+LGDD+KID+K+++LHQ+CNAMI
Sbjct: 16   AYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMI 75

Query: 82   LVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRD 141
            +VL ISM+I+ A+ DWI+                 QEYKA+KTMNSLK+LS+P+AHVIR+
Sbjct: 76   MVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRN 135

Query: 142  GNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYP 201
            G  ETI SK +VPGD+C+VK GDT+PADLRLIE  NF+TDE+LLTGESLP++K+A+ V+ 
Sbjct: 136  GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFG 195

Query: 202  ATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTF 261
              E+T VGDRLNLAF+SS V KGRA GIV+KT LN+EIGKIA+SL+GD+ LIS+D +K++
Sbjct: 196  KEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSW 255

Query: 262  WANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAI 321
              N  I+     G+FLGT  GTPLHRKLSK                MA+QKF V+K VAI
Sbjct: 256  LQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAI 315

Query: 322  YAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLT 381
            YAICVA+SMIPSSLVVVLTITMSVGA +M +RNV+VRKLDSLEALGAVND+CSDKTGTLT
Sbjct: 316  YAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLT 375

Query: 382  QGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKN 441
            QGKM+ +Q W+P FGTIT+SNS +PF+P +G + LIPRFSP++Y H+   DVGI+ +FK+
Sbjct: 376  QGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKD 435

Query: 442  KFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDM 501
            + Y   LP  ++  LF  WL+TA LANIA V++D  T+ WKAHGDPTEIAIQVFA K+D+
Sbjct: 436  RLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDL 495

Query: 502  PRNALTXXXXXXXX----XXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDE 557
            P NALT                    EK  S +  ++HIAEFPFDS++KRMS+VY + + 
Sbjct: 496  PHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQ--FEHIAEFPFDSTVKRMSSVYYN-NH 552

Query: 558  DNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAF 617
            +  + ++ KGAFE ++ CC+ W   G +     P+T+ D E + KNV +LS+EGLRVL F
Sbjct: 553  NETYNIYGKGAFESIISCCSSWY--GKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGF 610

Query: 618  ATKSFTESQALKVSEDLRKN----RDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGI 673
            A+KSFT+ Q   V++D  KN    R   ESDL+F GL+GIYDPPR ETAGAVK+FH+AGI
Sbjct: 611  ASKSFTKDQ---VNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGI 667

Query: 674  NVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLP 733
            NVHMLTGDF GTAKAIAQEVGILP NLYHY +E+VDSMVMT +QFD L++EE+D+L +LP
Sbjct: 668  NVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLP 727

Query: 734  LVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASD 793
            LVIARC+PQTKVRMI+ALHRR+KFC MTGDGVNDSPSLK ANVGIAMGINGSDV+K+ASD
Sbjct: 728  LVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASD 787

Query: 794  IVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPL 853
            IVLSDDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYL+IGL F DE+  SVFPL
Sbjct: 788  IVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPL 847

Query: 854  SPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAAC 913
            SPVEVLWIIVVTSCFPAMGLGLEK+APD+M++ P DS+ GIFTWE+I+D   YG  M   
Sbjct: 848  SPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGS 907

Query: 914  CLACFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRS 973
            C+A F   +YG  +G LG +C+ +Y+ SC +VY  R+A FA+MTWCALILAWEV+DMRRS
Sbjct: 908  CMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRS 967

Query: 974  FFKMQPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWG 1033
            FF+M P+TD+P  ++ + IW NQFLFWS+IFGFVS FPVVYIPVIN  VF HK IG EWG
Sbjct: 968  FFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWG 1027

Query: 1034 LAVAYTIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKYNT 1084
            LA+A+TIAFWIGAELYK  KR YFK + RA NPE DLES    DPFE Y+T
Sbjct: 1028 LAIAFTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPFEAYST 1077

>Scas_569.0d
          Length = 468

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/377 (74%), Positives = 327/377 (86%), Gaps = 1/377 (0%)

Query: 709  DSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDS 768
            ++MVMT +QFD+LT E+IDNL +LPLVIARC+PQTKVRMI+ALHRR+KFCAMTGDGVNDS
Sbjct: 78   ENMVMTGSQFDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDS 137

Query: 769  PSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAE 828
            PSLK ANVGIAMGINGSDVAKDASDIVLSDDNFASILNA+EEGRRMSDNIQKFVLQLLAE
Sbjct: 138  PSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAE 197

Query: 829  NVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQ 888
            NVAQALYL+ GL F D++  SVFPL+PVEVLWIIVVTSCFPAMGLGLEK+APD+M++ P 
Sbjct: 198  NVAQALYLICGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPN 257

Query: 889  DSKAGIFTWEIILDMLIYGTWMAACCLACFITVIYGKGNGELGINCNNSYSESCDNVYHG 948
            DSK+GIFTWEII+DM +YG  MA CC+  F TV+YGK  G LG NCN SY+E+C +V+ G
Sbjct: 258  DSKSGIFTWEIIVDMFVYGIIMAGCCMGSFTTVVYGKDGGNLGFNCNKSYNETCHDVFRG 317

Query: 949  RAATFASMTWCALILAWEVIDMRRSFFKMQPETDTPYTQWMKDIWSNQFLFWSVIFGFVS 1008
            R++ FA MTWCALILAWEV+D+RRSFF+MQPETDTP  ++ +DIWSN+FLFWS+IFGFVS
Sbjct: 318  RSSAFAVMTWCALILAWEVVDLRRSFFRMQPETDTPVREFFRDIWSNKFLFWSLIFGFVS 377

Query: 1009 VFPVVYIPVINKDVFKHKGIGYEWGLAVAYTIAFWIGAELYKYFKRCYFKN-KGRAQNPE 1067
             FPV+YIPVIN  VF HKGI +EWG+A A+TI FW+G ELYK+ KR YF+    +AQNPE
Sbjct: 378  TFPVIYIPVINDKVFLHKGITFEWGIAFAFTIIFWMGCELYKFMKRRYFRRMMNKAQNPE 437

Query: 1068 KDLESRRVHDPFEKYNT 1084
             DLE R   DPFE Y+T
Sbjct: 438  SDLEKRTRRDPFEAYST 454

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 11/80 (13%)

Query: 19  QHPAFHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKID----------- 67
           ++  FHT+ +++TA++L+TD   GL   +  AR S  GENSLGDD K +           
Sbjct: 27  EYNEFHTLQSQETANLLQTDASKGLDDEKFQARKSAVGENSLGDDMKSNSTENMVMTGSQ 86

Query: 68  FKSILLHQICNAMILVLFIS 87
           F  +   QI N  +L L I+
Sbjct: 87  FDELTPEQIDNLPVLPLVIA 106

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score =  382 bits (982), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 293/1042 (28%), Positives = 486/1042 (46%), Gaps = 165/1042 (15%)

Query: 23   FHTVSARDTAHVLETDLQAGLRSAE-ATARVSQYGENSLG-DDSKIDFKSILLHQICNAM 80
            + T+S  +T H L+TD + GL S E AT R   YG N +  DD +   K  L + + + +
Sbjct: 46   YCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRL 105

Query: 81   ILVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIR 140
            IL+L  S +I++ + +                    QEY++ K++ +L  L     H+IR
Sbjct: 106  ILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIR 165

Query: 141  DGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVY 200
             G +  + +  LVPGDL   + GD +PAD+R+IEC +   DE+ LTGE+ P+ K    + 
Sbjct: 166  GGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALS 225

Query: 201  PATED------TPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLIS 254
              + +       PV +R N+A+  + V +G   GIVV TG  T  G + + +    S I 
Sbjct: 226  RDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMM----SSIE 281

Query: 255  KDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFV 314
            K +                         TPL   + K                       
Sbjct: 282  KPK-------------------------TPLQLTMDKLGKDLSLASFVVIGIICVVGIIQ 316

Query: 315  VNKEVAIYAICV--AVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDV 372
                + ++ I V  AV+ IP  L +++T+T+++G   MA R  +VR+L S+E LG+VN +
Sbjct: 317  GRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 376

Query: 373  CSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTED 432
            CSDKTGTLT   M V + W    G++    +    D   GG            K+  T+D
Sbjct: 377  CSDKTGTLTSNHMTVSKIWC--LGSMANKLNVLSLDKNKGG----------NLKNYLTDD 424

Query: 433  VGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAI 492
            V                           L    L N A   Q    E  K  G+PT++A+
Sbjct: 425  VK------------------------TTLLCGNLCNNASYSQ----EHAKYLGNPTDVAL 456

Query: 493  QVFAHKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVY 552
                 K ++                         + V   Y  + E  F+S  ++M A  
Sbjct: 457  LEQLQKFEL-------------------------ADVRSEYTKVKELSFNSK-RKMMATK 490

Query: 553  VSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGL 612
            +  D +    +F KGAFER+LD  + +L +   +   + +T   +E +     TL+SEGL
Sbjct: 491  IQ-DNEKKTTLFIKGAFERILDKSSSYLTE---KGKIEKLTAGHRETIIDCANTLASEGL 546

Query: 613  RVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAG 672
            RVLAFA ++ T+S +  V +D+        SDL+F GL+G+ DPPR     A+ QF + G
Sbjct: 547  RVLAFAKRAMTDSSSKLVEDDI--------SDLVFTGLIGMNDPPRSSVKFAIDQFLQGG 598

Query: 673  INVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSM--VMTAAQFDQLTDEEIDNLL 730
            I++ M+TGD   TA  IA+++GI           V+D    V++  + +++TD+++ N++
Sbjct: 599  IHIIMITGDSENTAVNIARQIGI----------PVIDPKLSVLSGDKLNEMTDDQLANVI 648

Query: 731  LLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKD 790
                + AR  P+ K+ ++ AL RR    AMTGDGVND+P+LK A++G++MG  G+DVAK+
Sbjct: 649  DHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKE 708

Query: 791  ASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSV 850
            ASD++L+DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    + +   F+  +    
Sbjct: 709  ASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPN---- 764

Query: 851  FPLSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWM 910
             PL+ +++LWI ++    PA  LG+E    ++M+K P+     I T E++  ++  GT  
Sbjct: 765  -PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLI--GT-- 819

Query: 911  AACCLACFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDM 970
             A C+      ++ K   E G                    TF    +  +  A      
Sbjct: 820  -ASCIILGTVYVFVKEMAEDG-----------QVTARDTTMTFTCFVFFDMFNALACRHT 867

Query: 971  RRSFFKMQPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGY 1030
             +S F++               ++N+    +V F  +     +YIP   + +FK + + +
Sbjct: 868  TKSIFEI-------------GFFTNKMFNLAVGFSLLGQMCAIYIPFF-QAIFKTESLAF 913

Query: 1031 EWGLAVAY-TIAFWIGAELYKY 1051
               + +A  + + +I  E+ KY
Sbjct: 914  SDLIFLAMISSSVFIIDEIRKY 935

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score =  363 bits (933), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 285/1016 (28%), Positives = 475/1016 (46%), Gaps = 163/1016 (16%)

Query: 23   FHTVSARDTAHVLETDLQAGLRSAEATARVSQ-YGENSLG-DDSKIDFKSILLHQICNAM 80
            F T+S  +T   LETD+  GL S E   +  + +G N    DD +   K  L+  + + +
Sbjct: 48   FCTLSVGETVENLETDVDNGLSSEEEVVKRREIHGRNDFEEDDDESMIKKFLMSFVEDRL 107

Query: 81   ILVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIR 140
            IL+L  S V++ AI                      QEY++ K++ +L  L     H+IR
Sbjct: 108  ILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSEKSLEALNKLVPTKCHLIR 167

Query: 141  DGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVY 200
             G +    + +LVPGDL   K GD +PAD+R+IE V+   DE+ LTGE+ P+ K+A  + 
Sbjct: 168  YGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLSIDESNLTGETEPLHKDAQTID 227

Query: 201  PATED---TPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDE 257
            P   D    PV +R  +A+  + V +G   GIV+ TG NT  G I + +      I K +
Sbjct: 228  PEEYDNRNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMVNS----IEKPK 283

Query: 258  NKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNK 317
                                     TPL   + +                        N 
Sbjct: 284  -------------------------TPLQETMDRLGTELSYISFFIIAIISIVGIIRGNS 318

Query: 318  EVAIYAICV--AVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSD 375
             + ++ + V  AV+ IP  L +++T+T+++G   M  +N +VR+L S+E LG+VN +C+D
Sbjct: 319  LLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTD 378

Query: 376  KTGTLTQGKMIVKQAW-VPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVG 434
            KTGTLT   M V + + + S GT    N+ +P + ++        F  H   +D  E + 
Sbjct: 379  KTGTLTTNHMTVSKLFCLDSSGT--YENAISPEEDSE--------FDVHD--NDVKETLT 426

Query: 435  IITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQV 494
            I     N  Y+++        L++                          G+PT++A+  
Sbjct: 427  IANICNNAKYSEE------HNLYI--------------------------GNPTDVALIE 454

Query: 495  FAHKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVS 554
               K  +P                              ++ + E  F+S  K M+    S
Sbjct: 455  VLTKFGIPDQ-------------------------RDSHEKMEELSFNSKRKYMA--IKS 487

Query: 555  LDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRV 614
              E   H ++ KGAFER+LD  + +L       + +   E  K  V +   + +S+GLR 
Sbjct: 488  SKESGEHVLYIKGAFERILDKSSYYLDKA---GEVREFDEHSKVMVLEAAHSCASDGLRT 544

Query: 615  LAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGIN 674
            +A A K  T+S  +   +D+        + L F GL G+ DPPR     ++++ H+ G++
Sbjct: 545  IACAFKP-TDSDNVISEDDI--------NGLTFTGLFGLADPPRPNVKASIEKLHRGGVH 595

Query: 675  VHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPL 734
            + M+TGD   TA +IA+++G+  ++         +S VMT  +  +LT++E+  ++    
Sbjct: 596  IIMITGDSVNTAVSIAEKIGLSVQDR--------ESSVMTGDKVSELTEDELSKVIDKVN 647

Query: 735  VIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDI 794
            + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK A++GIAMGI+G+DVAK+ SD+
Sbjct: 648  IFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSDM 707

Query: 795  VLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLS 854
            +L+DD+F+SIL A+EEG+ + +NI+ F+   L+ +VA    + I        +L   PL+
Sbjct: 708  ILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAITTIA----KLPA-PLN 762

Query: 855  PVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACC 914
            P+++LWI ++    PA  LG+E    D+M+K P+  +  I    I+L +L    ++A C 
Sbjct: 763  PMQILWINIIMDGPPAQSLGVEPVDSDVMDKPPRSREERILNMNILLRLL----YLAICI 818

Query: 915  LACFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSF 974
            L      I+ KG  E      N  + S D        TF    + A+  A       +S 
Sbjct: 819  LVGTF-YIFLKGMDE------NQQTTSKD-----ITMTFTGFVFFAIFNAVACRHTTKSI 866

Query: 975  FKMQPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGY 1030
            F++              ++SN+    +++         VYIP   + +FK + +G+
Sbjct: 867  FQIG-------------LFSNRIFNIAILLSVCGQMCAVYIPFF-QHIFKTENLGF 908

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score =  358 bits (918), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 267/921 (28%), Positives = 440/921 (47%), Gaps = 132/921 (14%)

Query: 23  FHTVSARDTAHVLETDLQAGLRSA-EATARVSQYGENSLG-DDSKIDFKSILLHQICNAM 80
           + T+S  +    L+TD   GLRS+ EA  R S YG N +  +D +  FK  L + I + M
Sbjct: 38  YCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRM 97

Query: 81  ILVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIR 140
           IL+L  S V++L + +                    QEY++ K++ +L  L     H++R
Sbjct: 98  ILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMR 157

Query: 141 DGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVY 200
            G +  + +  LVPGDL   + GD +PAD+R+IE ++   DE+ LTGE+ P+ K +  + 
Sbjct: 158 CGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIE 217

Query: 201 PATED------TPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLIS 254
            ++ +       P+ +R  +A+  + V +G   GIVV TG NT  G + + +      I 
Sbjct: 218 KSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNN----IE 273

Query: 255 KDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFV 314
           K +                         TPL   + K                       
Sbjct: 274 KPK-------------------------TPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQ 308

Query: 315 VNKEVAIYAICV--AVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDV 372
               + ++ I V  AV+ IP  L +++T+T+++G   MA R  +VR+L S+E LG+VN +
Sbjct: 309 GRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 368

Query: 373 CSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTED 432
           CSDKTGTLT   M V + W        + + SN  +          + S    K+  TED
Sbjct: 369 CSDKTGTLTSNHMTVSKLWC-------LDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTED 421

Query: 433 VGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAI 492
           V                           L    L N A   Q    E     G+PT++A+
Sbjct: 422 VR------------------------ETLTIGNLCNNASFSQ----EHAIFLGNPTDVAL 453

Query: 493 QVFAHKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVY 552
                  +MP                          +    + + E PF+S  K M+   
Sbjct: 454 LEQLANFEMP-------------------------DIRNTVQKVQELPFNSKRKLMATKI 488

Query: 553 VSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGL 612
           ++   DN   V+ KGAFER+L+  T +L     +++   +TE  K  + +   +++SEGL
Sbjct: 489 LN-PVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEK--LTEAQKATINECANSMASEGL 545

Query: 613 RVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAG 672
           RV  FA  + ++S    ++EDL K       DL F GL+G+ DPPR     A++Q  + G
Sbjct: 546 RVFGFAKLTLSDSST-PLTEDLIK-------DLTFTGLIGMNDPPRPNVKFAIEQLLQGG 597

Query: 673 INVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSM--VMTAAQFDQLTDEEIDNLL 730
           +++ M+TGD   TA  IA+++GI           V+D    V++  + D+++D+++ N++
Sbjct: 598 VHIIMITGDSENTAVNIAKQIGI----------PVIDPKLSVLSGDKLDEMSDDQLANVI 647

Query: 731 LLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKD 790
               + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK +++G++MG  G+DVAK+
Sbjct: 648 DHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKE 707

Query: 791 ASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSV 850
           ASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +   F   +    
Sbjct: 708 ASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPN---- 763

Query: 851 FPLSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWM 910
            PL+ +++LWI ++    PA  LG+E    ++M+K P+     I T +++  +L      
Sbjct: 764 -PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLL-----T 817

Query: 911 AACCLACFITVIYGKGNGELG 931
            A C+      I+ K   E G
Sbjct: 818 TAACIIVGTVYIFVKEMAEDG 838

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score =  347 bits (890), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 276/1042 (26%), Positives = 480/1042 (46%), Gaps = 151/1042 (14%)

Query: 23   FHTVSARDTAHVLETDLQAGL-RSAEATARVSQYGENSLGDDSKID-FKSILLHQICNAM 80
            + T++  +T   L TD   GL    +  A   ++G N +  D +   +K  +   + + +
Sbjct: 44   YCTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPL 103

Query: 81   ILVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIR 140
            IL+L  S V++  + +                    QEY++ K++ +L  L   S H+IR
Sbjct: 104  ILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIR 163

Query: 141  DGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVY 200
             G +  + +  LVPGDL   K GD +PAD+R+IE  +   DE+ LTGE+ P+ K  + V 
Sbjct: 164  FGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVN 223

Query: 201  PATED------TPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLIS 254
             AT         P+G+R ++A+  + V +G   GIVV TG +T  G + + +       S
Sbjct: 224  SATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMN------S 277

Query: 255  KDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFV 314
             ++ KT    A  TL   +       +G      + +                       
Sbjct: 278  IEKPKTPLQMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRSWL------------------ 319

Query: 315  VNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCS 374
               E+   ++ +AV+ IP  L +++T+T+++G   MA R  +VR+L S+E LG+VN +CS
Sbjct: 320  ---EMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICS 376

Query: 375  DKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDP-TDGGIELIPRFSPHQYKHDSTEDV 433
            DKTGTLT   M   + W    G++   N+    +  + GG+                   
Sbjct: 377  DKTGTLTANHMTASKIWC--LGSMANKNNVLSLEAKSSGGLP------------------ 416

Query: 434  GIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQ 493
            G + + KN + +D + A L      N       A+ +H       E  K  G+PT+IA+ 
Sbjct: 417  GKLPNLKN-YLSDDVKATLRIGSICNN------ASFSH-------EHGKYLGNPTDIALL 462

Query: 494  VFAHKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYV 553
                K D+                    + E+     P    + E  F+S  K M+    
Sbjct: 463  EVLQKFDL--------------------VDER-----PTTTRVDELTFNSKRKYMAVKVD 497

Query: 554  SLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLR 613
            S      H ++ KGAFER+L+    ++         + +++  K  +    ++L+SEGLR
Sbjct: 498  SPANSGKHIIYVKGAFERILERSASFI---GGAGKVEKLSDSHKSLINDCAKSLASEGLR 554

Query: 614  VLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGI 673
             LAFA    + ++ +          D    +L F GL+G+ DPPR     A+++  + G+
Sbjct: 555  TLAFAQLECSTNKPMN---------DSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGV 605

Query: 674  NVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLP 733
            +V M+TGD   TA  IA+++GI        P    +  V+T  + DQ+TD+++  ++   
Sbjct: 606  HVIMITGDAENTAVNIARQIGI--------PVINPEISVLTGDRLDQMTDDQLAGVIDHV 657

Query: 734  LVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASD 793
             + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK A++G+AMG  G+DVAK+ASD
Sbjct: 658  NIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASD 717

Query: 794  IVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPL 853
            +VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + I   F  ++     PL
Sbjct: 718  MVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQN-----PL 772

Query: 854  SPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAAC 913
            + +++LWI ++    PA  LG+E    ++M K P+     I T +++  +LI   ++   
Sbjct: 773  NAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGG 832

Query: 914  CLACFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRS 973
             +  FI                   +E           TF    +  +  A       +S
Sbjct: 833  TIYVFI----------------KEMTEDGQVTARDTTMTFTCFVFFDMFSALACRHATKS 876

Query: 974  FFKMQPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGY-EW 1032
             F++              I++N+   ++V F  +     +YIP   +++FK + +   + 
Sbjct: 877  IFEI-------------GIFNNKMFNYAVGFSLLGQLCAIYIPFF-QNIFKTERLSLGDL 922

Query: 1033 GLAVAYTIAFWIGAELYKYFKR 1054
               +  + + +I  E+ KY+ +
Sbjct: 923  IYLIVISSSVFIADEVRKYYAK 944

>Scas_707.48*
          Length = 741

 Score =  339 bits (870), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 245/811 (30%), Positives = 401/811 (49%), Gaps = 127/811 (15%)

Query: 23  FHTVSARDTAHVLETDLQAGLRS-AEATARVSQYGENSL--GDDSKIDFKSILLHQICNA 79
           + T+S  +T   LETD ++GL S AEA+ R   YG N +   +D  + +K  L   + + 
Sbjct: 38  YCTMSVDETLRKLETDPKSGLGSIAEASRRKLVYGANEIVIEEDESL-WKKFLSSFVEDR 96

Query: 80  MILVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVI 139
           +IL+L  S V++  + +                    QEY++ K++ +L  L     H+I
Sbjct: 97  LILLLIGSAVVSFIMGNIDDAVSITLAIVIVVSVGFVQEYRSEKSLEALNKLVPAECHLI 156

Query: 140 RDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQV 199
           R G +  + +  LVPGDL   K GD +PADLR+IE V+   DE+ LTGE+ P+ K A +V
Sbjct: 157 RCGQESHVLASGLVPGDLVHFKIGDRIPADLRIIEAVDLSIDESNLTGENEPVHKSAKEV 216

Query: 200 YPATED------TPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLI 253
              + +       P+ DR  +A+  + V +G   GIVV  G NT  G I + L       
Sbjct: 217 NKDSFNDQPNSIIPISDRTCVAYMGTLVKEGHGKGIVVGIGKNTSFGAIFEMLS------ 270

Query: 254 SKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKF 313
           + ++ KT   NA   L   +  F     G                         +  + +
Sbjct: 271 NIEKPKTPLQNAMDKLGKDLSLFSFIVIG------------------LICLVGILQGRSW 312

Query: 314 VVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVC 373
           +   E+   ++ +AV+ IP  L +++T+T+++G   MA R  +VR+L S+E LG+VN +C
Sbjct: 313 L---EMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVIC 369

Query: 374 SDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDV 433
           SDKTGTLT   M   + W       +++N +N           + +      K+  TEDV
Sbjct: 370 SDKTGTLTSNHMTASKIWCLD----SMANKANVLS--------LEKSKSGSLKNYLTEDV 417

Query: 434 GIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQ 493
               +  N                        + N A   Q    E  K  G+PT+IA+ 
Sbjct: 418 KSTLTIGN------------------------ICNNASFSQ----EHGKYLGNPTDIALL 449

Query: 494 VFAHKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYV 553
               K D+                         S + P +K + E PF+S  K M+   V
Sbjct: 450 EQLSKFDL-------------------------SDIRPTFKKVQEIPFNSKRKFMAVKIV 484

Query: 554 SLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLR 613
             + +  + +  KGAFE+VL  C+ +L     +   + +T+  ++ + +   +L+SEGLR
Sbjct: 485 --NSEGKYSLCVKGAFEKVLSQCSHYLN---QKGKTEKLTQGQRDVIIETANSLASEGLR 539

Query: 614 VLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGI 673
           +LAFA  +  +S  L   E +         DLIF GL+G+ DPPR     A++Q  + G+
Sbjct: 540 MLAFAKTTLPDSPTLLTEESV--------GDLIFTGLIGMNDPPRPTVKPAIEQLLQGGV 591

Query: 674 NVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSM--VMTAAQFDQLTDEEIDNLLL 731
           ++ M+TGD   TA  IA+++GI           V+D    V++  + ++++D+++ N++ 
Sbjct: 592 HIIMITGDSENTAVNIARQIGI----------PVLDPKLSVLSGDKLNEMSDDQLANVID 641

Query: 732 LPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDA 791
              + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK A++G++MG  G+DVAK+A
Sbjct: 642 HVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEA 701

Query: 792 SDIVLSDDNFASILNAVEEGRRMSDNIQKFV 822
           SD+VL+DD+F++IL A+EEG+ + +NIQ F+
Sbjct: 702 SDMVLTDDDFSTILTAIEEGKGIFNNIQNFL 732

>Kwal_14.1498
          Length = 939

 Score =  334 bits (856), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 255/915 (27%), Positives = 434/915 (47%), Gaps = 145/915 (15%)

Query: 23  FHTVSARDTAHVLETDLQAGLRSAEATA-RVSQYGENSLG--DDSKIDFKSILLHQICNA 79
           F ++S  +TA  L TD Q GL +      R +QYG+N +   +D  + +K +    + + 
Sbjct: 33  FCSLSVEETAQSLGTDTQNGLPTMSVVEERRAQYGKNEISSEEDEPLWWKFVTTF-VGDP 91

Query: 80  MILVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVI 139
           +IL+L  S VI+  + +                    QEY++ K++ +L  L     H+I
Sbjct: 92  LILLLIGSAVISFIMGNIDDAVSITLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQCHLI 151

Query: 140 RDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQV 199
           R G +  + +  LVPGD+   + GD +PADLR+IE V+   +E+ LTGE+ P+ K  + V
Sbjct: 152 RCGQESKLLASVLVPGDVVRFRVGDRIPADLRIIEAVDLSIEESNLTGENEPVHKSTATV 211

Query: 200 ----YPATEDT--PVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKG----- 248
               Y     +  PV +R  +AF  + V +G   GIV+ T  NT  GK+ + +       
Sbjct: 212 NKEFYKENLGSIVPVSERSCIAFMGTLVREGHGRGIVIGTAKNTAFGKVFEMMNAIEKPK 271

Query: 249 ---DNSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXX 305
                ++    ++ +F +   I +   IG   G +                         
Sbjct: 272 TPLQTAMDKLGKDLSFMSFIVIGIICLIGVIQGRSW------------------------ 307

Query: 306 XXMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEA 365
                       E+   ++ +AV+ IP  L +++T+T+++G   MA R  ++R+L S+E 
Sbjct: 308 -----------LEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLPSVET 356

Query: 366 LGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQY 425
           LG+VN +CSDKTGTLT   M V + W       ++SN SN        I  + + +   +
Sbjct: 357 LGSVNVICSDKTGTLTANHMSVNKVWCLG----SMSNKSN--------ILKLDKATSGSF 404

Query: 426 KHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHG 485
           K + TED+                           L+T  L N +        E  K  G
Sbjct: 405 KKNLTEDLRAT------------------------LRTGNLCNNSTYSH----EHAKYLG 436

Query: 486 DPTEIAIQVFAHKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSI 545
           +PT+IA+    HK  +                             P      E  F+S  
Sbjct: 437 NPTDIALLEVLHKFGLEDE-------------------------RPQVTRSDEISFNSKR 471

Query: 546 KRMSAVYVSLDEDNAH-RVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNV 604
           K M+   V + E N    V  KGA+E++L+  T ++     E+    +    ++ +  + 
Sbjct: 472 KFMA---VKVKEANGKFVVHVKGAYEKILEKSTHFIN---AENKVVKLDSNLRQAITDSA 525

Query: 605 ETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGA 664
           + L+S+GLR LAFA    +   + K++ED     D   + L F GL+G+ DPPR     A
Sbjct: 526 DALASDGLRTLAFAQLELSNGNSKKLTED-----DI--NGLTFAGLLGMNDPPRPSVKAA 578

Query: 665 VKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDE 724
           V++  +  +++ M+TGD   TA +IA+++GI        P    ++ V+T  + D ++++
Sbjct: 579 VERLSEGSVHIIMITGDAENTAVSIARQIGI--------PVVNPETAVLTGDKLDHMSED 630

Query: 725 EIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGING 784
           ++ +++    + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK A++G++MG  G
Sbjct: 631 QLASIIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMG 690

Query: 785 SDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLD 844
           +DVAK+ASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + I   F  
Sbjct: 691 TDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIATAFKL 750

Query: 845 EDRLSVFPLSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDML 904
            +     PL+ +++LWI ++    PA  LG+E    ++M+K P+     I T  +   +L
Sbjct: 751 PN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRADKILTKAVFQRLL 805

Query: 905 IYGTWMAACCLACFI 919
                +    +  FI
Sbjct: 806 QSAALIIIGTIYVFI 820

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  243 bits (621), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 273/987 (27%), Positives = 428/987 (43%), Gaps = 179/987 (18%)

Query: 27  SARDTAHVLETDLQAGL---RSAE--ATARVSQYGENSLGDDSKIDFKSILLHQICNAMI 81
           SA   A  L TDL  G+   + AE     R   YG N L + +   F +++     +  +
Sbjct: 23  SAEALARRLSTDLANGIATDKDAELPPLKRRDAYGSNRLPERAPKSFWALVREAFQDRTM 82

Query: 82  LVLFISMVITLAIR---------------------DWISXXXXXXXXXXXXXXXSYQEYK 120
           L+L  + V++  +                      DWI                +  +Y+
Sbjct: 83  LLLTGAAVVSFTLGIYEVLTQPPELDPEGNPITQVDWIEGLAIMMAVLVVVLVSAANDYQ 142

Query: 121 ASKTMNSL-KSLSTPSAHVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLI--ECVN 177
                  L +        V+RD  +  I    L+ GDL  ++ GD VPAD  L+  EC  
Sbjct: 143 KELQFQQLNRKREDRQVVVVRDAAESLISIHNLLVGDLLKLQTGDVVPADCVLVRGEC-- 200

Query: 178 FETDEALLTGES-----LPIAKEASQVYPATEDTPVGDRLN---------------LAFA 217
            ETDE+ LTGES     LP+A +A + + A     +GD                  +  +
Sbjct: 201 -ETDESALTGESNTIKKLPLA-DALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLIS 258

Query: 218 SSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNS------LISK--DENKTFWANAGITL 269
            S V  G A+ IV   G+N+  GK   SLK D+        +S+  D    +   A ITL
Sbjct: 259 GSRVLSGLASAIVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITL 318

Query: 270 AATI-GSFL-------GTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAI 321
              +   +L       G     P   K SK                          ++ I
Sbjct: 319 FVVLFARYLSYILPSGGKYHDLPPAEKGSKFM------------------------DIFI 354

Query: 322 YAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLT 381
            AI V V  +P  L + +T+ ++     M     +VR L S E +G+   VCSDKTGTLT
Sbjct: 355 TAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLT 414

Query: 382 QGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKN 441
           +  M V +  +   G   +       DP+   +    + S           V   T+F+N
Sbjct: 415 ENIMTVVRGTLGRAGFDDIGA-----DPSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFEN 469

Query: 442 KFYNDKLPAGLNS-------KLFLNWLKTAA----------LANIAHVYQDPETEEWKAH 484
           K Y D  P   NS       +L     +T            LA+ A   Q+P        
Sbjct: 470 KDYKD--PNNYNSIDDSQPRRLIRRITQTLQKKKPDDEENLLAHAAEGRQEPYI------ 521

Query: 485 GDPTEIAIQVFAHK-LDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDS 543
           G  TE A+   A K   +   AL                 EK  +VE   + I   PF+S
Sbjct: 522 GSKTETALLSLARKSFGLKFGALQSFRGHP----------EKLPTVETIVQII---PFES 568

Query: 544 SIKRMSAVYVSLD-----EDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKE 598
           S ++ SA+ V L+     E    R++ KGA E V   CT  L + CNE  ++ + ++ K+
Sbjct: 569 S-RKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACT--LKNVCNEGISE-IDQKSKD 624

Query: 599 EVFKNVETLSSEGLRVLAFATKSFT----------------ESQALKVSEDLRKNRDFVE 642
           ++ + + +L+ + LR ++ A   F                 E+ A+K+ +  + + +   
Sbjct: 625 DIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLIDPKKPHLE--- 681

Query: 643 SDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYH 702
             L    +VGI DP R+    +V Q  KAG+ V M+TGD   TAKAIA+  GIL      
Sbjct: 682 -GLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSS---- 736

Query: 703 YPKEVVDSM-VMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMT 761
             K + DS   M    F +L+D E   +L    V+AR +P+ K  ++ AL    +  A+T
Sbjct: 737 --KSLNDSACAMEGPAFRKLSDSERKRILPKLRVLARSSPEDKKILVRALKEMGEVVAVT 794

Query: 762 GDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKF 821
           GDG ND+P+LK A+VG +MGI G++VA++ASDI+L  D+F++I+NA++ GR ++ +I+KF
Sbjct: 795 GDGTNDAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKF 854

Query: 822 VLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLGLEKSAPD 881
           +   L  NV  A+ L      +  D  SV  L+ V++LW+ ++     A+ L  +K  P+
Sbjct: 855 IQFQLIVNVT-AVLLTFVTSVISSDVKSV--LTAVQLLWVNLIMDTLAALALATDKPDPN 911

Query: 882 IMEKEPQDSKAGIF---TWEIILDMLI 905
           IM+++P+     +    TW++I+   I
Sbjct: 912 IMDRKPKGRSTPLITPSTWKMIIGQAI 938

>Kwal_47.17547
          Length = 1240

 Score =  231 bits (590), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 245/969 (25%), Positives = 421/969 (43%), Gaps = 165/969 (17%)

Query: 35  LETDLQAGLRSAE----ATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVI 90
           L+TD  AGL  A+     T R   YG+N +       F  +      + ++++L ++ V+
Sbjct: 61  LKTDRNAGLTIADEDITQTERYQLYGDNRIPQRKPKSFLQLAWIAFQDRIMILLTVAAVV 120

Query: 91  TLAIR---------------------DWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLK 129
           + A+                      DW+                S  +Y+     + L 
Sbjct: 121 SFALGLYEVLGQPPEHDAEGKKITKVDWVEGVAIMIAVLVVILVGSANDYQKELQFSKLN 180

Query: 130 SLSTP-SAHVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGE 188
                    V+R+G++  I    ++ GD+  ++ GD VPAD  L++  + E DE+ LTGE
Sbjct: 181 DKKNDREVIVLRNGDEHLISIHDILVGDILSLQTGDVVPADCILVKG-SCECDESALTGE 239

Query: 189 SLPIAKEASQV-------YPATE-----DTPVGDRLN--LAFASSTVSKGRATGIVVKTG 234
           S  I K A  V         AT+      TP  +++   +  + S +  G    +V   G
Sbjct: 240 SATIKKAAIDVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSVG 299

Query: 235 LNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFL-----------GTTTGT 283
           +N+  G+   +LK +       E     AN+ I++  +  + L               G 
Sbjct: 300 VNSMHGRTLMALKVEAETTPLQERLDSLANS-ISVYGSAAALLLFFILFMRFLANLKKGG 358

Query: 284 PLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITM 343
            LH                        QK      + I  I V V  +P  L + +T+ +
Sbjct: 359 ELH-------------------DLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLAL 399

Query: 344 SVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNS 403
           +     MA    +VR L + E +G+   VCSDKTGTLT+ +M V + ++ S    T  + 
Sbjct: 400 AFATTRMAKDGNLVRVLRACETMGSATAVCSDKTGTLTENRMTVVKGFLGS----TFFDE 455

Query: 404 SNPFDPTDGGIEL---IPRFSPHQYKHDSTEDVGI-ITSFKNK-FYNDKL----PAGLNS 454
           +    P+D   ++   I      + K D   ++ +  T+F+NK    DK+    P     
Sbjct: 456 AESVGPSDSETDVDLAIANECSEELKKDVLTNITLNSTAFENKENEEDKVSNENPFHKPR 515

Query: 455 KLFLNWL---KTAALANIAHVYQDPETEEWKAH--GDPTEIAIQVFAHKLDMPRNALTXX 509
           K    W    K+   A    + ++   ++ K    G  TE A+  FA K           
Sbjct: 516 KSLFPWSRNNKSKKPATAKELVENAAADQPKEPFLGSKTETALLAFAQK----------- 564

Query: 510 XXXXXXXXXXXXLGEKTSSVEPHY----------KHIAEFPFDSSIKRMSAVYVSLDEDN 559
                       LG +      HY          K +   PF+SS ++   + V   ++ 
Sbjct: 565 -----------NLGMQNLH---HYRDEPDCLGIEKIVQIIPFESS-RKWGGIVVKY-KNG 608

Query: 560 AHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFAT 619
            HR + KGA E +L  C   +    ++S    ++++D +E  + +  L++E LR ++ A 
Sbjct: 609 LHRFYIKGAAELLLRRC---MQKRASDSKLTLISQKDFDEESQTITNLAAEALRAISLAH 665

Query: 620 KSFT------------ESQALKVSEDLRKNRDFVESD------------LIFQGLVGIYD 655
           + +             E +    S DL    +   SD            ++  G+VGI D
Sbjct: 666 RDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQELVSPMVLDGIVGIQD 725

Query: 656 PPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTA 715
           P R+    +V+Q  KAG+ V M+TGD   TA AIA++  IL       P+       M  
Sbjct: 726 PLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQAENPESS-----MEG 780

Query: 716 AQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKAN 775
            +F +L+++E   +L    V+AR +P+ K  +++ L +     A+TGDG ND+P+LK A+
Sbjct: 781 PRFRKLSNKERVRILPNLRVLARSSPEDKRILVETLKKMGDVVAVTGDGTNDAPALKLAD 840

Query: 776 VGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALY 835
           VG +MGI G++VA++ASDI+L  D+F++I+NA++ GR +S +I+KF+   L  NV  A+ 
Sbjct: 841 VGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVSTSIKKFIQFQLTVNVT-AVV 899

Query: 836 LMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIF 895
           L         +  SV  L+ V++LW+ ++     A+ L  +K   +I+E++P+  +A + 
Sbjct: 900 LTFVSAVASSEEASV--LTAVQLLWVNLIMDTLAALALATDKPDENILERKPKGREAVLI 957

Query: 896 ---TWEIIL 901
              TW++IL
Sbjct: 958 TVSTWKMIL 966

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score =  219 bits (557), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 245/951 (25%), Positives = 413/951 (43%), Gaps = 137/951 (14%)

Query: 35  LETDLQAGLRSAEA----TARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVI 90
           L+TD + GL  A+     TAR  ++G N + + +   F  ++     +  ++VL ++ VI
Sbjct: 58  LKTDKKNGLALADEEVRETARCRRFGANRVPERTARGFLRLMWEAFKDKTMIVLMVAAVI 117

Query: 91  TLAIR---------------------DWISXXXXXXXXXXXXXXXSYQEYKASKTMNSL- 128
           + ++                      D++                +  +Y+  +    L 
Sbjct: 118 SFSLGLYEAIGQPPELDDDGTPMAQVDYVEGLAIMAAVAVVVLVTAANDYQKERQFARLN 177

Query: 129 KSLSTPSAHVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGE 188
           +        V+R+G+   I    L+ GDL  ++ GD VP D  L+E    E DE+ +TGE
Sbjct: 178 RKKEDTEVVVVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEG-KCECDESGITGE 236

Query: 189 SLPIAK----EASQVY-PATEDTP---VGDRLN--------LAFASSTVSKGRATGIVVK 232
           S  I K     + QVY     D P   +G   N        +  + S +  G    +V  
Sbjct: 237 SDTIKKVSLAMSLQVYRTVAADNPSADIGSSDNGHSLVPDPMLISGSKLLSGIGHAVVTA 296

Query: 233 TGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKX 292
            G ++  GK+  +LK +       E     A+  I++  ++ +FL         R LS  
Sbjct: 297 VGPHSVHGKMMLALKSEPETTPLQERLNTLAD-DISIYGSVAAFLLFVV--LFLRFLSYL 353

Query: 293 XXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMAT 352
                           + +K     ++ I A+ V V  +P  L + +T+ ++     M  
Sbjct: 354 PKGRLYHDLP------SARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTK 407

Query: 353 RNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDG 412
              +VR L + E +G+   VCSDKTGTLTQ KM+V + ++ S     +S  SN       
Sbjct: 408 DGNLVRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFLGSSHFDDISEDSNCAQSD-- 465

Query: 413 GIELIPRFSPHQYKHDSTEDVGI-ITSFKNKFYNDKL----PAGLNSKLFLNWLKTAALA 467
              L    S H   +D   ++ +  T+F+NK   D +    P     +    W +     
Sbjct: 466 --ALRQDMSQHTL-NDILANIALNSTAFENKQVADPVITENPYHKPRRSLFPWSR----- 517

Query: 468 NIAHVYQDPETEEWKAH----GDPTEIAIQVFAHKLDMPRNALTXXXXXXXXXXXXXXLG 523
           N    Y  P+    ++     G  TE A+      L + + +L                 
Sbjct: 518 NNKPKYPAPKDSSVQSAEFFIGSKTEAAL------LSLAKGSLGLESLQALRD------- 564

Query: 524 EKTSSVEPHYKHIAEF----PFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKW 579
                 +PH+  IA      PF+SS ++ + + V L + N +R F KGA E +   C   
Sbjct: 565 ------DPHHIGIASIVQMIPFESS-RKWAGLVVRLVDGN-YRFFIKGASETIFKSCHYM 616

Query: 580 LPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTE------------SQA 627
                +  D   ++ +   E+F  +  L+S+ LR ++ A K FT+            S  
Sbjct: 617 R---SSNDDVIKLSPQKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDP 673

Query: 628 LKVSEDLRKNRDFV-------------ESDLIFQGLVGIYDPPRQETAGAVKQFHKAGIN 674
              S DL    ++V              S LI  G+VGI+DP R     +VK   ++G+ 
Sbjct: 674 STASPDLLLGDEYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVT 733

Query: 675 VHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPL 734
           V M+TGD   T +AIA+  GIL  + Y           M    F +L+  ++ +      
Sbjct: 734 VRMITGDNITTGRAIARACGILSESEY-----ADHECAMEGPVFRKLSRRQMMDAAPKLK 788

Query: 735 VIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDI 794
           V+AR +P+ K   +D L +  +  A+TGDG ND+P+L  A+VG +MGI+G+ VA++ASDI
Sbjct: 789 VLARSSPEDKRIFVDILKKMNEVVAVTGDGTNDAPALTLADVGFSMGISGTGVAREASDI 848

Query: 795 VLSDDNFASILNAVEEGRRMSDNIQKFV-LQLLAENVAQALYLMIGLCFLDEDRLSVFPL 853
           +L  D+F SI+NA++ GR +S +I+KF+  QL     A  L  +  +   +E+ +    L
Sbjct: 849 ILMTDDFTSIVNAIKWGRCVSLSIKKFIQFQLTVNITAVTLTCVTAVTSTEENPV----L 904

Query: 854 SPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEP--QDSK-AGIFTWEIIL 901
           + V++LW+ ++     A+ L  +K  P I+E+ P  +DS    + TW++IL
Sbjct: 905 TAVQLLWVNLIMDTLAALALATDKPDPHILERIPTGRDSPLIAVSTWKMIL 955

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  218 bits (554), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 240/962 (24%), Positives = 419/962 (43%), Gaps = 138/962 (14%)

Query: 22   AFHTVSARDTAHV---LETDLQAGL----RSAEATARVSQYGENSLGDDSKIDFKSILLH 74
            AF+ V   D +++   L+TD   GL       E+  R   YG N + +     F  ++  
Sbjct: 98   AFNNVFDNDESNLYTYLQTDRTNGLTIQDEDIESLERTQVYGLNRIPERKGKSFLRLVWE 157

Query: 75   QICNAMILVLFISMVITLAIR---------------------DWISXXXXXXXXXXXXXX 113
               +  +++L ++ VI+ A+                      +W+               
Sbjct: 158  AFNDKTMILLTVAAVISFALGLYETLGQPPEYDPEGNEIVKVEWVEGVAIMIAVVVVVLV 217

Query: 114  XSYQEYKASKTMNSL-KSLSTPSAHVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRL 172
             +  +Y+       L K        VIR+G++  I    L+ GD+  ++ GD VPAD  L
Sbjct: 218  GAINDYQKELQFAKLNKKKDDRDVVVIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVL 277

Query: 173  IECVNFETDEALLTGESLPIAKEASQVYPATEDTP---------------VGDRLN--LA 215
            I   + E DE+ LTGES  I K A  + PA E                  VG+++   L 
Sbjct: 278  ISG-SCECDESALTGESDTIKKVA--LKPALEKYKQIFEKDPTIDIGSHGVGEKVPDPLL 334

Query: 216  FASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWA-NAGI-----TL 269
             + S +  G    ++   G N+  G+I  +LK ++      E  +  A N  I      L
Sbjct: 335  ISGSKLLSGIGNAVITSVGENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAAL 394

Query: 270  AATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVS 329
               I  F+   T  P  +K                      QK      + I A+ V V 
Sbjct: 395  VLFIILFIRFLTYLPNGKKYHDLP---------------PAQKGSKFMNIFITAVTVIVV 439

Query: 330  MIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQ 389
             +P  L + +T+ ++     M     +VR L + E +G+   +CSDKTGTLT+ +M V +
Sbjct: 440  AVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATAICSDKTGTLTENRMTVVK 499

Query: 390  AWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGII-------TSFKNK 442
             +  + G    +++ N         + I      +   D++    I+       T+F+NK
Sbjct: 500  GFAGNLGFDDTTHAEN---------KEIKSAVVLRSNCDASLLTDILSNISLNSTAFENK 550

Query: 443  FYN------DKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFA 496
                     D+ P   + K    W +    + +         E++   G  TE A+  FA
Sbjct: 551  ESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQLIADAMKENDEQF--LGSKTETALLAFA 608

Query: 497  HKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLD 556
             K                       L  K S +    K +   PF+SS ++  A+ V L 
Sbjct: 609  QK--------------SLGMKDVHKLRTKPSDLGID-KVVQVIPFESS-RKWGAIAVQLA 652

Query: 557  EDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLA 616
            ++  +R + KGA E +L  C+       +++   PM ++  +E FK ++ ++S  LR ++
Sbjct: 653  DNKGYRFYAKGAAEILLKVCSN---QRNSDNSIVPMNQDLYDESFKKIQDMASHALRTIS 709

Query: 617  FATKSFTE---------SQALKVSEDLRKNRDFVESDLIFQGL-----VGIYDPPRQETA 662
               + F E         +     S DL    +    +L  +G+     VG+ DP R+   
Sbjct: 710  LVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDAMVGLQDPLREGVK 769

Query: 663  GAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLT 722
             +V+Q  +AG+ V M+TGD   TA+AI++   IL    Y+ P+       M    F +L 
Sbjct: 770  ESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGYNDPE-----CAMEGPTFRKLP 824

Query: 723  DEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGI 782
             +++  ++    V+AR +P+ K  +++ L +  +  A+TGDG ND+P+LK A+VG +MGI
Sbjct: 825  YKKMLRVIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVGFSMGI 884

Query: 783  NGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCF 842
            +G++VA++ASDI+L  D+F +I+NA++ GR +S +I+KF+   L  N+  A+ L      
Sbjct: 885  SGTEVAREASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNIT-AVILTFVSAV 943

Query: 843  LDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKA---GIFTWEI 899
               +  SV  L+ V++LW+ ++     A+ L  +K    I++++P+   A    + TW++
Sbjct: 944  ASAEETSV--LTAVQLLWVNLIMDTLAALALATDKPDEFILDRKPKGRDAPLIAVSTWKM 1001

Query: 900  IL 901
            IL
Sbjct: 1002 IL 1003

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score =  208 bits (530), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 213/386 (55%), Gaps = 33/386 (8%)

Query: 536 IAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEE 595
           I E PF+S  K M+    ++D ++   V+ KGAFE++++    ++         KP    
Sbjct: 460 INEIPFNSKRKFMAVK--TIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKP---N 514

Query: 596 DKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYD 655
           DK  +      L+SEGLR LAFA    + +       D   N D VE  L F GL+ + D
Sbjct: 515 DKAIINDAAVALASEGLRTLAFAELEVSATHG-----DKEFNEDMVEG-LTFTGLIAMND 568

Query: 656 PPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTA 715
           PPR     A+++  +  ++V M+TGD   TA +IA+++GI        P    +  V++ 
Sbjct: 569 PPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGI--------PVINPEYSVLSG 620

Query: 716 AQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKAN 775
            + DQ+TD+++ +++    V AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK A+
Sbjct: 621 DKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLAD 680

Query: 776 VGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALY 835
           +G++MG  G+DVAK+ASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    
Sbjct: 681 IGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSL 740

Query: 836 LMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIF 895
           + I       +     PL+ +++LWI ++    PA  LG+E    ++M K P+     I 
Sbjct: 741 VAISTSLKLPN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDKIL 795

Query: 896 TWEIILDMLIYGTWMAACCLACFITV 921
           T  ++  +LI          ACFI V
Sbjct: 796 TDAVLKRVLIS---------ACFIIV 812

 Score =  161 bits (407), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 117/379 (30%), Positives = 172/379 (45%), Gaps = 39/379 (10%)

Query: 23  FHTVSARDTAHVLETDLQAGLRS-AEATARVSQYGENSLGDDSKIDF-KSILLHQICNAM 80
           + TVS  DT   L TD   GL + +E   R S +G N +  D K+   K  L   I + +
Sbjct: 33  YCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPL 92

Query: 81  ILVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIR 140
           IL+L  S VI+  + +                    QEYK+ K++ +L  L     H+ R
Sbjct: 93  ILLLIGSAVISFLMGNIDDSISIALAIIIVVTVGFVQEYKSEKSLEALNKLVPAECHLTR 152

Query: 141 DGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVY 200
            G    + +  LVPGDL   K GD +PADLR++E ++   DE+ LTGE+ P+ K +  V 
Sbjct: 153 SGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVD 212

Query: 201 PATED------TPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLIS 254
           P           PVGDR  + F  + V +G   GIV+ TG +T  G + + + G    I 
Sbjct: 213 PKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSG----ID 268

Query: 255 KDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFV 314
           K +                         TPL   + K                       
Sbjct: 269 KPK-------------------------TPLQTAMDKLGQDLSYMSFVLIGIICLIGIIQ 303

Query: 315 VNKEVAIYAICV--AVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDV 372
               + ++ I V  AV+ IP  L +++T+T+++G   MA R  +VR+L S+E LG+VN +
Sbjct: 304 GRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 363

Query: 373 CSDKTGTLTQGKMIVKQAW 391
           CSDKTGTLT   M V + W
Sbjct: 364 CSDKTGTLTANHMTVSKIW 382

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score =  179 bits (454), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 205/386 (53%), Gaps = 32/386 (8%)

Query: 534 KHIAEFPFDSSIKRMSAVYVSLDEDNA---HRVFTKGAFERV-LDCCTKWLPDGCNESDA 589
           K +   PF+SS K    V    +  N    +R F KGA E V  +C  K   D   E   
Sbjct: 608 KVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEE-- 665

Query: 590 KPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNR-------DFV- 641
             + E++K+E    ++ L+S+ LR ++ A K F E  +    E LR          D + 
Sbjct: 666 --INEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWP-PEQLRDKDSPNIAALDLLF 722

Query: 642 --ESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRN 699
             +  LI  GL+GI DP R     +V+Q  +AG+ V M+TGD   TAKAIA+   IL  +
Sbjct: 723 NSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTD 782

Query: 700 LYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCA 759
           +            M   +F +LT  E   +L    V+AR +P+ K  +++ L       A
Sbjct: 783 ISSEAYSA-----MEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVA 837

Query: 760 MTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQ 819
           +TGDG ND+P+LK A+VG +MGI+G++VA++ASDI+L  D+F++I+NA++ GR +S +I+
Sbjct: 838 VTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIK 897

Query: 820 KFV-LQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLGLEKS 878
           KF+  QL+    A  L  +  +   DE  +    L+ V++LWI ++     A+ L  +K 
Sbjct: 898 KFIQFQLIVNITAVILTFVSSVASSDETSV----LTAVQLLWINLIMDTLAALALATDKP 953

Query: 879 APDIMEKEPQDSKAGIF---TWEIIL 901
            P+IM+++P+     +    TW++IL
Sbjct: 954 DPNIMDRKPRGRSTSLISVSTWKMIL 979

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 151/407 (37%), Gaps = 61/407 (14%)

Query: 35  LETDLQAGLRSAE-----ATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMV 89
           L+TD  AG+   E      T R   YG+NSL +     F  ++     +  + +L ++ V
Sbjct: 66  LKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLLTVAAV 125

Query: 90  ITLAIR---------------------DWISXXXXXXXXXXXXXXXSYQEYKASKTMNSL 128
           ++  +                      DWI                +  +Y+       L
Sbjct: 126 VSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKL 185

Query: 129 -KSLSTPSAHVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLI--ECVNFETDEALL 185
            K        VIR+  +  I    ++ GD+  ++ GD VPAD  +I  +C   E DE+ +
Sbjct: 186 NKKKENRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKC---EADESSI 242

Query: 186 TGESLPIAK-----------EASQVYPATEDTPV--------GDRLN--LAFASSTVSKG 224
           TGES  I K           + + +       P+        G+++   +  + S +  G
Sbjct: 243 TGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSG 302

Query: 225 RATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFLGTTTGTP 284
              G++   G+N+  G+   SL          E ++      ++  A   S  G  +   
Sbjct: 303 LGRGVITSVGINSVYGQTMTSLNA--------EPESTPLQLHLSQLADNISVYGCVSAII 354

Query: 285 LHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMS 344
           L   L                     QK      + I +I V V  +P  L + +T+ ++
Sbjct: 355 LFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALA 414

Query: 345 VGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAW 391
                M     +VR L S E +G+   VCSDKTGTLT+  M V + +
Sbjct: 415 FATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGF 461

>Scas_297.1
          Length = 800

 Score =  132 bits (331), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 88/246 (35%), Positives = 141/246 (57%), Gaps = 20/246 (8%)

Query: 680 GDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARC 739
           GD   TA+AIA+   IL    Y  P+  ++       +F  LT +E   +L    V+AR 
Sbjct: 1   GDNILTARAIARNCNILSEETYLIPECAIE-----GPKFRTLTKQERIKMLPNLRVMARS 55

Query: 740 APQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDD 799
           +P+ K  +++ L       A+TGDG ND+P+LK A+VG +MGI+G++VA++ASDI+L  D
Sbjct: 56  SPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTD 115

Query: 800 NFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVL 859
           +FA+I++A++ GR +S +I+KF+   L  N+  A+ L        ED  SV  L+ V++L
Sbjct: 116 DFAAIVDAIKWGRCVSISIKKFIQFQLIVNIT-AVILAFVSSIASEDETSV--LTAVQLL 172

Query: 860 WIIVVTSCFPAMGLGLEKSAPDIMEKEPQD-SKAGIF--TWEIILDMLIYGTWMAACCLA 916
           WI ++     A+ L  +K  P+IM+++P+  S   IF  TW++IL         +  CL 
Sbjct: 173 WINLIMDTLAALALATDKPDPNIMDRKPRGRSTPLIFPSTWKMIL---------SQSCLQ 223

Query: 917 CFITVI 922
             +T I
Sbjct: 224 LIVTFI 229

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 20/129 (15%)

Query: 138 VIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPI----- 192
           VIR+  +       L+ GD+  ++ GD +PAD  L+E    E DE+ +TGES  I     
Sbjct: 602 VIRNSQELLTSIHNLLVGDIITLQTGDVIPADGVLVEG-QCEVDESSITGESDTIKKVKV 660

Query: 193 ------------AKEASQVYPATEDTPVGDRLN--LAFASSTVSKGRATGIVVKTGLNTE 238
                        K   Q+      TP GD++   +  + S +  G    I+   G N+ 
Sbjct: 661 FNALKTFDVINEGKSNDQILDIGFKTPNGDKIPDCMLISGSKLLSGLGKAIITSVGTNSI 720

Query: 239 IGKIAQSLK 247
            G+   +LK
Sbjct: 721 HGRTMMALK 729

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score =  125 bits (313), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 103/362 (28%), Positives = 162/362 (44%), Gaps = 48/362 (13%)

Query: 33  HVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVITL 92
            +L+TD   GL S E T R  +YG N + ++++  F   L+  I   +  V+  + ++  
Sbjct: 59  ELLQTDPSYGLTSDEVTKRRKKYGLNQMSEETENLFVKFLMFFI-GPIQFVMEAAAILAA 117

Query: 93  AIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQL 152
            + DW+                  QEY+A   ++ LK     SA VIRDGN   +PS ++
Sbjct: 118 GLEDWVDFGVICGLLFLNAAVGFIQEYQAGSIVDELKKTLANSAVVIRDGNLVEVPSNEV 177

Query: 153 VPGDLCVVKAGDTVPADLRLI-ECVNFETDEALLTGESLPIAKEASQVYPATEDTPVGDR 211
           VPGD+  ++ G  +PAD RL+ E    + D++ +TGESL +            D   GD 
Sbjct: 178 VPGDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGESLAV------------DKRFGDS 225

Query: 212 LNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAA 271
               F+SSTV +G A  IV  TG              D++ + +       A AG     
Sbjct: 226 ---TFSSSTVKRGEAFMIVTATG--------------DSTFVGRAAALVNKAAAGS---- 264

Query: 272 TIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAI--YAICVAVS 329
             G F     G      +                       +  NK V I  Y + + + 
Sbjct: 265 --GHFTEVLNGIGTILLILVIVTLLLV---------WVASFYRTNKIVRILRYTLAITIV 313

Query: 330 MIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQ 389
            +P  L  V+T TM+VGA  +A +  +V+KL ++E+L  V  +CSDKTGTLT+ K+ + +
Sbjct: 314 GVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE 373

Query: 390 AW 391
            +
Sbjct: 374 PY 375

 Score =  105 bits (263), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 87/314 (27%), Positives = 142/314 (45%), Gaps = 42/314 (13%)

Query: 533 YKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPM 592
           YK +   PFD   K+++A+  S   +    +  KGA   VL              +  P+
Sbjct: 424 YKLLEFHPFDPVSKKVTAIVES--PEGERIICVKGAPLFVLKTV----------EEEHPI 471

Query: 593 TEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVG 652
            E+ +E     V  L+S G R L  A K                     E      G++ 
Sbjct: 472 PEDVRENYENKVAELASRGFRALGVARKRG-------------------EGHWEILGVMP 512

Query: 653 IYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMV 712
             DPPR +TA  V +    G+ V MLTGD  G AK   +++G L  N+Y+  +  +    
Sbjct: 513 CMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAERLGLGGGG 571

Query: 713 -MTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSL 771
            M  ++      E  D         A   PQ K  +++ L +R    AMTGDGVND+PSL
Sbjct: 572 DMPGSELADFV-ENADGF-------AEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSL 623

Query: 772 KKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA 831
           KKA+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+  +A ++ 
Sbjct: 624 KKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLH 682

Query: 832 QALYLMIGLCFLDE 845
             ++L + +  L+ 
Sbjct: 683 LEIFLGLWIAILNR 696

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  120 bits (300), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 99/373 (26%), Positives = 164/373 (43%), Gaps = 48/373 (12%)

Query: 20  HPAFHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNA 79
           H     V  +D    L TD   GL S E   R  +YG N + ++++      L+      
Sbjct: 98  HAGQRVVPEKD----LSTDPAYGLTSDEVARRRKKYGLNQMAEENESLIVKFLMF-FVGP 152

Query: 80  MILVLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVI 139
           +  V+  + ++   + DW+                  QE++A   ++ LK     +A VI
Sbjct: 153 IQFVMEAAAILAAGLSDWVDVGVICALLLLNASVGFIQEFQAGSIVDELKKTLANTATVI 212

Query: 140 RDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLI-ECVNFETDEALLTGESLPIAKEASQ 198
           RDG    IP+ ++VPG++  +++G   PAD R++ E    + D++ +TGESL   K    
Sbjct: 213 RDGQLIEIPANEVVPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKH--- 269

Query: 199 VYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDEN 258
                     GD +   F+SSTV  G A  +V  TG NT +G+ A +L G  S +     
Sbjct: 270 ---------YGDEV---FSSSTVKTGEAFMVVTATGDNTFVGR-AAALVGQASGVEGHFT 316

Query: 259 KTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKE 318
           +       I L   I + L   T    +R +                             
Sbjct: 317 EVLNGIGIILLVLVIATLLLVWTAC-FYRTVGIV-------------------------S 350

Query: 319 VAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTG 378
           +  Y + + +  +P  L  V+T TM+VGA  +A +  +V+KL ++E+L  V  +CSDKTG
Sbjct: 351 ILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTG 410

Query: 379 TLTQGKMIVKQAW 391
           TLT+ K+ + + +
Sbjct: 411 TLTKNKLSLHEPY 423

 Score =  107 bits (266), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 90/313 (28%), Positives = 142/313 (45%), Gaps = 42/313 (13%)

Query: 533 YKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPM 592
           YK +   PFD   K+++AV  S   +    V  KGA   VL            E D  P+
Sbjct: 472 YKVLEFHPFDPVSKKVTAVVES--PEGERIVCVKGAPLFVLKTV---------EED-HPI 519

Query: 593 TEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVG 652
            E+  E     V  L+S G R L  A K                     E      G++ 
Sbjct: 520 PEDVHENYENKVAELASRGFRALGVARKRG-------------------EGHWEILGVMP 560

Query: 653 IYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMV 712
             DPPR +TA  + +    G+ + MLTGD  G AK   +++G L  N+Y+  +  +    
Sbjct: 561 CMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLG-LGTNIYNAERLGLGGGG 619

Query: 713 -MTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSL 771
            M  ++      E  D         A   PQ K R+++ L  R    AMTGDGVND+PSL
Sbjct: 620 DMPGSELADFV-ENADGF-------AEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSL 671

Query: 772 KKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA 831
           KKA+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+  +A ++ 
Sbjct: 672 KKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLH 730

Query: 832 QALYLMIGLCFLD 844
             ++L + +  L+
Sbjct: 731 LEIFLGLWIAILN 743

>Kwal_47.17522
          Length = 899

 Score =  119 bits (299), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 101/363 (27%), Positives = 164/363 (45%), Gaps = 50/363 (13%)

Query: 33  HVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVITL 92
            +L+TD   GL S E T R  +YG N + ++S+      L+  I   +  V+  + ++  
Sbjct: 59  ELLQTDPSYGLTSDEVTKRRKKYGLNQMAEESESLVVKFLMFFI-GPIQFVMEAAAILAA 117

Query: 93  AIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQL 152
            + DW+                  QEY+A   ++ LK     SA V+RDGN   IP+ ++
Sbjct: 118 GLEDWVDFGVILGLLFLNAGVGFIQEYQAGSIVDELKKSLANSAVVVRDGNLVEIPANEV 177

Query: 153 VPGDLCVVKAGDTVPADLRLI--ECVNFETDEALLTGESLPIAKEASQVYPATEDTPVGD 210
           VPGD+  ++ G  + AD RL+  EC   + D++ +TGESL +            D   GD
Sbjct: 178 VPGDIMQLEDGVVICADGRLVTEECF-LQIDQSAITGESLAV------------DKHYGD 224

Query: 211 RLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLA 270
                F+SSTV +G    IV  TG NT +G+ A       +L+++              A
Sbjct: 225 T---TFSSSTVKRGEGFMIVTATGDNTFVGRAA-------ALVNQ-------------AA 261

Query: 271 ATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSM 330
              G F     G      +                       +  ++ V I    + +++
Sbjct: 262 GDQGHFTEVLNGIGTILLVLVIVTLLLVWTACF---------YRTDRIVRILRYTLGITI 312

Query: 331 I--PSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVK 388
           I  P  L  V+T TM+VGA  +A +  +V+KL ++E+L  V  +CSDKTGTLT+ K+ + 
Sbjct: 313 IGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLH 372

Query: 389 QAW 391
           + +
Sbjct: 373 EPY 375

 Score =  106 bits (264), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 90/314 (28%), Positives = 144/314 (45%), Gaps = 42/314 (13%)

Query: 533 YKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPM 592
           YK +   PFD   K+++AV  S   +    +  KGA   VL            E D  P+
Sbjct: 424 YKVLDFHPFDPVSKKVTAVVES--PEGERIICVKGAPLFVLKTV---------EED-HPI 471

Query: 593 TEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVG 652
            E+  E     V  L+S G R L  A K                     E      G++ 
Sbjct: 472 PEDVHENYENKVAELASRGFRALGVARKRG-------------------EGHWEILGVMP 512

Query: 653 IYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMV 712
             DPPR +TA  V +  + G+ V MLTGD  G AK   +++G L  N+Y+  +  +    
Sbjct: 513 CMDPPRDDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAERLGLGGGG 571

Query: 713 -MTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSL 771
            M  ++      E  D         A   PQ K  +++ L +R    AMTGDGVND+PSL
Sbjct: 572 DMPGSELADFV-ENADGF-------AEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSL 623

Query: 772 KKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA 831
           KKA+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+  +A ++ 
Sbjct: 624 KKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLH 682

Query: 832 QALYLMIGLCFLDE 845
             ++L + +  L++
Sbjct: 683 LEIFLGLWIAILNQ 696

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score =  119 bits (298), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 103/372 (27%), Positives = 167/372 (44%), Gaps = 49/372 (13%)

Query: 24  HTVSARDTAH-VLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMIL 82
           HT SAR      L+TD   GL S E   R  +YG N + D+ +      ++      +  
Sbjct: 52  HTGSARVVPEEYLQTDPSYGLTSDEVAHRRKKYGLNQMADERESMIVKFVMF-FVGPIQF 110

Query: 83  VLFISMVITLAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDG 142
           V+  + ++   + DW+                  QE++A   ++ LK      A VIRDG
Sbjct: 111 VMEAAAILAAGLSDWVDFGVICGLLMLNACVGFIQEFQAGSIVDELKKTLANVAVVIRDG 170

Query: 143 NDETIPSKQLVPGDLCVVKAGDTVPADLRLI-ECVNFETDEALLTGESLPIAKEASQVYP 201
               +P+ ++VPGD+  ++ G  +PAD RL+ E    + D++ +TGESL +         
Sbjct: 171 QLVEVPANEVVPGDILQLEDGTIIPADGRLVTENCFLQVDQSAITGESLAV--------- 221

Query: 202 ATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTF 261
              D   GD+    F+SSTV +G A  +V  TG NT +G+ A       +L++K      
Sbjct: 222 ---DKGYGDQ---TFSSSTVKRGEAFMVVTATGDNTFVGRAA-------ALVNK------ 262

Query: 262 WANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAI 321
            A+ G       G F            L+                  A   +  +  V I
Sbjct: 263 -ASGG------QGHF---------TEVLNGIGILLLVLVIVTLLGVWAACFYRTDNIVKI 306

Query: 322 YAICVAVSMI--PSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGT 379
               + +++I  P  L  V+T TM+VGA  +A +  +V+KL ++E+L  V  +CSDKTGT
Sbjct: 307 LRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGT 366

Query: 380 LTQGKMIVKQAW 391
           LT+ K+ + + +
Sbjct: 367 LTKNKLSLHEPY 378

 Score = 95.5 bits (236), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 94/314 (29%), Positives = 143/314 (45%), Gaps = 42/314 (13%)

Query: 533 YKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPM 592
           YK I   PFD   K+++AV  S   +    V  KGA   VL            E D  P+
Sbjct: 427 YKVIEFHPFDPVSKKVTAVVES--PEGERIVCVKGAPLFVLKTV---------EED-HPI 474

Query: 593 TEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVG 652
            E+  E     V  L+S G R L  A K                     E      G++ 
Sbjct: 475 PEDVHENYENKVAELASRGFRALGVARKRG-------------------EGHWEILGVMP 515

Query: 653 IYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMV 712
             DPPR +TA  V +  + G+ V MLTGD  G AK   +++G L  N+Y+  +  +    
Sbjct: 516 CMDPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAERLGLGGGG 574

Query: 713 -MTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSL 771
            M  ++      E  D         A   PQ K ++++ L  R    AMTGDGVND+PSL
Sbjct: 575 DMPGSELADFV-ENADGF-------AEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSL 626

Query: 772 KKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA 831
           KKA+ GIA+    SD A+ A+DIV      ++I++A++  R++   +  +V+  +A ++ 
Sbjct: 627 KKADTGIAVE-GASDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLH 685

Query: 832 QALYLMIGLCFLDE 845
             L+L + +  L+ 
Sbjct: 686 LELFLGLWIIILNH 699

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  116 bits (291), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 97/360 (26%), Positives = 162/360 (45%), Gaps = 48/360 (13%)

Query: 35  LETDLQAGLRSAEATARVSQYGENSLGDDSK-IDFKSILLHQICNAMILVLFISMVITLA 93
           L+TD   GL S E   R  +YG N + D+ + +  K ++       +  V+  + ++   
Sbjct: 80  LQTDPSYGLTSDEVLKRRKKYGLNQMADEKESLVVKFVMF--FVGPIQFVMEAAAILAAG 137

Query: 94  IRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLV 153
           + DW+                  QE++A   ++ LK     +A VIRDG    IP+ ++V
Sbjct: 138 LSDWVDFGVICGLLMLNAGVGFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEVV 197

Query: 154 PGDLCVVKAGDTVPADLRLI-ECVNFETDEALLTGESLPIAKEASQVYPATEDTPVGDRL 212
           PGD+  ++ G  +P D R++ E    + D++ +TGESL +            D   GD+ 
Sbjct: 198 PGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAV------------DKHYGDQ- 244

Query: 213 NLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANA-GITLAA 271
              F+SSTV +G    +V  TG NT +G+ A  +   N       + T   N  GI L  
Sbjct: 245 --TFSSSTVKRGEGFMVVTATGDNTFVGRAAALV---NKAAGGQGHFTEVLNGIGIILLV 299

Query: 272 TIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMI 331
            + + L        +R                      T   V    +  Y + + +  +
Sbjct: 300 LVIATLLLVWTACFYR----------------------TNGIV---RILRYTLGITIIGV 334

Query: 332 PSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAW 391
           P  L  V+T TM+VGA  +A +  +V+KL ++E+L  V  +CSDKTGTLT+ K+ + + +
Sbjct: 335 PVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPY 394

 Score =  109 bits (273), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 93/313 (29%), Positives = 142/313 (45%), Gaps = 42/313 (13%)

Query: 533 YKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPM 592
           YK +   PFD   K+++AV  S   +    V  KGA   VL            E D  P+
Sbjct: 443 YKVLEFHPFDPVSKKVTAVVES--PEGERIVCVKGAPLFVLKTV---------EED-HPI 490

Query: 593 TEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVG 652
            E+  E     V  L+S G R L  A K                     E      G++ 
Sbjct: 491 PEDVHENYENKVAELASRGFRALGVARKRG-------------------EGHWEILGVMP 531

Query: 653 IYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMV 712
             DPPR +TA  V +    G+ V MLTGD  G AK   +++G L  N+Y+  +  +    
Sbjct: 532 CMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAERLGLGGGG 590

Query: 713 -MTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSL 771
            M  ++      E  D         A   PQ K R+++ L  R    AMTGDGVND+PSL
Sbjct: 591 DMPGSELADFV-ENADGF-------AEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSL 642

Query: 772 KKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA 831
           KKA+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+  +A ++ 
Sbjct: 643 KKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLH 701

Query: 832 QALYLMIGLCFLD 844
             ++L + +  LD
Sbjct: 702 LEIFLGLWIAILD 714

>Scas_710.41
          Length = 904

 Score =  112 bits (281), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 157/362 (43%), Gaps = 52/362 (14%)

Query: 35  LETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVITLAI 94
           L+TD   GL + E   R  +YG N + ++++ +F    L      +  V+  + ++   +
Sbjct: 67  LKTDPGIGLTTDEVVRRRKKYGLNQMKEENE-NFIVKFLMYFVGPIQFVMEAAAILAAGL 125

Query: 95  RDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLVP 154
            DW+                  QE++A   +  LK     +A VIRDG  + IP+ ++VP
Sbjct: 126 SDWVDFGVICGLLMLNASVGFIQEFQAGSIVEELKKTLANTARVIRDGTLQEIPANEIVP 185

Query: 155 GDLCVVKAGDTVPADLRLIECVNF-ETDEALLTGESLPIAKEASQVYPATEDTPVGDRLN 213
           GD+  +  G  +PAD RL+    F + D++ +TGESL +            D   GD   
Sbjct: 186 GDILELDEGTIIPADGRLVTENRFLQVDQSAITGESLAV------------DKNYGD--- 230

Query: 214 LAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATI 273
           + F+SSTV  G +  +V  TG              DN+ + +                  
Sbjct: 231 VTFSSSTVKTGTSVMVVTATG--------------DNTFVGR-----------------A 259

Query: 274 GSFLGTTTGTPLHRK--LSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMI 331
            + +G  +G   H    L+                      +  +  V I    + +++I
Sbjct: 260 AALVGEASGGQGHFTDILNDIGTILLVLVIITLLLVWTACFYRTDGIVMILRFTLGITII 319

Query: 332 --PSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQ 389
             P  L  V+T TM+VGA  +A +  +V+KL ++E+L  V  +CSDKTGTLT+ K+ + +
Sbjct: 320 GVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE 379

Query: 390 AW 391
            +
Sbjct: 380 PY 381

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 91/322 (28%), Positives = 147/322 (45%), Gaps = 42/322 (13%)

Query: 525 KTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGC 584
           K  +  P YK +   PFD   K+++AV  S + +    V  KGA   VL           
Sbjct: 422 KAMNALPKYKILEFHPFDPVSKKVTAVVKSPEGETITCV--KGAPLFVLKTV-------- 471

Query: 585 NESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESD 644
            E D  P+ E+  E     V  L+S G R L  A K               +   + E  
Sbjct: 472 -EED-HPVPEDVHENYENKVAELASRGFRSLGVARK---------------RGEGYWE-- 512

Query: 645 LIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYP 704
               G++   DPPR +TA  + +    G+ V MLTGD  G AK  ++++G L  N+Y+  
Sbjct: 513 --ILGVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLG-LGVNIYNAE 569

Query: 705 KEVVDSMV-MTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGD 763
           K  +     M  ++      E  D         A   PQ K ++++ L  R    AMTGD
Sbjct: 570 KLGLGGGGDMPGSELADFV-ENADGF-------AEVFPQHKYKVVEILQNRGYLVAMTGD 621

Query: 764 GVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVL 823
           GVND+PSLKKA+ GIA+    +D A+ A+DIV      ++I++ ++  R++   +  +V+
Sbjct: 622 GVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDGLKTSRQIFHRMYSYVV 680

Query: 824 QLLAENVAQALYLMIGLCFLDE 845
             +A ++   ++  + +  L+ 
Sbjct: 681 YRIALSLHLEIFFGLWIAILNR 702

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  110 bits (274), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 162/361 (44%), Gaps = 46/361 (12%)

Query: 33  HVLETDLQAGLRSAEATARVSQYGENSLGD-DSKIDFKSILLHQICNAMILVLFISMVIT 91
            +L+TD   GL S E + R  +YG N + + +  +  K ++       +  V+  + ++ 
Sbjct: 59  ELLQTDPSYGLTSDEVSRRRKKYGLNQMSEANESMILKFVMF--FVGPIQFVMEAAAILA 116

Query: 92  LAIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQ 151
             + +WI                  QE++A   +  LK     SA VIRDG+   IP+ +
Sbjct: 117 AGLEEWIDFGIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSAVVIRDGSLVEIPANE 176

Query: 152 LVPGDLCVVKAGDTVPADLRLI-ECVNFETDEALLTGESLPIAKEASQVYPATEDTPVGD 210
           +VPGD+  ++ G  +PAD R++ E    + D++ +TGESL +            D   GD
Sbjct: 177 VVPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAV------------DKRYGD 224

Query: 211 RLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLA 270
                F+SSTV +G    IV  TG +T +G+ A       +L++K       A+AG    
Sbjct: 225 A---TFSSSTVKRGEGFMIVTATGDSTFVGRAA-------ALVNK-------ASAG---- 263

Query: 271 ATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSM 330
              G F     G      +                        ++   +AI  + V    
Sbjct: 264 --SGHFTEVLNGIGTILLILVILTLLVVYVACFYRSIDIVT--ILRYTLAITVVGV---- 315

Query: 331 IPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQA 390
            P  L  V+T TM+VGA  +A +  +V+KL ++E+L  V  +CSDKTGTLT+ K+ + + 
Sbjct: 316 -PVGLPAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEP 374

Query: 391 W 391
           +
Sbjct: 375 Y 375

 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 89/315 (28%), Positives = 145/315 (46%), Gaps = 44/315 (13%)

Query: 533 YKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPM 592
           YK +   PFD   K+++A+  S   +    V  KGA   VL              +   +
Sbjct: 424 YKVLEFHPFDPVSKKVTAIVES--PEGERIVCVKGAPLFVLKTV-----------EENHL 470

Query: 593 TEEDKEEVFKN-VETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLV 651
             ED +E ++N V  L+S G R L  A K                     E      G++
Sbjct: 471 IPEDVKENYENKVAELASRGYRALGVARKRG-------------------EGHWEILGVM 511

Query: 652 GIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSM 711
              DPPR +TA  V +    G+ V MLTGD  G AK   +++G L  N+Y+  +  +   
Sbjct: 512 PCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAERLGLGGG 570

Query: 712 V-MTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPS 770
             M  ++      E  D         A   PQ K  +++ L +R    AMTGDGVND+PS
Sbjct: 571 GDMPGSELADFV-ENADGF-------AEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPS 622

Query: 771 LKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENV 830
           LKKA+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+  +A ++
Sbjct: 623 LKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSL 681

Query: 831 AQALYLMIGLCFLDE 845
              ++L + +  L++
Sbjct: 682 HLEIFLGLWIAILNQ 696

>Scas_688.1
          Length = 913

 Score =  107 bits (266), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 88/312 (28%), Positives = 143/312 (45%), Gaps = 40/312 (12%)

Query: 533 YKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPM 592
           YK +   PFD   K+++AV  S   +    +  KGA   VL            E D  P+
Sbjct: 438 YKVLEFHPFDPVSKKVTAVVES--PEGERIICVKGAPLFVLKTV---------EED-HPI 485

Query: 593 TEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVG 652
            E+  E     V  L+S G R L  A K                     E      G++ 
Sbjct: 486 PEDIHENYENKVAELASRGFRALGVARKRG-------------------EGHWEILGVMP 526

Query: 653 IYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMV 712
             DPPR +T   V +  + G+ V MLTGD  G AK   +++G L  N+Y+  +       
Sbjct: 527 CMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNVYNAER------- 578

Query: 713 MTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLK 772
           +  +    +   E+ + +      A   PQ K R+++ L  R    AMTGDGVND+PSLK
Sbjct: 579 LGLSGGGDMPGSELADFVENADGFAEVFPQDKYRVVEILQTRGYLVAMTGDGVNDAPSLK 638

Query: 773 KANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQ 832
           KA+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+  +A ++  
Sbjct: 639 KADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSIHL 697

Query: 833 ALYLMIGLCFLD 844
            ++L + +  L+
Sbjct: 698 EIFLGLWIAILN 709

 Score =  106 bits (265), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 93/356 (26%), Positives = 155/356 (43%), Gaps = 50/356 (14%)

Query: 34  VLETDLQAGLRSAEATARVSQYGENSLGDDSK-IDFKSILLHQICNAMILVLFISMVITL 92
           +L+TD   GL S E   R  +YG N + ++++ +  K I+       +  V+  + ++  
Sbjct: 74  MLQTDPAYGLSSDEVARRRKKYGLNQMSEENESLVVKFIMF--FVGPIQFVMEAAAILAA 131

Query: 93  AIRDWISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQL 152
            + DW+                  QE++A   +  LK     SA VIRDG    +P+ ++
Sbjct: 132 GLSDWVDFGVICGLLLLNAGVGFVQEFQAGSIVEELKKTLANSAIVIRDGQLVEVPANEV 191

Query: 153 VPGDLCVVKAGDTVPADLRLI-ECVNFETDEALLTGESLPIAKEASQVYPATEDTPVGDR 211
           VPGD+  ++ G  +PAD R++ E    + D++ +TGESL              D   GD+
Sbjct: 192 VPGDILQLEDGVIIPADGRIVTEDCFVQIDQSAITGESL------------AADKHYGDQ 239

Query: 212 LNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAA 271
               F+SSTV +G A  ++  T              GDN+ + +       A+ G     
Sbjct: 240 ---TFSSSTVKRGEAFMVITAT--------------GDNTFVGRAAALVNKASGGQ---- 278

Query: 272 TIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAI--YAICVAVS 329
             G F            L+                      +  +  V I  Y + + + 
Sbjct: 279 --GHF---------TEVLNGIGIILLVLVIVTLLLVWTASFYRTDGIVRILRYTLGITIV 327

Query: 330 MIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKM 385
            +P  L  V+T TM+VGA  +A +  +V+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 328 GVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 383

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 166/771 (21%), Positives = 304/771 (39%), Gaps = 161/771 (20%)

Query: 120  KASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLVPGDLCVVKAGDT--VPADLRLI--EC 175
            K S+T+  +   +     V+R+G   +I S +LVPGD+  +   +   +P D  L+  +C
Sbjct: 526  KISRTLAEMSHFNC-EVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDC 584

Query: 176  VNFETDEALLTGESLPIAKEASQVYPATEDT--PVGDRL-----------NLAFASSTVS 222
            +    +E++LTGES+P++K     YPA+E+T   + D             +  F  +T+ 
Sbjct: 585  I---VNESMLTGESVPVSK-----YPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLI 636

Query: 223  KGR-------ATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLA-ATIG 274
            + +       A  + V+TG +T  G + +S+     +  K     F++++   +    I 
Sbjct: 637  RAKIPNGGSVALAMAVRTGFSTTKGSLIRSM-----VFPKPSGFKFYSDSFKYIGFMAII 691

Query: 275  SFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSS 334
            +F G +       KL                        +  + + + A+ +   ++P +
Sbjct: 692  AFFGFSISCINFIKLG-----------------------LDKRTMILRALDIITIVVPPA 728

Query: 335  LVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPS 394
            L   LTI  S     +  + +       +   G ++ +C DKTGTLT+  + V    V  
Sbjct: 729  LPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRVSC 788

Query: 395  FGTITVSNSSNPFDPTDGGIELIPRFS------PHQYKHDSTEDVGIITSFKNKFYNDKL 448
              T   ++ S+    T    ++ P+FS      P  YK  +   + ++T    +  + +L
Sbjct: 789  AATRNKASFSDLISDTH---DIFPKFSLKDCSNPDDYKRRNFL-ISLLTCHSLRVVDGEL 844

Query: 449  ---PAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDP-TEIAIQVFAHKLDM-PR 503
               P       F  W       N  H +     E  +    P     I    H  D   R
Sbjct: 845  LGDPLDFKMFQFTGWSYEEDFQN--HQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDER 902

Query: 504  NALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRV 563
            N                 LG            I  F F S ++RMS + V  + +N +  
Sbjct: 903  NKFVQNDPNNI-------LGI-----------IRSFEFLSELRRMSVI-VKPNNENVYWA 943

Query: 564  FTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFT 623
            +TKGA E ++D C              P T     +   N  T S  G RV+A A K+  
Sbjct: 944  YTKGAPEVIIDIC-------------NPATLPSDYDDILNFYTHS--GYRVIACAGKTLP 988

Query: 624  ESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFP 683
            ++  L  S+ +R  R+ VES++ F G +   +  +  T+  + +   A I   M TGD  
Sbjct: 989  KNTWL-YSQKVR--REEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNV 1045

Query: 684  GTAKAIAQEVGILPRNLYHYP---------------------KEVVD------------- 709
             TA ++ +E  ++  +  + P                     + ++D             
Sbjct: 1046 LTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGP 1105

Query: 710  -SMVMTAAQF-------DQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMT 761
             ++ +T   F       D  ++E ++ +LL   + AR +P  K  +++ L + +      
Sbjct: 1106 YTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFC 1165

Query: 762  GDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 812
            GDG ND  +LK A+VGI++    + VA   +  +    +   +L+ ++EGR
Sbjct: 1166 GDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKEGR 1213

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score = 96.3 bits (238), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 197/844 (23%), Positives = 334/844 (39%), Gaps = 194/844 (22%)

Query: 137  HVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVN------FETDEALLTGESL 190
            HVI    + +IPSK L  GDL  V  GD +PADL L++          +TD+  L GE+ 
Sbjct: 257  HVI--TRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQ--LDGETD 312

Query: 191  PIAKEASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDN 250
               + A    P T++    D +N         +   T    +  ++  +GK+       N
Sbjct: 313  WKLRVAC---PLTQNLSENDLIN---------RISITASAPEKSIHKFLGKVTYKDSTSN 360

Query: 251  SLISKDENKTFWAN-----AGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXX 305
             L     + T WAN     +G  +A  +  + G  T   ++   +K              
Sbjct: 361  PL---SVDNTLWANTVLASSGFCIACVV--YTGRDTRQAMNTTTAKVKTGLLELEINSIS 415

Query: 306  XXMATQKFVVNKEVAIYA--------------ICVAVSMIPSSLVVVLTITMSVGA-KIM 350
              +    F ++  +  +A              + +  ++IP SL V L +  SV A +I 
Sbjct: 416  KILCACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIE 475

Query: 351  ATRNV---VVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPF 407
              + +   +VR     E LG +  + SDKTGTLTQ  M +K+  +      TVS +S   
Sbjct: 476  HDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLG-----TVSYTSETL 530

Query: 408  DPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALA 467
            D     ++     S    K+DS  +  +  S   K  + ++   +        L  A   
Sbjct: 531  DIVSDYVQ-----SLVSSKNDSLNNSKVALSTTRKDMSFRVRDMI--------LTLAICH 577

Query: 468  NIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMP-----RNALTXXXXXXXXXXXXXXL 522
            N+   ++D E     A   P EIAI  F   + +      R++++              L
Sbjct: 578  NVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLSLFKRDRHSIS--------------L 621

Query: 523  GEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGA---FERVLDCCTKW 579
              + S    +Y+ +  FPF+S  KRM  + V  ++ + +    KGA     ++++    W
Sbjct: 622  LHEHSGKTLNYEILQVFPFNSDSKRM-GIIVRDEQLDEYWFMQKGADTVMSKIVES-NDW 679

Query: 580  LPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRK--- 636
            L                 EE   N   ++ EGLR L    K   +    K+ E  +K   
Sbjct: 680  L-----------------EEETGN---MAREGLRTLVIGRKKLNK----KIYEQFQKEYN 715

Query: 637  -------NRD---------FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTG 680
                   NRD         ++E DL   GL G+ D  +++   +++    AGI + MLTG
Sbjct: 716  DASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTG 775

Query: 681  DFPGTAKAIAQEVGILPRNLY-HYPKEVV------------------------DSMVMTA 715
            D   TA+ ++    ++ R  Y H   +V                         +S+ M  
Sbjct: 776  DKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFL 835

Query: 716  AQFDQLTDEEIDNLLLLPLVIA-RCAPQTKVRMIDALHRR--EKFCAMTGDGVNDSPSLK 772
              ++Q   E  D ++ LP VIA RC PQ K  +   + +   ++ C + GDG ND   ++
Sbjct: 836  KHYEQ---EFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI-GDGGNDVSMIQ 891

Query: 773  KANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVE----EGR---RMSDNIQKFVLQL 825
             A+VG+  GI G +  K AS  + +D +     +  E     GR   + S  + +FV+  
Sbjct: 892  CADVGV--GIVGKE-GKQAS--LAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHR 946

Query: 826  -LAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCF---PAMGLGLEKSAPD 881
             L   + QA+Y    +C L E      P++  +   ++   +C+   P   L L+    +
Sbjct: 947  GLIIAICQAVY---SICSLFE------PIALYQGWLMVGYATCYTMAPVFSLTLDHDIEE 997

Query: 882  IMEK 885
             + K
Sbjct: 998  SLTK 1001

>Scas_665.30
          Length = 1439

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 173/783 (22%), Positives = 305/783 (38%), Gaps = 180/783 (22%)

Query: 120  KASKTMNSLKSLS--TPSAHVIRDGNDETIPSKQLVPGDLCVVK--AGDTVPADLRLI-- 173
            +  +T  SL  +S       V RD     + S  LVPGD+  +   +    P D  L+  
Sbjct: 311  ETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSG 370

Query: 174  ECVNFETDEALLTGESLPIAKEAS------QVYPATEDTPVGDRLN--LAFASSTVSKGR 225
            +C+    +E++LTGES+P++K  +      Q+    ++T +   L+    F  +T+ + R
Sbjct: 371  DCI---VNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRAR 427

Query: 226  -------ATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANA--GITLAATIGSF 276
                   A  +VV+TG +T  G + +S+     +  K     F+ ++   I + A I  F
Sbjct: 428  IPYGQSAALAMVVRTGFSTTKGSLVRSM-----VFPKPTGFKFYEDSFKYIGVMALIALF 482

Query: 277  LGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSLV 336
             G +       K+                        +  + + + A+ +   ++P +L 
Sbjct: 483  -GFSISCIQFIKIG-----------------------LDKRTMILRALDIITIVVPPALP 518

Query: 337  VVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIV--KQAWVPS 394
              LTI        +  + +       +   G ++ +C DKTGTLT+  + V   Q  VPS
Sbjct: 519  ATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPS 578

Query: 395  FGTITVSNSSNPF-DPTDGGIELIPRFS------PHQYKHDSTEDVGIITSFKNKFYNDK 447
                  S++S  F D      +L P+FS      P  Y+  +   + ++T    +  +++
Sbjct: 579  ------SHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFF-ISLLTCHSLRVVDNE 631

Query: 448  L---PAGLNSKLFLNWLKTAALANIAHVYQDPE---TEEWKAHGD--PTEIAI---QVFA 496
            L   P       F  W       +    +Q+ E   T E + H +  P  I I    V  
Sbjct: 632  LIGDPLDFKMFQFTKW-------SYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHP 684

Query: 497  HKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPH--YKHIAEFPFDSSIKRMSAVYVS 554
            +  D P N                         +PH     I  F F S ++RMS +   
Sbjct: 685  NSAD-PENTFIDN--------------------DPHNFLGIIRSFEFLSELRRMSVIVKP 723

Query: 555  LDEDNAHRVFTKGAFERVLDCCTK-WLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLR 613
             +ED  +  FTKGA E +   C K  LP    E                 +   + +G R
Sbjct: 724  SNED-VYWAFTKGAPEVITQICNKATLPANFEEM----------------LNYYTHKGYR 766

Query: 614  VLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGI 673
            V+A A +    +  L      + +R+ VES++ F G +   +  ++ETA  ++   +A I
Sbjct: 767  VIACAGRVLPRNTWLYSQ---KVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASI 823

Query: 674  NVHMLTGDFPGTAKAIAQEVGILPRNLYHYPK-EVVDSMVMTAAQFDQL--TDEEIDNLL 730
               M TGD   TA ++ ++  ++     + P  E +DS   T+  +  +   D+ +D+  
Sbjct: 824  RTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRT 883

Query: 731  LLPL-----------------------------------------VIARCAPQTKVRMID 749
            LLP+                                         + AR +P  K  +++
Sbjct: 884  LLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELME 943

Query: 750  ALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVE 809
             L R        GDG ND  +LK A+VGI++    + VA   +  V    + + +L+ ++
Sbjct: 944  QLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVF---DISCVLDVIK 1000

Query: 810  EGR 812
            EGR
Sbjct: 1001 EGR 1003

>Kwal_26.9207
          Length = 1469

 Score = 93.6 bits (231), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 189/855 (22%), Positives = 326/855 (38%), Gaps = 165/855 (19%)

Query: 37   TDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVITLAIRD 96
            + +Q GL ++    R+  +G N++    K   + IL  ++ +   +    S+++ LA   
Sbjct: 462  SSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLE-ILFDEVLHPFYVFQIFSILLWLADNY 520

Query: 97   WISXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLVPGD 156
            +                   +  K S+ +  + S S     V RDG    + S +LVPGD
Sbjct: 521  YYYAACIFIISMLSIIDTLVETKKTSQRLAEV-SHSHCEVRVYRDGFWVQVSSSELVPGD 579

Query: 157  LCVVK--AGDTVPADLRLI--ECVNFETDEALLTGESLPIAKEASQ---VYPATED---T 206
            +  +   +  T P D  L+  +C+    +E++LTGES+P++K  +    +Y   ED   T
Sbjct: 580  VYEISDPSLSTFPCDSLLLSGDCI---VNESMLTGESVPVSKIPASDETIYQLLEDFQKT 636

Query: 207  PVGDRL--NLAFASSTVSKGRATG-------IVVKTGLNTEIGKIAQSLKGDNSLISKDE 257
             + + L  +  F  + + + R  G       +VV+TG +T  G + +S+        K  
Sbjct: 637  QISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFY 696

Query: 258  NKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNK 317
              +F     +TL A  G  +       L                            +  K
Sbjct: 697  EDSFKYIGFMTLIALAGFSISCINFIRLG---------------------------LAYK 729

Query: 318  EVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKT 377
             + + A+ +   ++P +L   L+I  S     +  + +       +   G ++ +C DKT
Sbjct: 730  VMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKT 789

Query: 378  GTLTQGKMIVKQAWVPS--------FGTI--TVSNSSNPFDPTDGGIELIPRFSPHQYKH 427
            GTLT+  + V    V          FG +   V    N +   D G       SP  +K 
Sbjct: 790  GTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCG-------SPIDFKS 842

Query: 428  DSTEDVGIITSFKNKFYNDKL---PAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAH 484
             +   V ++T    +  + +L   P       F NW       + A  +QD     +K H
Sbjct: 843  RNFL-VSLLTCHSLRVVDGELLGDPLDFKMFQFTNW-------SYAEDFQD-----FKFH 889

Query: 485  GDPTEIAIQVFAHKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPH--YKHIAEFPFD 542
                E       +K  +P NA                   K +  +PH     I  F F 
Sbjct: 890  SLNEER-----NNKSTLPENAGIAPAVVHPNAESTE---NKFTENDPHNLLGVIRSFEFV 941

Query: 543  SSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTK-WLPDGCNESDAKPMTEEDKEEVF 601
            S ++RMS +     E N    FTKGA E + + C K  LP              + E++ 
Sbjct: 942  SELRRMSVIVKPYGE-NVFWGFTKGAPEVISEICNKSTLP-------------ANYEQI- 986

Query: 602  KNVETLSSEGLRVLAFATKSFTESQ---ALKVSEDLRKNRDFVESDLIFQGLVGIYDPPR 658
              ++  +  G RV+A A K+  +     A KVS      R+ VES++ F G V   +  +
Sbjct: 987  --LQQYTHNGYRVIACAGKTLPKRTWRFAQKVS------REEVESNMEFLGFVVFENKLK 1038

Query: 659  QETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYP-------------- 704
              T   +     AGI   M TGD   TA ++ +E G++  +    P              
Sbjct: 1039 PSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLII 1098

Query: 705  -KEVVD-------------------SMVMTAAQF-------DQLTDEEIDNLLLLPLVIA 737
             ++V D                   ++ +T   F       + L +  I+ +LL   + A
Sbjct: 1099 WRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYA 1158

Query: 738  RCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLS 797
            R +P  K  ++  L   +      GDG ND  +LK A+VG+++    + VA   +  V  
Sbjct: 1159 RMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAAPFTSSVF- 1217

Query: 798  DDNFASILNAVEEGR 812
                + IL+ ++EGR
Sbjct: 1218 --EISCILDVIKEGR 1230

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 173/733 (23%), Positives = 288/733 (39%), Gaps = 167/733 (22%)

Query: 142 GNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVN------FETDEALLTGESLPIAKE 195
           G    + SK L  GDL  +  G  VPADL L++          +TD+  L GE+    + 
Sbjct: 254 GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQ--LDGETDWKLRI 311

Query: 196 ASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISK 255
           A  +     +  + +++ +  ++   S     G V     NT        L  DN+L + 
Sbjct: 312 ACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNT------SGLTIDNTLWAN 365

Query: 256 DENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVV 315
               T  A++G  +   I  + G  T   ++   +K                +    F++
Sbjct: 366 ----TVLASSGFCIGCVI--YTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFIL 419

Query: 316 NKEVAIYA--------------ICVAVSMIPSSLVVVLTITMSVGA-KIMATRNV---VV 357
           +  + ++A              + +  ++IP SL V L +  SV A +I   + +   +V
Sbjct: 420 SILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIV 479

Query: 358 RKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELI 417
           R     E LG +  + SDKTGTLTQ  M +K+  + +  + T   +    D   G IE  
Sbjct: 480 RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNV-SYTTETADIVSDYIQGMIE-- 536

Query: 418 PRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALA-NIAHVYQDP 476
                   K+DS  ++G  ++ +             +   ++ + T A+  N+   ++D 
Sbjct: 537 -------SKNDSVTNLGPRSTTRKD----------AATHVIDLITTLAICHNVTPTFEDD 579

Query: 477 ETEEWKAHGDPTEIAIQVFAHKLDMP-----RNALTXXXXXXXXXXXXXXLGEKTSSVEP 531
           E     A   P EIAI  F   + +      R++++              L E + ++  
Sbjct: 580 ELTYQAA--SPDEIAIVKFTESVGLSLFKRDRHSMSL-------------LHEHSGTI-L 623

Query: 532 HYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGA---FERVLDCCTKWLPDGCNESD 588
           +Y  +  FPF+S  KRM  +     +D  +    KGA     R++     WL        
Sbjct: 624 NYDVLTMFPFNSDTKRMGIIVYDKQKDQ-YWFLQKGADTVMNRIV-ANNDWL-------- 673

Query: 589 AKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRK----------NR 638
                    EE   N   ++ EGLR L    K  T+    K+ E  +K          NR
Sbjct: 674 ---------EEETGN---MAREGLRTLVIGRKKLTK----KIYEQFKKEYEEVSASMYNR 717

Query: 639 D---------FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAI 689
           +         ++E DL   GL G+ D  +++   +++    AGI + MLTGD   TA+ +
Sbjct: 718 EQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCV 777

Query: 690 AQEVGILPRNLYHYPKEVVDSMVMTAAQFDQL-------------------------TDE 724
           +    ++ R  Y +   VV  +      F+QL                           E
Sbjct: 778 SISAKLISRGQYVH---VVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQE 834

Query: 725 EIDNLLLLPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIA 779
             D ++ LP VIA RC PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+ 
Sbjct: 835 FFDVVVHLPTVIACRCTPQQKADV--ALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV- 890

Query: 780 MGINGSDVAKDAS 792
            GI G +  K AS
Sbjct: 891 -GIVGKE-GKQAS 901

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 173/731 (23%), Positives = 284/731 (38%), Gaps = 172/731 (23%)

Query: 145 ETIPSKQLVPGDLCVVKAGDTVPADLRLIECVN------FETDEALLTGESLPIAKEASQ 198
           + +PSK L  GDL  +  G  +PADL L++          +TD+  L GE+    + A  
Sbjct: 259 QLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQ--LDGETDWKLRVACS 316

Query: 199 VYPATEDTPVGDRLN-LAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDE 257
           +   T++    D LN ++  +S+  K           ++  +GK+       N+L     
Sbjct: 317 L---TQNLSTDDLLNKISITASSPEKS----------IHRFLGKLTYKDSSSNAL---SV 360

Query: 258 NKTFWANAGITLAATIGS------FLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQ 311
           + T WAN   T+ A++GS      + GT T   ++  +S                 +   
Sbjct: 361 DNTMWAN---TVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCAC 417

Query: 312 KFVVNKEVAIYA--------------ICVAVSMIPSSLVVVLTITMSVGAKIM----ATR 353
            FV++  +  +A              + +  ++IP SL V L +  SV A+ +       
Sbjct: 418 VFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIP 477

Query: 354 NVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGG 413
           + +VR     E LG +  + SDKTGTLTQ  M +K+      GT++ +  +         
Sbjct: 478 DTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKL---HLGTVSYTMDT--------- 525

Query: 414 IELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVY 473
           ++++  +        +T  +   T+ K+      LP  +   +    +  A   N+   +
Sbjct: 526 MDIVTDYVQELVSSSTTTPMPQSTAKKD------LPNRVRDLV----VTLAICHNVTPTF 575

Query: 474 QDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHY 533
           +D E     A   P EIAI  F   + +                    L  + S+    Y
Sbjct: 576 EDGELTYQAA--SPDEIAIVKFTESVGL---------SLFKRDRHSVSLFHQHSATNFEY 624

Query: 534 KHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGA---FERVLDCCTKWLPDGCNESDAK 590
             +  FPF+S  KRM  + V       H    KGA     R++     WL          
Sbjct: 625 DILQVFPFNSDTKRM-GIIVYDKVKGEHWFMQKGADTVMARIVQS-NDWL---------- 672

Query: 591 PMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRK----------NRD- 639
                D+E     V  ++ EGLR L    K  +     K  E  RK          NRD 
Sbjct: 673 -----DEE-----VGNMAREGLRTLVIGRKKLSP----KSYEQFRKEYHDASLSMLNRDE 718

Query: 640 --------FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQ 691
                    +E +L   GL G+ D  + +   +++    AG+ + MLTGD   TA+ ++ 
Sbjct: 719 TMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSI 778

Query: 692 EVGILPRNLYHY-------PKEVV------------------DSMVMTAAQFDQLTDEEI 726
              ++ R  Y +       P+  +                  +S+ M    + Q   E  
Sbjct: 779 SAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQ---EFF 835

Query: 727 DNLLLLPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAMG 781
           D ++ LP VIA RC PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+  G
Sbjct: 836 DIVVDLPAVIACRCTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV--G 890

Query: 782 INGSDVAKDAS 792
           I G +  K AS
Sbjct: 891 IVGKE-GKQAS 900

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH]
           (544854..548354) [3501 bp, 1166 aa]
          Length = 1166

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 172/728 (23%), Positives = 282/728 (38%), Gaps = 161/728 (22%)

Query: 143 NDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVN------FETDEALLTGESLPIAKEA 196
           N + +PSK L  GDL  +     +PAD+ L++          +TD+  L GE+       
Sbjct: 279 NSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQ--LDGET----DWK 332

Query: 197 SQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKD 256
            +V P+       D +        ++K   T    +  ++   GK+  + KG ++ +S D
Sbjct: 333 LRVAPSLTQNLTQDEM--------LTKVHITASAPEKSIHMFTGKL--TYKGSSAPLSVD 382

Query: 257 ENKTFWAN-----AGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQ 311
              T WAN     +G  +A  I  + GT T   ++   S                 +   
Sbjct: 383 --NTLWANTVLASSGTCVACVI--YTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCIC 438

Query: 312 KFVVNKEVAI---------------YAICVAVSMIPSSLVVVLTITMSVGAKIMATR--- 353
            F ++  + +               Y I  + ++IP SL V L +  SV A+ + +    
Sbjct: 439 VFTLSILLVVIGGLDDDKWYVDIMRYLILFS-TIIPVSLRVNLDLGKSVYARQIESDKSI 497

Query: 354 -NVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDG 412
            + +VR     E LG +  + SDKTGTLTQ  M +++  +      TVS +    D    
Sbjct: 498 PDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLG-----TVSYTMETMDMVTD 552

Query: 413 GIELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHV 472
            I+ +   SP           G+  +   K  + ++   +        +  A   N+   
Sbjct: 553 YIQTLT--SPANMGA-----AGVAVTGSRKEVSQRVRDLV--------VTLATCHNVTPN 597

Query: 473 YQDPETEEWKAHGDPTEIAIQVFAHKLDMP-----RNALTXXXXXXXXXXXXXXLGEKTS 527
           ++D E     A   P EIAI  F  ++ +      R++LT              L  + S
Sbjct: 598 FEDNELAYQAA--SPDEIAIVKFTERVGLSLFKRDRHSLT--------------LFHEYS 641

Query: 528 SVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKW-LPDGCNE 586
            V   Y  +  FPF S  KRM  +          R  TK            W L  G + 
Sbjct: 642 GVNLQYDILHVFPFTSDTKRMGIIV---------RDRTKNEI---------WFLQKGADT 683

Query: 587 SDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRK------NRD- 639
             +K +   D  E  + V  ++ EGLR L  A K  +     + S++ +       NRD 
Sbjct: 684 VMSKIVQSNDWLE--EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDE 741

Query: 640 --------FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQ 691
                    +E +L   GL G+ D  +++   +++    AG+ + MLTGD   TA+ +  
Sbjct: 742 AMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCV 801

Query: 692 EVGILPRNLY-----------------HYPKEVVDSMVMT-----AAQFDQLTDEEIDNL 729
              ++ R  Y                  Y K   +S ++      A        E  + +
Sbjct: 802 SAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIV 861

Query: 730 LLLPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAMGING 784
           + LP+VIA RC PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+  GI G
Sbjct: 862 ICLPVVIACRCTPQQKADV--ALLIREMTGKRVCCI-GDGGNDVSMIQCADVGV--GIVG 916

Query: 785 SDVAKDAS 792
            +  K AS
Sbjct: 917 KE-GKQAS 923

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 93/421 (22%), Positives = 174/421 (41%), Gaps = 84/421 (19%)

Query: 536  IAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTK-WLPDGCNESDAKPMTE 594
            +  F F S ++RMS + V  + D+ +  FTKGA E + + C K  LP             
Sbjct: 929  VRSFEFLSELRRMSVI-VKTNNDDVYWSFTKGAPEVISEICNKSTLP------------- 974

Query: 595  EDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIY 654
             D EEV +     +  G RV+A A K+  +   L      + +R+ VES+L F G +   
Sbjct: 975  ADFEEVLR---CYTHNGYRVIACAGKTLPKRTWLYSQ---KVSREEVESNLEFLGFIIFQ 1028

Query: 655  DPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPK--------- 705
            +  ++ET+  +K    A I   M TGD   TA ++ +E G++  +  + P          
Sbjct: 1029 NKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGE 1088

Query: 706  ------------EVVDSMVMTAAQF-----------------------------DQLTDE 724
                        +++D+  +   +                              +++ +E
Sbjct: 1089 PVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEE 1148

Query: 725  EIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGING 784
             ++ +LL   + AR +P  K  ++  L + +      GDG ND  +LK A+VGI++    
Sbjct: 1149 YLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAE 1208

Query: 785  SDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLD 844
            + VA   +  +    N + +L+ + EGR  +  +  F         +   ++ I + +  
Sbjct: 1209 ASVAAPFTSKIF---NISCVLDVIREGR--AALVTSFACFQYMSLYSAIQFITITILYSR 1263

Query: 845  EDRLSVFPLSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDML 904
               L  F    +++L I+ +  C     +   KS   I +K P    A + + +I++ +L
Sbjct: 1264 GSNLGDFQFLYIDLLLIVPIAIC-----MSWSKSYEKIDKKRP---SANLVSPKILVPLL 1315

Query: 905  I 905
            I
Sbjct: 1316 I 1316

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 112/276 (40%), Gaps = 59/276 (21%)

Query: 136 AHVIRDGNDETIPSKQLVPGDLCVVKAGD--TVPADLRLI--ECVNFETDEALLTGESLP 191
             V+RD    TI S +LVPGD+  V   +   +P D  L+  +C+    +E++LTGES+P
Sbjct: 553 VRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCI---VNESMLTGESVP 609

Query: 192 IAKEASQVYPATEDT--PVGDRLNLAFASSTVSKG------------------RATGIVV 231
           ++K     +PATE+T   + D       SS VSK                    A  +VV
Sbjct: 610 VSK-----FPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVV 664

Query: 232 KTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSK 291
           +TG +T  G + +S+        K    +F     ++L A  G  +       L   L K
Sbjct: 665 RTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKL--GLDK 722

Query: 292 XXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMA 351
                                    K + + A+ +   ++P +L   LTI  +     + 
Sbjct: 723 -------------------------KTMILRALDIITIVVPPALPATLTIGTNFALSRLK 757

Query: 352 TRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIV 387
            + +       L   G ++ +C DKTGTLT+  + V
Sbjct: 758 EKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDV 793

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 184/806 (22%), Positives = 315/806 (39%), Gaps = 160/806 (19%)

Query: 147 IPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYPATEDT 206
           IPSK L  GD+  +K G  VPAD+     V  +T+E    GES     +         +T
Sbjct: 268 IPSKDLKVGDIIKLKKGARVPADV-----VVLQTNEP--NGESFIKTDQLDG------ET 314

Query: 207 PVGDRLNLAFASSTVSKGRATGIVV-----KTGLNTEIGKIAQSLKGDNSLISKDENKTF 261
               RL  +   S         I +     +  ++  +GKI       +S +S D   T 
Sbjct: 315 DWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYK-DSTSSPLSVD--NTM 371

Query: 262 WANAGI-TLAATIGS--FLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKE 318
           W N  + + AA I    + G  T   L+   SK                +    F+++  
Sbjct: 372 WENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIM 431

Query: 319 VAIYA--------------ICVAVSMIPSSLVVVLTITMSVGA-KIMATRNV---VVRKL 360
           +  +A              + +  ++IP SL V L +  SV A KI   + +   +VR  
Sbjct: 432 LVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTS 491

Query: 361 DSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRF 420
              E LG +  + SDKTGTLTQ  M +K+      GT++ +N +         ++++  F
Sbjct: 492 TIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTNET---------MDIVTDF 539

Query: 421 SPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALA-NIAHVYQDPETE 479
              Q  +  T +    T+ KN   +D++         ++ + T A+  N+   ++D E  
Sbjct: 540 I--QSMNSRTSNSTPTTTRKN--ISDRV---------IDLVTTLAICHNVTPTFEDGELT 586

Query: 480 EWKAHGDPTEIAIQVFAHKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEF 539
              A   P EIAI  F   + +                    L    S ++  Y     F
Sbjct: 587 YQAA--SPDEIAIVKFTESVGL---------SLFRRDRHSISLFHDHSGMKLEYDIKILF 635

Query: 540 PFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKW-LPDGCNESDAKPMTEEDKE 598
           PF+S  KRM  +           +F K   E        W L  G +   +  +   D  
Sbjct: 636 PFNSDSKRMGVI-----------IFDKLKQEY-------WFLQKGADTVMSSIVVRNDWL 677

Query: 599 EVFKNVETLSSEGLRVLAFATKS------------FTESQALKVSEDLRKN---RDFVES 643
           E  +    +++EGLR L    K             ++E+    +  ++      R F+E+
Sbjct: 678 E--EETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLEN 735

Query: 644 DLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLY-- 701
           DL   GL G+ D  +++   +++    AGI + MLTGD   TA+ ++    ++ R  Y  
Sbjct: 736 DLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVH 795

Query: 702 ---------------HYPKEVVDSMVMTAAQ-----FDQLTDEEIDNLLLLPLVIA-RCA 740
                           Y +   +S ++   +          DE  D ++ LP V+A RC 
Sbjct: 796 TVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCT 855

Query: 741 PQTKVRMIDALHRR--EKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSD 798
           PQ K  +   + +   ++ C + GDG ND   ++ A+VG+  GI G +  + +     S 
Sbjct: 856 PQQKADVAVFIRQATGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKEGKQASLAADFSI 912

Query: 799 DNFASILNAVE-EGR---RMSDNIQKFVLQL-LAENVAQALYLMIGLCFLDEDRLSVFPL 853
             F  +   +   GR   + S  + +FV+   L  +V QA+Y    +C + E      PL
Sbjct: 913 TQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVY---SICSMFE------PL 963

Query: 854 SPVEVLWIIVVTSCF---PAMGLGLE 876
           +  +   ++   +C+   P   L L+
Sbjct: 964 ALYQGWLMVGYATCYTMAPVFSLTLD 989

>Kwal_23.5789
          Length = 1133

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 183/776 (23%), Positives = 299/776 (38%), Gaps = 171/776 (22%)

Query: 145 ETIPSKQLVPGDLCVVKAGDTVPADLRLIEC------VNFETDEALLTGES---LPIAKE 195
           + +PSK L  GDL  +  G   PADL L++       +  +TD+  L GE+   L IA  
Sbjct: 249 QLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQ--LDGETDWKLRIA-- 304

Query: 196 ASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKI------AQSLKGD 249
                P T+     D L          +   T  V +  +N  +GK+      +Q L  D
Sbjct: 305 ----CPLTQHLSQDDLL---------YRISITASVPEKSINNFLGKLTFGEIQSQPLSVD 351

Query: 250 NSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMA 309
           N++ +     T +A+AG  +A  +  + G  T   ++  +S                 + 
Sbjct: 352 NTMWAN----TVFASAGTAIACVV--YTGADTRQAMNTSMSSVKTGLLELEINSLSKILC 405

Query: 310 TQKFVVNKEVAIYA--------------ICVAVSMIPSSLVVVLTITMSVGAKIM----A 351
              F+++  +  +A              + +  ++IP SL V L +  SV A  +     
Sbjct: 406 ACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDST 465

Query: 352 TRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTD 411
               +VR     E LG +  + SDKTGTLTQ  M +K+      GT++ +      D  D
Sbjct: 466 IPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKL---HLGTVSYT-----MDTMD 517

Query: 412 GGIELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAH 471
              + +   S      D+     + ++ K       LP  +   +    L  A    +  
Sbjct: 518 IVTDYVRAMS------DNLNSSAVPSASKK-----DLPGRVRDLV----LTLALCHQVTP 562

Query: 472 VYQDPETEEWKAHGDPTEIAIQVFAHKLDMP-----RNALTXXXXXXXXXXXXXXLGEKT 526
            ++D E     A   P EIAI  F   + +      R+++T              L    
Sbjct: 563 TFEDGELTYQAA--SPDEIAIVKFTESVGLTLFRRDRHSIT--------------LLHDQ 606

Query: 527 SSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKW-LPDGCN 585
           S     Y  +  FPF+S  KRM  V           +F K   E        W L  G +
Sbjct: 607 SGTNFEYDILHVFPFNSDNKRMGIV-----------IFDKQKDEY-------WFLQKGAD 648

Query: 586 ESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSED------LRKNRD 639
              +K + + D  E  +    L+ EGLR L    K  ++      ++D      +  NR+
Sbjct: 649 VVMSKIVQKNDWLE--EETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNRE 706

Query: 640 F---------VESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIA 690
                     +E DL   GL G+ D  +++   +++    AGI + MLTGD   TA+ ++
Sbjct: 707 VTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVS 766

Query: 691 QEVGILPRNLYHY-------PKEVVDSMVMTAAQFDQ--LTDEEIDNLLL---------- 731
               ++ R  Y +       P+  +  + +     +   L D E   L L          
Sbjct: 767 ISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEI 826

Query: 732 ---LPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAMGIN 783
              LP VIA RC PQ K  +  A   RE    + C + GDG ND   ++ A+VG+ +   
Sbjct: 827 VVNLPAVIACRCTPQQKADV--ATFIREVTGKRVCCI-GDGGNDVSMIQSADVGVGIVGK 883

Query: 784 GSDVAKDASDIVLSDDNFASILNAVEEGR---RMSDNIQKFVLQL-LAENVAQALY 835
               A  A+D  ++     S L  +  GR   + S  + +FV+   L  +V QA+Y
Sbjct: 884 EGKQASLAADFSITQFCHLSKL-LLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVY 938

>Scas_704.38
          Length = 1161

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 168/744 (22%), Positives = 273/744 (36%), Gaps = 180/744 (24%)

Query: 137 HVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEA 196
           HV+     + +PSK L  GDL  +  GD +PADL L++      +  + T +        
Sbjct: 267 HVL--NQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWK 324

Query: 197 SQVYPA-TEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISK 255
            ++ PA T++    D +N         K   T    +  ++  +GK+       N L   
Sbjct: 325 LRIAPALTQNLTEPDLMN---------KVSITASAPEKAIHNFLGKVTYKDTSSNPL--- 372

Query: 256 DENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVV 315
             + T WAN   T+ A+ G  +G    T    + +                  +  K + 
Sbjct: 373 SIDNTLWAN---TVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILC 429

Query: 316 NKEVAIYAICVAV--------------------SMIPSSLVVVLTITMSVGAKIMATRNV 355
               A+  I V                      ++IP SL V L +  SV A  +   + 
Sbjct: 430 ASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDT 489

Query: 356 V----VRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVS---------- 401
           +    VR     E LG +  + SDKTGTLTQ  M +K+      GT++ +          
Sbjct: 490 IPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTSETLDIVSDY 546

Query: 402 -----NSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKL 456
                NSSN  +P+   +       P   + D                       L++++
Sbjct: 547 VDALVNSSNSANPSGKSV-------PSTSRKD-----------------------LSARV 576

Query: 457 FLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTXXXXXXXXX 516
               +  A   N+   ++D E     A   P EIAI  F   + +               
Sbjct: 577 RDMVVTLAICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGL--------SLFKRDR 626

Query: 517 XXXXXLGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGA---FERVL 573
                L   + S+   Y+ +  FPF+S  KRM  + V  ++ + +    KGA     R++
Sbjct: 627 HSISLLHGHSGSILT-YEILQVFPFNSDSKRM-GIIVHDEQKDEYWFMQKGADTVMARIV 684

Query: 574 DCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSED 633
           +    WL                 EE   N   ++ EGLR L    K  + +   +  +D
Sbjct: 685 EN-NDWL-----------------EEETGN---MAREGLRTLVVGRKKLSRNIYDQFKKD 723

Query: 634 LRK------NRD---------FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHML 678
                    NRD         ++E DL   GL G+ D  + +   +++    AGI + ML
Sbjct: 724 YDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWML 783

Query: 679 TGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQL----------------- 721
           TGD   TA+ ++    ++ R  Y +   ++  +       +QL                 
Sbjct: 784 TGDKVETARCVSISAKLISRGQYVH---IITKLTKPEGALNQLEYLKVNKGACLLIDGES 840

Query: 722 --------TDEEIDNLLLLPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDS 768
                     E  D ++ LP V+A RC PQ K  +  AL  RE    + C + GDG ND 
Sbjct: 841 LGMFLRYYKREFFDVVICLPTVVACRCTPQQKADV--ALVIREFTGKRVCCI-GDGGNDV 897

Query: 769 PSLKKANVGIAMGINGSDVAKDAS 792
             ++ A+VG+  GI G +  K AS
Sbjct: 898 SMIQCADVGV--GIVGKE-GKQAS 918

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 131/320 (40%), Gaps = 66/320 (20%)

Query: 536  IAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMT-E 594
            I  F F S ++RMS +     E N +  FTKGA E + D C              P T  
Sbjct: 904  IRSFEFLSELRRMSVIVKGFKE-NTYWSFTKGAPEVIADIC-------------NPATIP 949

Query: 595  EDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIY 654
            +D  E+  +    +  G R++A A K+  +S  L      + +R+ VE +L F G +   
Sbjct: 950  KDFHELLHH---YTHNGFRIIACAGKTLPKSSWLYSQ---KVSREEVEDNLEFLGFIVFE 1003

Query: 655  DPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGIL----------------PR 698
            +  +  T  A+K+   A I   M TGD   TA ++ ++ G++                 R
Sbjct: 1004 NKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESR 1063

Query: 699  NLYHYPKEVVDSMVMTAAQFDQLTDEE--------------------------IDNLLLL 732
            +L  +     +  V+ A     L D E                          I  +L+ 
Sbjct: 1064 HLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMK 1123

Query: 733  PLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDAS 792
              + AR +P  K  +++ L + +      GDG ND  +LK AN+GI++    + VA   +
Sbjct: 1124 GSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFT 1183

Query: 793  DIVLSDDNFASILNAVEEGR 812
              V    + + +L+ ++EGR
Sbjct: 1184 SAVF---DISCVLDVIKEGR 1200

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 83/370 (22%), Positives = 139/370 (37%), Gaps = 65/370 (17%)

Query: 39  LQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVITLAIRDWI 98
           +Q GL S+    R   +G+NS+    K     IL  +  +   +    S+++ LA   + 
Sbjct: 445 VQHGLTSSIQEDRTLAFGKNSVNLKQKT-VTEILFDEALHPFYVFQIFSIILWLADDYYY 503

Query: 99  SXXXXXXXXXXXXXXXSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLVPGDLC 158
                             +  K S+ +  +   +     V +D     + S  LVPGDL 
Sbjct: 504 YAGCIFLISVLSIIDTVIETKKNSEKLADISHFNC-EVRVYKDRFWTQVNSSDLVPGDLF 562

Query: 159 VVKAGDTV--PADLRLI--ECVNFETDEALLTGESLPIAKEASQVYPATEDTPVGDRLNL 214
            +     V  P D  LI  +C+    +E++LTGES+P++K     Y ATE T    +L  
Sbjct: 563 EISDPSLVVLPCDAVLISGDCI---VNESMLTGESVPVSK-----YAATEATMA--QLLQ 612

Query: 215 AFASSTVS----------------------KGRATGIVVKTGLNTEIGKIAQSLKGDNSL 252
            F SS VS                      +G A  +V++TG +T  G + +S+     +
Sbjct: 613 DFKSSQVSSFVSKSFLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPV 672

Query: 253 ISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQK 312
             K    +F     +TL A  G  +       L  +                        
Sbjct: 673 GFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEY----------------------- 709

Query: 313 FVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDV 372
               K + + A+ +   ++P +L   LTI  S     +  + +       +   G V+ +
Sbjct: 710 ----KVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMM 765

Query: 373 CSDKTGTLTQ 382
           C DKTGTLT+
Sbjct: 766 CFDKTGTLTE 775

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 133/320 (41%), Gaps = 65/320 (20%)

Query: 536  IAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEE 595
            +  F F S+++RMS +     E N    FTKGA E + + C+K            P+   
Sbjct: 913  VRSFEFLSNLRRMSVIVKPFSE-NVFMSFTKGAPEVIFELCSK---------QTLPL--- 959

Query: 596  DKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYD 655
            D E +  +    +  G RV+A A K  T    L      + +R+ +ES+L F G +   +
Sbjct: 960  DYEALLHH---YTHNGYRVIACAGKKLTRQSWLYSQ---KVSREEIESNLEFLGFIIFEN 1013

Query: 656  PPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGIL--PRNLYHYPKEV------ 707
              +  T   ++  H+A I   M TGD   TA ++ +E G++  PR       ++      
Sbjct: 1014 KLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEG 1073

Query: 708  --------------VDSMVM--------------TAAQFDQL-------TDEEIDNLLLL 732
                          +DS+ +              T   F  L        +E I+N+LL 
Sbjct: 1074 DIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLK 1133

Query: 733  PLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDAS 792
              + AR +P  K  +++ L          GDG ND  +LK A++GI++    + VA   +
Sbjct: 1134 TSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFT 1193

Query: 793  DIVLSDDNFASILNAVEEGR 812
              +      + +L+ ++EGR
Sbjct: 1194 SRLF---EISCVLDVMKEGR 1210

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 61/270 (22%), Positives = 110/270 (40%), Gaps = 49/270 (18%)

Query: 137 HVIRDGNDETIPSKQLVPGDLCVVK--AGDTVPADLRLI--ECVNFETDEALLTGESLPI 192
            V RDG    +PS  LVPGD+  +   +   +P D  LI  +C+    +E++LTGES+P+
Sbjct: 542 RVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCL---VNESMLTGESVPV 598

Query: 193 AKEAS------QVYPATEDTPVGDRLNLAF---------ASSTVSKGRATGIVVKTGLNT 237
           +K A+      Q+     DT +   ++ +F           +T  +  A G+V +TG +T
Sbjct: 599 SKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFST 658

Query: 238 EIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXXXXX 297
             G + +S+        K    +F     I++ A  G     +    L   L K      
Sbjct: 659 TKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFG--FAVSFIQFLRLGLDK------ 710

Query: 298 XXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVV 357
                              + + + A+ +   ++P +L   L+I        +  + +  
Sbjct: 711 -------------------RTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFC 751

Query: 358 RKLDSLEALGAVNDVCSDKTGTLTQGKMIV 387
                +   G ++ +C DKTGTLT+  + V
Sbjct: 752 ISPTRVNVGGKIDVMCFDKTGTLTEDGLDV 781

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 129/286 (45%), Gaps = 59/286 (20%)

Query: 536 IAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEE 595
           +  F F S++KR S + V    +  H    KGA            P+   E  ++  T  
Sbjct: 578 LRRFQFSSALKRSSTIAV---HNKQHYSAVKGA------------PETIRERLSQVPT-- 620

Query: 596 DKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYD 655
           D ++V+K   + +  G RVLA A+K    S ++K  E L   R+ VESDL F+G +  + 
Sbjct: 621 DYDQVYK---SFTRAGSRVLALASKKLP-SMSIKQIEKLE--REAVESDLEFKGFLVFHC 674

Query: 656 PPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPR----------------- 698
           P + +    +K  +++     M+TGD P TA  +A+EV I+ R                 
Sbjct: 675 PLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLILDEPIDGSSHALV 734

Query: 699 ---------NLYHYPKEVVD--------SMVMTAAQFDQLTDE-EIDNLLLLPLVIARCA 740
                    N ++  K+  +         + +T      L+   +++ L+    V AR +
Sbjct: 735 FRNIEETIVNPFNPEKDTFEHSKLFAKYDIAVTGHALQLLSGHSQLNELIRHTWVYARVS 794

Query: 741 PQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSD 786
           P  K  ++++L        M GDG ND  +LK+A+VGIA+ +NG++
Sbjct: 795 PAQKEFIMNSLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 839

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 110/268 (41%), Gaps = 53/268 (19%)

Query: 137 HVIRDGNDETIPSKQLVPGDLCVVKAGD---TVPADLRLIE--CVNFETDEALLTGESLP 191
           +V RD   + + + +L+P DL  V   D    +  D+ L++  C+    +EA+L+GES P
Sbjct: 257 NVFRDSKWQLLQTNELLPMDLISVTRTDEDSALSCDMILVDGTCI---VNEAMLSGESTP 313

Query: 192 IAKEASQVYPATEDTPVG--DRLNLAFASSTVSK----------------GRATGIVVKT 233
           + KE+ ++  + E   V   D+ ++    + V +                G A  +V KT
Sbjct: 314 LLKESVKLRSSEEKLQVEGLDKNSVLHGGTKVLQVTAPEKGSSSIPAPPDGGALAVVSKT 373

Query: 234 GLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXX 293
           G  T  G + + +   +  +S    +  +    + + A   S+     GT + R      
Sbjct: 374 GFETSQGALVRVMIYSSERVSVGNKEALYFILFLLIFAIAASWYVWVEGTRMGR------ 427

Query: 294 XXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATR 353
                                V  ++ +  I +  S++PS L + LT+ ++    +++  
Sbjct: 428 ---------------------VQSKLILDCILIITSVVPSELPMELTMAVNNSLAVLSKF 466

Query: 354 NVVVRKLDSLEALGAVNDVCSDKTGTLT 381
            V   +   +   G ++  C DKTGTLT
Sbjct: 467 YVYCTEPFRIPLAGRIDVCCFDKTGTLT 494

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 129/286 (45%), Gaps = 59/286 (20%)

Query: 536 IAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEE 595
           I  F F S++KR +++      ++A     KGA E + +  +                 +
Sbjct: 577 IRRFQFSSALKRSASI---ASHNDALFAAVKGAPETIRERLSD--------------IPK 619

Query: 596 DKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYD 655
           + +E++K   + +  G RVLA A+KS  +    K+ +DL  NRD VES+L F G +  + 
Sbjct: 620 NYDEIYK---SFTRSGSRVLALASKSLPKMSQSKI-DDL--NRDDVESELTFNGFLIFHC 673

Query: 656 PPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGIL---------------PRNL 700
           P + +    +K  +++     M+TGD P TA  +A+EVGI+                + L
Sbjct: 674 PLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGETLILDRAGKSDDNQLL 733

Query: 701 YHYPKEVVD-------------------SMVMTAAQFDQLTDE-EIDNLLLLPLVIARCA 740
           +   +E V                     + +T    + L    ++ +LL    V AR +
Sbjct: 734 FRDVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALNALEGHSQLRDLLRHTWVYARVS 793

Query: 741 PQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSD 786
           P  K  +++ L        M GDG ND  +LK+A+VGIA+ +NG++
Sbjct: 794 PSQKEFLLNTLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 838

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 114/286 (39%), Gaps = 49/286 (17%)

Query: 116 YQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLVPGDLCVVKAG---DTVPADLRL 172
           +Q   A K   ++  +   + +V R+     + + +L+P DL  +        +P DL L
Sbjct: 237 FQRLTALKEFRTM-GIKPYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLIL 295

Query: 173 IECVNFETDEALLTGESLPIAKEASQVYPATEDTPVG--DRLNLAFASSTVSK------- 223
           ++      +EA+L+GES P+ KE+ ++ P+ ++  +   D++ +    +   +       
Sbjct: 296 LDGSAI-VNEAMLSGESTPLLKESIKLRPSEDNLQLDGVDKIAVLHGGTKALQVTPPEHK 354

Query: 224 --------GRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGS 275
                   G A  IV KTG  T  G + + +      +S D  +       + + A I S
Sbjct: 355 SDIPPPPDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFAVIAS 414

Query: 276 FLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSL 335
           +     GT + R  SK                           + +  I +  S++P  L
Sbjct: 415 WYVWVEGTKMGRIQSK---------------------------LILDCILIITSVVPPEL 447

Query: 336 VVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLT 381
            + LT+ ++     +A   V   +   +   G ++  C DKTGTLT
Sbjct: 448 PMELTMAVNSSLAALAKFYVYCTEPFRIPFAGRIDVCCFDKTGTLT 493

>Scas_583.14*
          Length = 875

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 135/304 (44%), Gaps = 59/304 (19%)

Query: 536 IAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEE 595
           +  F F S++KR S+V    D     ++FT            K  P+   E  A  +  +
Sbjct: 231 LRRFQFSSALKRSSSVASHKD-----KLFT----------AVKGAPETIRERLA--VVPK 273

Query: 596 DKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYD 655
           + +E++K   + +  G RVLA A+KS     + K  +DL  +RD +E+ L F G +  + 
Sbjct: 274 NYDEIYK---SFTRSGSRVLALASKSLPNLSS-KQLDDL--DRDEIETGLTFNGFLVFHC 327

Query: 656 PPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGIL------------------- 696
           P + +    +K  +++     M+TGD P TA  +A+EV I+                   
Sbjct: 328 PLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILDKSETVGDGKLL 387

Query: 697 -------------PRNLYHYPKEVVDS--MVMTAAQFDQLTDE-EIDNLLLLPLVIARCA 740
                        P +     +E+ D   + +T    + L D  ++ +L+    V AR +
Sbjct: 388 FFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDHSQLKDLIRHTWVYARVS 447

Query: 741 PQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDN 800
           P  K  +++ L        M GDG ND  +LK+A+VG+A+ +NG++ +  A      D+N
Sbjct: 448 PSQKEFILNNLKEMGYQTLMCGDGTNDVGALKQAHVGVAL-LNGTEESMTAMAQKRRDEN 506

Query: 801 FASI 804
             S+
Sbjct: 507 MKSM 510

>Kwal_26.7070
          Length = 1315

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 184/845 (21%), Positives = 327/845 (38%), Gaps = 170/845 (20%)

Query: 317  KEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMAT----------RNVVVRKLDSLEAL 366
            K++  Y I  + +++P SL V + +     A ++A+             VVR    +E L
Sbjct: 492  KDILTYWILFS-NLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEEL 550

Query: 367  GAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYK 426
            G +  + SDKTGTLT+  M         F + +++            IE IP     + K
Sbjct: 551  GQIEYIFSDKTGTLTRNVM--------EFKSCSIAGKCY--------IETIP-----EDK 589

Query: 427  HDSTEDVGIITSFKNKFYNDKLPAGLN------SKLFLNWLKTAALAN-IAHVYQDPETE 479
              +TED GI   F+ KF  D +   LN      S +  ++L   A  + +   +Q+  + 
Sbjct: 590  AATTED-GIEIGFR-KF--DSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSI 645

Query: 480  EWKAHGDPTEIAIQVFAHKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVEPHYKHIAEF 539
            +++A   P E A+   A  L                      LG+     E  Y+ +   
Sbjct: 646  KYQA-ASPDEGALVEGAASLGYK----FIIRKPNSVSVLIEDLGQ-----EQEYQLLNIC 695

Query: 540  PFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEE 599
             F+S+ KRMSA++     +   ++F KGA   +L+     L  G N     P  E     
Sbjct: 696  EFNSTRKRMSAIFRL--PNGEIKLFCKGADTVILER----LKAGEN-----PYIEA---- 740

Query: 600  VFKNVETLSSEGLRVLAFATKSFTESQ---------ALKVSEDLRKNR-----DFVESDL 645
              +++E  ++EGLR L  A+++ TES+         A   + D R  +     + +E DL
Sbjct: 741  TLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDL 800

Query: 646  IFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILP-------- 697
               G   I D  +      +     AGI V +LTGD   TA  I     +L         
Sbjct: 801  FLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLII 860

Query: 698  ---------RNLYHYPKEVVD-----------SMVMTAAQFDQLTDEEIDNLLLL----- 732
                     +NL    K + D           ++V+         + ++++ LL      
Sbjct: 861  NEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFALEADLEDYLLAIGKLC 920

Query: 733  -PLVIARCAPQTKVRMIDALHRR-EKFCAMTGDGVNDSPSLKKANVGIAM-GINGSDVAK 789
              ++  R +P  K  ++  + R+ +      GDG ND   ++ A+VG+ + G+ G   A+
Sbjct: 921  KAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAAR 980

Query: 790  DASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA---QALYLMIGLCFLDED 846
             A D  ++   +   L  V  G      I + +L    +N+A      + +    +  + 
Sbjct: 981  SA-DFAIAQFKYLKKLLLV-HGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQS 1038

Query: 847  RLSVFPLSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAG----IFTWEIILD 902
             +  + ++   V + ++       MG+  +  +  ++++ PQ  K G     F+  I   
Sbjct: 1039 IMESWTMTFYNVFFTVLPPFV---MGVFDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWG 1095

Query: 903  MLIYGTWMAACCLACFI--TVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCA 960
             +I G + +A     FI  T+ Y  G      N  NS+ E+ D+   G      S+  C+
Sbjct: 1096 WVINGFYHSAV---TFIGSTLFYRNG------NVLNSHGETADHWAWG-----VSIYTCS 1141

Query: 961  LILAWEVIDMRRSFFKMQPETDTPYTQWMKDIWSNQFLFWSVIFG-FVSVFPVVYIPVIN 1019
            +I    ++  + +    Q      +T++         +FW V F  + S+ P   +    
Sbjct: 1142 VI----IVIGKAALVTNQ------WTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEY 1191

Query: 1020 KDVFKH-KGIGYEWGLAVAYTIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDP 1078
              V  H  G    W + +       +   ++KY+KR Y         P    ES  V   
Sbjct: 1192 YGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTY--------TP----ESYHVVQE 1239

Query: 1079 FEKYN 1083
             +KYN
Sbjct: 1240 MQKYN 1244

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 168/801 (20%), Positives = 305/801 (38%), Gaps = 170/801 (21%)

Query: 356  VVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIE 415
            VVR    +E LG +  + SDKTGTLT+         V  F +++++            IE
Sbjct: 545  VVRTSSLVEELGQIEYIFSDKTGTLTRN--------VMEFKSVSIAGRCY--------IE 588

Query: 416  LIPRFSPHQYKHDSTEDVGIITSFKN-KFYNDKL--PAGLNSKLFLNWLKTAALAN-IAH 471
             IP     + +  + ED GI   F + +   DK+  P    + + + +L   A  + +  
Sbjct: 589  TIP-----EDRRATVED-GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIP 642

Query: 472  VYQDPETEEWKAHGDPTEIAI----QVFAHKLDMPR-NALTXXXXXXXXXXXXXXLGEKT 526
              Q   T +++A   P E A+         + D+ R N+++                  +
Sbjct: 643  ETQSDGTIKYQA-ASPDEGALVQGAADLGFRFDIRRPNSVSISTPF-------------S 688

Query: 527  SSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNE 586
              +E    +I EF  +S+ KRMSA++     D + ++F KGA   +L+           +
Sbjct: 689  EQLEYQLLNICEF--NSTRKRMSAIFRM--PDGSIKLFCKGADTVILERL---------D 735

Query: 587  SDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVS--------------E 632
            S+  P  +       +++E  ++EGLR L  A+++  E +  + S              E
Sbjct: 736  SEFNPYVQS----TLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTE 791

Query: 633  DLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQE 692
            +L +  + +E DL F G   I D  ++     +    +AG+ V +LTGD   TA  I   
Sbjct: 792  ELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMS 851

Query: 693  VGILPR--NLYHYPKEVVDSMV------MTAAQFDQLTDEEIDNLLLL------------ 732
              +L    NL    +E  +         + A +  Q++ +++++L L+            
Sbjct: 852  CRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEE 911

Query: 733  --------------PLVIARCAPQTKVRMIDALHRR-EKFCAMTGDGVNDSPSLKKANVG 777
                           ++  R +P  K  ++  + R+        GDG ND   ++ A+VG
Sbjct: 912  DLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVG 971

Query: 778  IAM-GINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA---QA 833
            + + G+ G   A+ A D  +    F   L  V  G      I   +L    +N+A     
Sbjct: 972  VGISGMEGMQAARSA-DFAIGQFRFLRKLLIV-HGSWSYQRISLAILYSFYKNMALYMTQ 1029

Query: 834  LYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLGL--EKSAPDIMEKEPQDSK 891
             + +    F  +  +  + L+   V + ++     P   +G+  +     ++++ PQ  K
Sbjct: 1030 FWYVFANAFSGQSIMESWTLTFYNVFFTVM-----PPFVIGIFDQFVTSRLLDRYPQLYK 1084

Query: 892  AG----IFTWEIILDMLIYGTWMAACCLACFITVIYGKGNGELGINCNNSYSESCDNVYH 947
             G     F+  I    ++ G + +A      + + Y  G      NC N   E+ D+   
Sbjct: 1085 LGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSV-LFYRYG------NCLNMGGETADH--- 1134

Query: 948  GRAATFASMTWCALILAWEVIDMRRSFFKMQPETDTPYTQWMKDIW---SNQFLFWSVIF 1004
                      W      W V     S   +  +     +QW K          + W + F
Sbjct: 1135 ----------WV-----WGVGIYTTSIIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFF 1179

Query: 1005 GFVS-VFPVVYIPVINKDVFKH-KGIGYEWGLAVAYTIAFWIGAELYKYFKRCYFKNKGR 1062
             F S VFP V +      +  H  G    W + +   +   +   ++KY+KR Y      
Sbjct: 1180 PFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRTY------ 1233

Query: 1063 AQNPEKDLESRRVHDPFEKYN 1083
              +P    ES  V    +KYN
Sbjct: 1234 --SP----ESYHVVQEMQKYN 1248

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 129/595 (21%), Positives = 219/595 (36%), Gaps = 119/595 (20%)

Query: 530  EPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGA----FERVLDCCTKWLPDGCN 585
            E  Y+ +    F+S+ KRMSA++     D + ++F KGA     ER+ D   +++     
Sbjct: 687  EKEYQLLNICEFNSTRKRMSAIFRF--PDGSIKLFCKGADTVILERLDDEANQYV----- 739

Query: 586  ESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALK--------------VS 631
                        E   +++E  +SEGLR L  A +  +E +  +               +
Sbjct: 740  ------------EATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRA 787

Query: 632  EDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQ 691
            E L +  + +E +LI  G   I D  +      +    +AGI + +LTGD   TA  I  
Sbjct: 788  EKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGM 847

Query: 692  EVGILPR--NLYHYPKEVVD--------------------------SMVMTAAQFDQLTD 723
               +L    NL    +E  D                          ++V+         +
Sbjct: 848  SCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALE 907

Query: 724  EEIDNLLLL------PLVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANV 776
             E+++ LL        ++  R +P  K  ++  + R+     +    G ND   ++ A+V
Sbjct: 908  PELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHV 967

Query: 777  GIAM-GINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA---Q 832
            G+ + G+ G   A+ A DI L    F   L  V  G      I   +L    +N A    
Sbjct: 968  GVGISGMEGMQAARSA-DIALGQFKFLKKLLLV-HGSWSYQRISVAILYSFYKNTALYMT 1025

Query: 833  ALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLGL--EKSAPDIMEKEPQDS 890
              + +    F  +  +  + +S   + + +     +P   +G+  +  +  ++E+ PQ  
Sbjct: 1026 QFWYVFANAFSGQSIMESWTMSFYNLFFTV-----WPPFVIGVFDQFVSSRLLERYPQLY 1080

Query: 891  KAG----IFTWEIILDMLIYGTWMAACCLACFITVIYGKGNGELGINCNNSYSESCDNVY 946
            K G     F+  I    +I G + +A      I +IY  G     +N             
Sbjct: 1081 KLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTI-LIYRYG---FALNM------------ 1124

Query: 947  HGRAATFASMTWCALILAWEVIDMRRSFFKMQPETDTPYTQWMKDIW---SNQFLFWSVI 1003
            HG  A      W     +W V     S   +  +      QW K          LFW + 
Sbjct: 1125 HGELADH----W-----SWGVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIF 1175

Query: 1004 FG-FVSVFPVVYIPVINKDVFKHK-GIGYEWGLAVAYTIAFWIGAELYKYFKRCY 1056
            F  + S+FP   I      V KH  G G  W   +   I   +   L+KY+KR Y
Sbjct: 1176 FPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMY 1230

>Kwal_55.21575
          Length = 989

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 120/280 (42%), Gaps = 34/280 (12%)

Query: 118 EYKA-SKTMNSLK---SLSTPSAHVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLI 173
           E KA SKT NSL    SL+  +  +I +G    IP + L  GD   +K G  +P D  +I
Sbjct: 389 ENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVII 448

Query: 174 ECVNFETDEALLTGESLPIAKEASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKT 233
           E  + E DE+L+TGESL +        P  +  PV        A S     R        
Sbjct: 449 EGES-EVDESLITGESLMV--------PRYKGFPV-------IAGSINGPNRFLLTATSV 492

Query: 234 GLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXX 293
           G +T++ +I Q++K      +  ++   +  +    +  + + +   T T L R LS   
Sbjct: 493 GDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPP 552

Query: 294 XXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATR 353
                             KF +  E+ I  I VA    P +L +     + VG  + A  
Sbjct: 553 SIFDS----------PNGKFFICLEMTISVIVVAC---PCALGLAAPTAIMVGTGLGAKH 599

Query: 354 NVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVP 393
            V+++  D LE   ++     DKTGTLT G M V+Q +VP
Sbjct: 600 GVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQ-FVP 638

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 38/182 (20%)

Query: 626 QALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGT 685
           Q + +S D      +V+ +    G   I D  +++ A  V+   + G  V M+TGD   +
Sbjct: 718 QDMSLSADASSTLAYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKS 777

Query: 686 AKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKV 745
           A  +A E+GI   N+Y           +T A  +QL  +  D                  
Sbjct: 778 AMKVALELGIEANNVYSE---------LTPADKNQLVQDLQDG----------------- 811

Query: 746 RMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVL---SDDNFA 802
                     K  A  GDG+NDSP+L  +++G+++   G+D+A +A+D+++   S++N  
Sbjct: 812 --------GRKNVAFIGDGINDSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHV 862

Query: 803 SI 804
           S+
Sbjct: 863 SL 864

>Scas_615.9
          Length = 942

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 80/182 (43%), Gaps = 39/182 (21%)

Query: 616 AFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINV 675
           A  T S  +S +   S+D  K+   +   L+  G   I D  +++ A  ++       ++
Sbjct: 665 ALMTDSMFDSNSDNTSDDFTKSYVSINDTLV--GKFEIRDSVKEDVADIIQYLQGLHYDI 722

Query: 676 HMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLV 735
           +M+TGD  G A  +AQ+VGI   N+Y                                  
Sbjct: 723 YMVTGDSHGAAMKVAQQVGIAANNVY---------------------------------- 748

Query: 736 IARCAPQTKVRMIDALHRRE-KFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDI 794
            +   P  K  ++++L        A  GDG+NDSP L  +++G+A+   G+D+A +A+DI
Sbjct: 749 -SGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALS-TGTDIAMEAADI 806

Query: 795 VL 796
           V+
Sbjct: 807 VV 808

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 119/280 (42%), Gaps = 36/280 (12%)

Query: 120 KASKTMNSLKSLSTPSAHVIRDGNDET-----IPSKQLVPGDLCVVKAGDTVPADLRLIE 174
           + S +++ L  L+     +++D N+       I +  L   D+  +K G  +PAD  +I+
Sbjct: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401

Query: 175 CVNFETDEALLTGESLPIAKE-ASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKT 233
             + E DE+L+TGES+ + K+  SQV   + + P                G      +  
Sbjct: 402 GES-EIDESLMTGESILVHKQKGSQVIAGSLNGP----------------GHFYFKAINI 444

Query: 234 GLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXX 293
           G +T++ +I Q++K      S   NK    N    LA+    F+ T     +   ++   
Sbjct: 445 GDDTKLAQIIQTMK------SAQLNKAPIQNNADYLASI---FVPTILCLSIITFITWIT 495

Query: 294 XXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATR 353
                             KF  + ++AI  I VA    P +L +     + VG  I A  
Sbjct: 496 LSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVAC---PCALGLATPTAIMVGTGIGAQH 552

Query: 354 NVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVP 393
            V+++  D LE    +  +  DKTGT+T G+M V Q ++P
Sbjct: 553 GVLIKGGDILERFNTITKIVFDKTGTITTGQMTV-QRFIP 591

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/346 (23%), Positives = 141/346 (40%), Gaps = 69/346 (19%)

Query: 541  FDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEV 600
            F+S+ KRMSA++     DN+ R+  KGA   +L+            + + P         
Sbjct: 694  FNSTRKRMSAIFRF--PDNSIRLLCKGADTVILERLA---------ATSNPYVAA----T 738

Query: 601  FKNVETLSSEGLRVLAFATKSFTESQALK--------------VSEDLRKNRDFVESDLI 646
             +++E  ++EGLR L  A+++  ES+  +               SE+L K  + +E  L+
Sbjct: 739  LRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLV 798

Query: 647  FQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPR--NLYHYP 704
              G   I D  +      +    +AGI V +LTGD   TA  I     +L    NL    
Sbjct: 799  LLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVN 858

Query: 705  KEVVDSMV------MTAAQFDQLTDEEIDNLLLL-------------------------- 732
            ++  +S        + A    Q++ ++++ L L+                          
Sbjct: 859  EDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCR 918

Query: 733  PLVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM-GINGSDVAKD 790
             ++  R +P  K  ++  + RR K   +  GDG ND   ++ A+VG+ + G+ G   A+ 
Sbjct: 919  AVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARS 978

Query: 791  ASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYL 836
            A D  L    +   L  V  G      I + +L    +N+  ALY+
Sbjct: 979  A-DFALGQFKYLKKLLLV-HGSWSYQRISQAILYSFYKNI--ALYM 1020

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 10/70 (14%)

Query: 329 SMIPSSLVVVLTITMSVGAKIMAT----------RNVVVRKLDSLEALGAVNDVCSDKTG 378
           +++P SL V + +     A ++A+             VVR    +E LG +  + SDKTG
Sbjct: 500 NLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTG 559

Query: 379 TLTQGKMIVK 388
           TLTQ  M  K
Sbjct: 560 TLTQNVMEFK 569

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 126/281 (44%), Gaps = 33/281 (11%)

Query: 116 YQEYKA-SKTMNSLKSLS--TPSAHVIRDGNDETIPSK----QLVPGDLCVVKAGDTVPA 168
           Y E KA SKT  +L  L   TPS+ +I D +D++I  +     L  GD+ +VK G  +P+
Sbjct: 389 YLENKAKSKTSTALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPS 448

Query: 169 DLRLIECVNFETDEALLTGESLPIAKEASQVYPATEDTPVGDRLNLAFASSTVSKGRATG 228
           D  + + ++ E DE+L+TGE+  + KE   V   T  T  G  L + F  ++V       
Sbjct: 449 DGIVTKGIS-EVDESLMTGETNLVVKEIGSV--VTGGTINGSGL-IYFEVTSVGDDTKLA 504

Query: 229 IVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRK 288
            ++K   N ++ K +         I +  +          L  ++ +F+  T+ T   + 
Sbjct: 505 NIIKVMKNAQLKKAS---------IQRYTDYVASIFVPTVLILSLLTFIVWTSLTRSEKI 555

Query: 289 LSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAK 348
           +SK                 +  +F +  ++A   + VA    P +L +     + VG  
Sbjct: 556 ISKLSIFGET----------SESRFYMCLQIATSVVIVAC---PCALGLATPTAIMVGTG 602

Query: 349 IMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQ 389
           + +   V+++  D LE    VN    DKTGTLT G M V+Q
Sbjct: 603 VASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ 643

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 75/184 (40%), Gaps = 42/184 (22%)

Query: 653 IYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMV 712
           + D  + +    ++        V M+TGD   +A  +A+ V I P N+Y           
Sbjct: 761 LLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVY----------- 809

Query: 713 MTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLK 772
                                   +   P  K + ++ L    +  A  GDG+NDS +L 
Sbjct: 810 ------------------------SEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALV 845

Query: 773 KANVGIAMGINGSDVAKDASDIVLSDD------NFASILNAVEEGRRMSDNIQKFVLQLL 826
            +++GIA+  +G++VA +A+ IV+ +D          ++NA++   R    ++  +   L
Sbjct: 846 TSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNLFWAL 904

Query: 827 AENV 830
             NV
Sbjct: 905 CYNV 908

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 115/267 (43%), Gaps = 52/267 (19%)

Query: 137 HVIRDGNDETIPSKQLVPGDLC-VVKAGD--TVPADLRLIE--CVNFETDEALLTGESLP 191
           +V+RDG    + + +L+P D+  VV+  +   +P DL L++  C+    +EA+L+GES P
Sbjct: 255 NVLRDGKWVEMQTNELLPMDVVSVVRTAEDSALPCDLILVDGTCI---VNEAMLSGESTP 311

Query: 192 IAKEASQVYPATEDTPV--GDRLNLAFASSTVSK---------------GRATGIVVKTG 234
           + KE+ ++ P  E+  +   D++++    + V +               G A  IV KTG
Sbjct: 312 LLKESIRLRPGNEELQIEGTDKISVLHGGTKVLQVTTPEKTGKVPSPPDGGAIAIVTKTG 371

Query: 235 LNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKXXX 294
             T  G + + +   +  +  D  +  +    + + A + S+     GT + R       
Sbjct: 372 FETSQGSLVRVMIYSSERVGVDNKEALYFILFLLIFAVVASWYVWVEGTKMGR------- 424

Query: 295 XXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRN 354
                               V  ++ +  I +  S++P  L + LT+ ++     ++   
Sbjct: 425 --------------------VQSKLILDCILIITSVVPPELPMELTMAVNSSLSALSKFY 464

Query: 355 VVVRKLDSLEALGAVNDVCSDKTGTLT 381
           V   +   +   G ++  C DKTGTLT
Sbjct: 465 VYCTEPFRIPFAGRIDVCCFDKTGTLT 491

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 102/224 (45%), Gaps = 42/224 (18%)

Query: 598 EEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPP 657
           +E++K   + +  G RVLA A+K   +    ++ +    +R+  E DL F G +  + P 
Sbjct: 620 DEIYK---SFTRSGSRVLALASKKLEKMSQSQIED---ADREHFERDLEFNGFLIFHCPL 673

Query: 658 RQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILP---------------RNLYH 702
           + +    ++  +++     M+TGD P TA  +A+EVGI+                + ++ 
Sbjct: 674 KHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFR 733

Query: 703 YPKEVVD-SMVMTAAQFDQL-------------------TDEEIDNLLLLPLVIARCAPQ 742
             +E +    V++   F++                       ++ +L+    + AR +P 
Sbjct: 734 NVEETLSFEFVVSKDSFEKYGIFDKYDLAVTGHALEALKGHHQLQDLIRHAWIYARVSPA 793

Query: 743 TKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSD 786
            K  +++ L        M GDG ND  +LK+A+VG+A+ +NG++
Sbjct: 794 QKEFILNNLKDMGYQTLMCGDGTNDVGALKQAHVGVAL-LNGTE 836

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 101/227 (44%), Gaps = 53/227 (23%)

Query: 580  LPDGCNESDAKP-MTEEDKEEVFKNVET-LSSEGLRVLAFATKSFTESQALKVSEDLRKN 637
            LPD     +  P M     E + ++ +  L+SE L++LA   +     ++L V+    K+
Sbjct: 856  LPDARIWKEVDPEMAIVGNERLLRDYKCHLTSEQLKLLA---EWKARGKSLMVTA--IKS 910

Query: 638  RDFVESDLIFQGLV-GIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGIL 696
            R +  +D  +  ++    D  R E    +K+  ++GI   M++GD   TA+A+AQE+   
Sbjct: 911  RSYFGNDNFYPVMMCAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVAQEL--- 967

Query: 697  PRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHR--- 753
                                        +IDN      VIA   P+ K   +  +     
Sbjct: 968  ----------------------------DIDN------VIAEVLPEEKAAKVKWIQHNNI 993

Query: 754  ----REKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVL 796
                  K  AM GDG+ND+P+L  A+VGIA+  +GS++A  + D VL
Sbjct: 994  GANGHHKVVAMVGDGINDAPALAAADVGIALA-SGSELAMTSCDFVL 1039

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 7/95 (7%)

Query: 115 SYQEYKASKTMNSLKSLSTPSAHVIRDGND-----ETIPSKQLVPGDLCVVKAGDTVPAD 169
           S  + K +  +++L S    +A +++   D     ET+  + L  GD   +  G + P D
Sbjct: 530 SLAKTKTASAISNLSSFKQETATLMQKVGDQYQEVETVQIQYLELGDYIKISPGQSPPLD 589

Query: 170 LRLIECVNFETDEALLTGESLPIAK-EASQVYPAT 203
             ++E    E DE+ LTGES+P+ +    Q++  T
Sbjct: 590 SIILEG-ETEFDESALTGESIPMVRLRGDQIFAGT 623

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 84/190 (44%), Gaps = 44/190 (23%)

Query: 649 GLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVV 708
           GL  I D  + ++   V+   + G   +M+TGD    AK +A+EVGI   N+Y       
Sbjct: 757 GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVY------- 809

Query: 709 DSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRRE--KFCAMTGDGVN 766
                                       +  +P  K  ++  +  +E     A+ GDG+N
Sbjct: 810 ----------------------------SDVSPTGKCDLVKKIQDKEGNNKVAVVGDGIN 841

Query: 767 DSPSLKKANVGIAMGINGSDVAKDASDIV------LSDDNFASILNAVEEGRRMSDNIQK 820
           D+P+L  +++GIA+   G+++A +A+DIV      L+ ++   + NA++   +    I+ 
Sbjct: 842 DAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKL 900

Query: 821 FVLQLLAENV 830
            +   L  N+
Sbjct: 901 NLFWALCYNI 910

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 114/284 (40%), Gaps = 52/284 (18%)

Query: 120 KASKTMNSLKSLSTPSAHVIRD-GNDET--IPSKQLVPGDLCVVKAGDTVPADLRLIECV 176
           + S  ++ L  L+     +I D   +ET  IP + L   D+  +K G  +PAD  +I   
Sbjct: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPAD-GIITRG 454

Query: 177 NFETDEALLTGESLPIAKEASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLN 236
             E DE+L+TGES+ + K+    +P    +  G   +  F ++TV +      ++K    
Sbjct: 455 ESEIDESLMTGESILVPKKTG--FPVIAGSVNGPG-HFYFRTTTVGEETKLANIIKVMKE 511

Query: 237 TEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSF-----LGTTTGTPLHRKLSK 291
            ++ K    ++G       D   + +   GI + A +  F     L  +   P+      
Sbjct: 512 AQLSK--APIQG-----YADYLASIFV-PGILILAVLTFFIWCFILNISANPPV------ 557

Query: 292 XXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAIC------VAVSMIPSSLVVVLTITMSV 345
                                F  N +   + IC      V +   P +L +     + V
Sbjct: 558 --------------------AFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMV 597

Query: 346 GAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQ 389
           G  + A   V+++  + LE   ++     DKTGTLT G M+VK+
Sbjct: 598 GTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKK 641

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 64/286 (22%), Positives = 117/286 (40%), Gaps = 59/286 (20%)

Query: 536 IAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEE 595
           +  F F SS+KR +++     + N      KGA E + +                     
Sbjct: 575 LRRFQFSSSLKRSASI---ASQSNRFFAAVKGAPETIRERLNS--------------VPS 617

Query: 596 DKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYD 655
           D ++++K   + +  G RVLA A K   +    ++      +RD +E+ L F   +  + 
Sbjct: 618 DYDDIYK---SFTRSGSRVLALAYKDLPKMSNSQID---NIDRDEIETGLTFGAFLVFHC 671

Query: 656 PPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRN---------------- 699
           P + +    +K  +++     M+TGD P TA  +A+EVGI+ R                 
Sbjct: 672 PLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLILDEPIDGSSHALV 731

Query: 700 LYHYPKEVVDSMVMTAAQFDQLT-------------------DEEIDNLLLLPLVIARCA 740
           +    + +V      A  FD+                      +++ +++    + AR +
Sbjct: 732 MRDVNETIVKPFNPDADTFDEKEIFQKYDLAVTGHALKLLQGHKQLRDVIRHTWIYARVS 791

Query: 741 PQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSD 786
           P  K  ++  L        M GDG ND  +LK+A+VGIA+ +NG++
Sbjct: 792 PSQKEFILITLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 836

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 117/291 (40%), Gaps = 57/291 (19%)

Query: 123 KTMNSLKSLST----PSA-HVIRDGNDETIPSKQLVPGDLCVVK--AGDT-VPADLRLIE 174
           + + +LK   T    P A +V RDG    + + +L P DL  +   A D+ +P DL LI+
Sbjct: 237 QRLTTLKEFRTMGIKPYAINVFRDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLID 296

Query: 175 --CVNFETDEALLTGESLPIAKEASQVYPATEDTPV-GDRLNLAFASSTVS--------- 222
             C+    +EA+L+GES P+ KE+ ++ PA +   + G   N      T +         
Sbjct: 297 GSCI---VNEAMLSGESTPLLKESIKLRPANDQLQLDGVDKNAVLHGGTKALQVTAPENR 353

Query: 223 -------KGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGS 275
                   G A  +V KTG  T  G + + +      +     +  +    + + A + S
Sbjct: 354 TGVITPPDGGALAVVTKTGFETSQGSLVRVMIFSAERVDVGNKEALYFILFLLIFAIVAS 413

Query: 276 FLGTTTGTPLHRKLSKXXXXXXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSMIPSSL 335
           +     GT + R  SK                           + +  I +  S++P  L
Sbjct: 414 WYVWKEGTRMGRIQSK---------------------------LILDCILIITSVVPPEL 446

Query: 336 VVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMI 386
            + LT+ ++     ++   V   +   +   G ++  C DKTGTLT   ++
Sbjct: 447 PMELTMAVNSSLAALSKFYVYCTEPFRIPYAGRIDVCCFDKTGTLTAEDLV 497

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 117/280 (41%), Gaps = 48/280 (17%)

Query: 120 KASKTMNSLKSLSTPSAH--VIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVN 177
           + S  M+ L SL TPS+   V+ DG+   I  + L P D+  V  G  +PAD  +I    
Sbjct: 393 ETSTAMSKLISL-TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIR-NE 450

Query: 178 FETDEALLTGESLPIAK-EASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLN 236
            E DE+L+TGES+ + K   SQV   + + P                G      ++ G +
Sbjct: 451 TEVDESLITGESMLVEKIVGSQVIGGSVNGP----------------GHFYFRAIRVGED 494

Query: 237 TEIGKIAQSLKGDNSLISKDENKTFWAN-AGITLAATIGSFLGTTTGTPLHRKLSKXXXX 295
           T++  I  ++K   + +SK   + +    AGI +              P    LS     
Sbjct: 495 TKLANIIATMK--KAQLSKAPIQKYADKMAGIFV--------------PFVISLS----A 534

Query: 296 XXXXXXXXXXXXMATQKFVVNKEVAIYAICVAVSM------IPSSLVVVLTITMSVGAKI 349
                       M T   + N E   + +C+ +S+       P +L +     + VG  +
Sbjct: 535 ITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGV 594

Query: 350 MATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQ 389
            A+  V+++  D LE   A+     DKTGTLT G+M V+ 
Sbjct: 595 GASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVEN 634

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 74/161 (45%), Gaps = 35/161 (21%)

Query: 640 FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRN 699
           +V  D    G   I D  +++    V+     GI   M+TGD   +A  +AQ++GI   +
Sbjct: 734 YVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISAND 793

Query: 700 LYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCA 759
           +                 F ++T E                 Q +  +I   +   +  A
Sbjct: 794 V-----------------FSEVTPE-----------------QKRDIVIQLQNNGTERVA 819

Query: 760 MTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDN 800
             GDG+NDSP+L +A++GI++  +G+D+A +A+DIV+ D +
Sbjct: 820 FVGDGINDSPALVEADLGISIS-SGTDIAIEAADIVILDSD 859

>Scas_89.1
          Length = 271

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 84/185 (45%), Gaps = 39/185 (21%)

Query: 638 RDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILP 697
           +  +E +L   GL G+ D  + +   +++    AG+ + MLTGD   TA+ ++    ++ 
Sbjct: 28  KKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLIS 87

Query: 698 RNLYHY-------PKEVV------------------DSMVMTAAQFDQLTDEEIDNLLLL 732
           R  Y +       P+  +                  +S+ M    + Q   E  D ++ L
Sbjct: 88  RGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQ---EFFDIVVDL 144

Query: 733 PLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAMGINGSDV 787
           P VIA RC PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+  GI G + 
Sbjct: 145 PAVIACRCTPQQKADV--ALLIREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE- 198

Query: 788 AKDAS 792
            K AS
Sbjct: 199 GKQAS 203

>CAGL0G06270g 598357..602343 highly similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2, start by
           similarity
          Length = 1328

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 125/312 (40%), Gaps = 65/312 (20%)

Query: 530 EPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDA 589
           E  Y+ +    F+S+ KRMSA++     D++ ++  KGA   +L+  ++    G    DA
Sbjct: 668 EREYQLLNICEFNSTRKRMSAIFRF--PDDSIKLLCKGADSVILERLSE---TGNFYVDA 722

Query: 590 KPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQAL--------------KVSEDLR 635
                       +++E  ++EGLR L  ATK   E +                  +E L 
Sbjct: 723 TT----------RHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLD 772

Query: 636 KNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGI 695
              + +ES L   G   I D  ++     ++   +AGI + +LTGD   TA  I     +
Sbjct: 773 AVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRL 832

Query: 696 LPR--NLYHYPKEVVDSMV------MTAAQFDQLTDEEIDNLLLL--------------- 732
           L    NL    +E  ++        + A     L++ +++ L L+               
Sbjct: 833 LSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLE 892

Query: 733 -----------PLVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM 780
                       ++  R +P  K  ++  + R+     +  GDG ND   ++ A+VG+ +
Sbjct: 893 DYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGI 952

Query: 781 -GINGSDVAKDA 791
            G+ G   A+ A
Sbjct: 953 SGMEGMQAARSA 964

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 114/278 (41%), Gaps = 60/278 (21%)

Query: 598  EEVFKNVETLSSEGLRVLAFATK------------SFTESQALKVS--EDLRKNRDFVES 643
            E   ++++  ++EGLR L ++ K             ++ ++A  V+  E +    + +E 
Sbjct: 939  ERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTVGEIIER 998

Query: 644  DLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHY 703
            DL   G +GI D  ++    A+ +  +AGI + MLTGD     +  A  +G   R ++ Y
Sbjct: 999  DLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGD----KRETAINIGYSCRLIHDY 1054

Query: 704  PKEVV-----DSMVMTAAQFDQLTDE-----------EID---------NLLLLPLVIAR 738
               ++     ++M   A++   +T E            ID         NL L+ L I  
Sbjct: 1055 STVIILAPNDENM---ASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIEL 1111

Query: 739  C-----------APQTKVRMIDALHRREK--FCAMTGDGVNDSPSLKKANVGIAMGINGS 785
            C           +P  K  M+  + + +K       GDG ND   ++ A++G+ +     
Sbjct: 1112 CTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEG 1171

Query: 786  DVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVL 823
              A  +SD  ++   +   L  V  GR       KFVL
Sbjct: 1172 LQASRSSDYSIAQFRYLLKLLLV-HGRYNYIRTSKFVL 1208

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 10/71 (14%)

Query: 329 SMIPSSLVVVLTITMSVGAKIM----------ATRNVVVRKLDSLEALGAVNDVCSDKTG 378
           ++IP SL V + I   + +++M                 R    LE LG V+ + SDKTG
Sbjct: 451 TLIPLSLYVTMEIIKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTG 510

Query: 379 TLTQGKMIVKQ 389
           TLT  +MI ++
Sbjct: 511 TLTDNRMIFRK 521

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 62/150 (41%), Gaps = 41/150 (27%)

Query: 650  LVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVD 709
             + + D  R E    V+  H+ GI   M++GD    A A+A EVGI      H       
Sbjct: 1013 FLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI-----KH------- 1060

Query: 710  SMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREK---FCAMTGDGVN 766
                                     VIA   P+ K   I  +          AM GDG+N
Sbjct: 1061 -------------------------VIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMN 1095

Query: 767  DSPSLKKANVGIAMGINGSDVAKDASDIVL 796
            D+P++  A+VGI++  +GSD+A  + D VL
Sbjct: 1096 DAPAIAAADVGISLA-SGSDLAMISCDFVL 1124

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 322 YAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGA-VNDVCSDKTGTL 380
           +AI V V   P  + +     + VGA I A   ++ R   +   +G+ V  VC DKTGTL
Sbjct: 807 FAIAVFVIACPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTL 866

Query: 381 TQG 383
           T+G
Sbjct: 867 TKG 869

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 115 SYQEYKASKTMNSLKSLSTPSAHVI-----RDGNDET-IPSKQLVPGDLCVVKAGDTVPA 168
           S  + K  KT+ SL SL   +  ++     RD   ET + ++ L  GD  ++K G + PA
Sbjct: 621 SLSKSKMVKTLESLTSLKQRTGILMQADGARDFKKETSVSAEMLELGDHILIKPGAS-PA 679

Query: 169 DLRLIECVNFETDEALLTGESLPIAK-EASQVYPAT 203
              LI     E DE+ LTGES PI      Q++  T
Sbjct: 680 VDALIVQGETEFDESSLTGESRPITHFPGDQIFAGT 715

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 95/409 (23%), Positives = 155/409 (37%), Gaps = 93/409 (22%)

Query: 598  EEVFKNVETLSSEGLRVLAFATKSF---------TESQALKVSEDLRKNR-----DFVES 643
            E+  +++E+ S+EGLR L FA K           T     K S   RK +       +E 
Sbjct: 959  EKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQIED 1018

Query: 644  DLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTA----------------- 686
            +L   G   I D  ++  + A+++  +AGI + MLTGD   TA                 
Sbjct: 1019 ELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDYSTVV 1078

Query: 687  -------------KAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLL- 732
                          AI+QEV     N+ H    V+D    T A F+       DN  L+ 
Sbjct: 1079 ILTTSDENIISKMNAISQEVD--SGNVAHCVI-VIDG--ATLAMFE-------DNPTLMS 1126

Query: 733  ----------PLVIARCAPQTKVRMIDALHRREK--FCAMTGDGVNDSPSLKKANVGIAM 780
                       +V  R +P  K  M+  +   +K       GDG ND   ++ A++G+  
Sbjct: 1127 VFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGV-- 1184

Query: 781  GINGSDVAKDASDIVLSDDNFASILN-AVEEGRRMSDNIQKFVLQLLAENVAQALYLMIG 839
            GI G +  + +     S   F  IL   +  GR       KF+L    + +   L  +I 
Sbjct: 1185 GIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLI- 1243

Query: 840  LCFLDEDRLSVFPLSPVEVLWII----VVTSCFPAMGLGL-EKS-APDIMEKEPQDSKAG 893
                   R ++F  + +   W +     + +  P + +G+ EK   P  +   P+    G
Sbjct: 1244 -----YQRYTMFSGTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMG 1298

Query: 894  ----IFTWEIILDMLIYGTWMAACCLACFITVIYGKGNGELGINCNNSY 938
                 F W I  + +  GT  A   +  F+ ++     GE  ++ N  Y
Sbjct: 1299 RLSKAFNWSIFAEWVFLGT--ANALIITFLNIV---AWGETSLSDNTLY 1342

 Score = 37.4 bits (85), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 54/121 (44%), Gaps = 24/121 (19%)

Query: 324 ICVAVSMIPSSLVVVLTITMSVGAKIM----------ATRNVVVRKLDSLEALGAVNDVC 373
           I +  ++IP SL V + +     +++M          +     VR    LE LG V+ + 
Sbjct: 468 IIMYNTIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIF 527

Query: 374 SDKTGTLTQGKMIVKQAWVPSF-GTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTED 432
           SDKTGTLT  KM+ ++    SF GT  V N++            I  F P Q  + +  D
Sbjct: 528 SDKTGTLTDNKMLFRKL---SFCGTSWVHNATQD----------ISEFKPAQLSNKNDID 574

Query: 433 V 433
           V
Sbjct: 575 V 575

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 70/158 (44%), Gaps = 34/158 (21%)

Query: 655  DPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMT 714
            D  R +    +    + GI++H+L+GD  G  +++A  +GI   N+  +          T
Sbjct: 1024 DSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHA---------T 1074

Query: 715  AAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREK----FCAMTGDGVNDSPS 770
             A+  +   + ++                  R  D+  + ++    FC   GDG ND+  
Sbjct: 1075 PAEKSEYIKDIVEG-----------------RNCDSSSQSKRPVVVFC---GDGTNDAIG 1114

Query: 771  LKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAV 808
            L +A +G+ +   GS+VAK A+D+V+      +IL  +
Sbjct: 1115 LTQATIGVHIN-EGSEVAKLAADVVMLKPKLNNILTMI 1151

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%)

Query: 321 IYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTL 380
           IYAI V +   P  + + + I   + + + A R V+ +  +S+E     + V  DKTGTL
Sbjct: 849 IYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKTGTL 908

Query: 381 TQGKMIV 387
           T+GK+ V
Sbjct: 909 TEGKLTV 915

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 48/86 (55%), Gaps = 3/86 (3%)

Query: 118 EYKASKTMNSLKSLSTPSAHVI-RDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECV 176
            ++A K++ S++SL   SA ++ + G +  I  + L  GD+  V     +P D  +I   
Sbjct: 680 RHRAVKSI-SVRSLQASSAILVDKTGKETEINIRLLQYGDIFKVLPDSRIPTDGTVIS-G 737

Query: 177 NFETDEALLTGESLPIAKEASQVYPA 202
           + E DEAL+TGES+P+ K+   +  A
Sbjct: 738 SSEVDEALITGESMPVPKKCQSIVVA 763

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 133/624 (21%), Positives = 223/624 (35%), Gaps = 147/624 (23%)

Query: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVV--RKLDS---------LEALGAVND 371
            A+ +  S++P SL + + I  +  A I    +V++   KLD           + LG +  
Sbjct: 612  AVILYQSLVPISLYISVEIIKTAQA-IFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEY 670

Query: 372  VCSDKTGTLTQGKMIVKQAWVP--SFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDS 429
            + SDKTGTLTQ  M  K+  +   S+G       +         +    +      K D 
Sbjct: 671  IFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDR 730

Query: 430  TEDVGIITSF--KNKFYNDKLPAGLNSKLFLNWLKTA--------------ALANIAHVY 473
             E +  + +    ++FY D++     SK F++ L                 ALA    V 
Sbjct: 731  EEMINKLQNLAKNSQFYEDEVT--FVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVL 788

Query: 474  QDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTXXXXXXXXXXXXXXLGE----KTSSV 529
             +P  E      DP ++ I     K   P  A                  E    +   +
Sbjct: 789  TEPSKE------DPAKLEI-----KAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGI 837

Query: 530  EPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHR-----VFTKGAFERVLDCCTKWLPDGC 584
            E  ++ +    F+SS KRMS + V +  D+A+      +  KGA   +     K    G 
Sbjct: 838  EKEFQILNILEFNSSRKRMSCI-VKIPGDDANGKPKALLICKGADSVIYSRLDK---TGL 893

Query: 585  NESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFT--------------ESQALKV 630
            NE       E   E+   ++E  ++EGLR L  A +  +               +  +  
Sbjct: 894  NE-------ESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDR 946

Query: 631  SEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIA 690
             E+L K  D +E  LI  G   I D  +     ++    +AGI + +LTGD   TA  I 
Sbjct: 947  EEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIG 1006

Query: 691  QEVGILP---------------RNLYHYPKEVVDSMV------------------MTAAQ 717
                +L                 +L   PK++VD+++                     A+
Sbjct: 1007 FSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAE 1066

Query: 718  FD-----------------QLTDEEIDNLLLL------PLVIARCAPQTKVRMIDALHRR 754
             D                  L+ E++    LL       ++  R +P  K  ++  +  +
Sbjct: 1067 HDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLV--K 1124

Query: 755  EKFCAMT---GDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEG 811
                 MT   GDG ND   ++ AN+G+ +       A  +SD  +    + + L  V   
Sbjct: 1125 NTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVH-- 1182

Query: 812  RRMSDNIQKFVLQLLAENVAQALY 835
                    K+  + LAE + Q  Y
Sbjct: 1183 -------GKWCYKRLAEMIPQFFY 1199

>Kwal_23.3556
          Length = 1597

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 102/271 (37%), Gaps = 46/271 (16%)

Query: 598  EEVFKNVETLSSEGLRVLAFATKSF---------TESQALKVSEDLRKNR-----DFVES 643
            E   + +E  S+ GLR L ++ K            +  A K S + RK +     + VE+
Sbjct: 958  ERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSVGELVET 1017

Query: 644  DLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRN---- 699
             L   G   I D  ++  A A+ +  +AGI + MLTGD   TA  I     ++       
Sbjct: 1018 SLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHDYSTVV 1077

Query: 700  LYHYPKEVVDSMVMTAAQ---------------FDQLTDEEIDNLLLL----------PL 734
            +     E + S +   +Q                  LT  E +  L+            +
Sbjct: 1078 ILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTDSV 1137

Query: 735  VIARCAPQTKVRMIDALHRREK--FCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDAS 792
            +  R +P  K  M+  +   +K       GDG ND   ++ A++G+ +       A  +S
Sbjct: 1138 ICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSS 1197

Query: 793  DIVLSDDNFASILNAVEEGRRMSDNIQKFVL 823
            D  ++   F   L  V  GR       KFVL
Sbjct: 1198 DYSIAQFRFLLKLLLV-HGRYNYVRTTKFVL 1227

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 48/98 (48%), Gaps = 20/98 (20%)

Query: 324 ICVAVSMIPSSLVVVLTITMSVGAKIM--------ATRNVVV--RKLDSLEALGAVNDVC 373
           I +  ++IP SL V + I  ++ +K+M        A  N     R    LE LG V+ + 
Sbjct: 469 IIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYIF 528

Query: 374 SDKTGTLTQGKMIVKQAWVPSFGTITVSNSS--NPFDP 409
           SDKTGTLT  KM+        F  ++V  SS  + FDP
Sbjct: 529 SDKTGTLTDNKMV--------FRALSVCGSSWIHDFDP 558

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 80/184 (43%), Gaps = 40/184 (21%)

Query: 640 FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRN 699
           FV  + +  G   + D  R++    V+     G  V M+TGD    A  ++  +GI   N
Sbjct: 572 FVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNN 631

Query: 700 LYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCA 759
           ++                 ++L                   P+ K  ++  L ++  + A
Sbjct: 632 VFS----------------ERL-------------------PEGKCDVLRQLRQKYDYVA 656

Query: 760 MTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFA----SILNAVEEGRRMS 815
             GDG+NDS +L ++++GI++  N SD+  DA+ IV+ D + A     IL A++  R   
Sbjct: 657 FIGDGINDSVALAESDLGISLSGN-SDIVADAAGIVVLDHSSAPPLTRILYAIDLARATF 715

Query: 816 DNIQ 819
           + ++
Sbjct: 716 NRVK 719

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 8/91 (8%)

Query: 115 SYQEYKASKTMNSLKSLSTPSAHVIRD-GNDETIPSKQLVPGDLCVVKAGDTVPADLRLI 173
           S    +A+ ++  + S S PS   IR+ G+D  +  + L  GD+ V++ G  +PAD  ++
Sbjct: 233 SRARARAADSLARMVS-SAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVL 291

Query: 174 ECVNFETDEALLTGESLPIAKEASQVYPATE 204
           E    E DE+L+TGES  + K     YP + 
Sbjct: 292 EG-EAEVDESLMTGESTLVPK-----YPGSR 316

>Scas_505.4
          Length = 1025

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 73/340 (21%), Positives = 127/340 (37%), Gaps = 50/340 (14%)

Query: 734  LVIARCAPQTKVRMIDALHRR-EKFCAMTGDGVNDSPSLKKANVGIAM-GINGSDVAKDA 791
            +V  R +P  K  ++  + R+        GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 589  VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648

Query: 792  SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA---QALYLMIGLCFLDEDRL 848
             DI +    F   L  V  G      I   +L    +N A      + +    F  +  +
Sbjct: 649  -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIM 706

Query: 849  SVFPLSPVEVLWIIVVTSCFPAMGLGL--EKSAPDIMEKEPQDSKAG----IFTWEIILD 902
              + +S   V + +     FP   +G+  +  +  ++E+ PQ  K G     F+  I   
Sbjct: 707  ESWTMSYYNVFFTV-----FPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWG 761

Query: 903  MLIYGTWMAACC-LACFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCAL 961
             ++ G + +A   +   +   YG     + +N             HG  A      W   
Sbjct: 762  WIVNGFYHSAVVYIGTMLFYRYG-----MALNM------------HGEVAD----HW--- 797

Query: 962  ILAWEVIDMRRSFFKMQPETDTPYTQWMKDIW---SNQFLFWSVIFG-FVSVFPVVYIPV 1017
              +W +     S   +  +      QW K         F+FW + F  + SVFP   I  
Sbjct: 798  --SWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANISR 855

Query: 1018 INKDVFKHK-GIGYEWGLAVAYTIAFWIGAELYKYFKRCY 1056
                V KH  G G  W   +   +   +   ++KY++R Y
Sbjct: 856  EYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMY 895

>Scas_669.3
          Length = 1638

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 18/125 (14%)

Query: 598  EEVFKNVETLSSEGLRVLAFATK--SFTESQA-------LKVSEDLRKNR-----DFVES 643
            E+  + ++  S+EGLR L ++ K     E Q         K+S   RK++     + +E 
Sbjct: 993  EKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEVGEEIEQ 1052

Query: 644  DLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHY 703
            DL   G   I D  ++  + A+++  +AGI + MLTGD     +  A  +G   + +Y Y
Sbjct: 1053 DLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGD----KRETAINIGYSCKLIYDY 1108

Query: 704  PKEVV 708
               V+
Sbjct: 1109 STVVI 1113

 Score = 37.4 bits (85), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 10/76 (13%)

Query: 324 ICVAVSMIPSSLVVVLTITMSVGAKIM----------ATRNVVVRKLDSLEALGAVNDVC 373
           I +  ++IP SL V + I  ++ +K+M                 R    LE LG V+ + 
Sbjct: 491 IIMYNTIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMF 550

Query: 374 SDKTGTLTQGKMIVKQ 389
           SDKTGTLT  KMI ++
Sbjct: 551 SDKTGTLTDNKMIFRK 566

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 118/293 (40%), Gaps = 60/293 (20%)

Query: 598  EEVFKNVETLSSEGLRVLAFATK------------SFTESQA--LKVSEDLRKNRDFVES 643
            E+    ++  S+EGLR L ++ K             + E++      S  + +    +E+
Sbjct: 938  EKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEVGGHIET 997

Query: 644  DLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHY 703
            DL   G   I D  ++    A+++  +AGI + MLTGD     +  A  +G   + +Y Y
Sbjct: 998  DLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGD----KRETAINIGYACKLIYDY 1053

Query: 704  PKEVV-----DSMV--MTAAQFDQLTDEEIDNLLLL------------------------ 732
               V+     D+++  MTA   ++L   +I + +L+                        
Sbjct: 1054 STVVILKKNDDNLISKMTALG-EELDTGKIAHCVLVIDGASLAVFENNPTMMSVFIELCT 1112

Query: 733  ---PLVIARCAPQTKVRMIDALHRREK--FCAMTGDGVNDSPSLKKANVGIAMGINGSD- 786
                ++  R +P  K  ++  +  + K       GDG ND   ++ A++G+  GI G + 
Sbjct: 1113 KTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGV--GITGKEG 1170

Query: 787  -VAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMI 838
              A  +SD  ++   +   L  V  GR       KFVL    + V   L  MI
Sbjct: 1171 LQASRSSDYSIAQFRYLLKLLFV-HGRYNYVRTSKFVLCTFYKEVLFYLTQMI 1222

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 10/76 (13%)

Query: 324 ICVAVSMIPSSLVVVLTITMSVGAKIM----------ATRNVVVRKLDSLEALGAVNDVC 373
           I +  ++IP SL V   I  ++ +K+M          +      R    LE LG V+ + 
Sbjct: 474 IIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRTATILEELGQVSYIF 533

Query: 374 SDKTGTLTQGKMIVKQ 389
           SDKTGTLT  KMI ++
Sbjct: 534 SDKTGTLTDNKMIFRK 549

>Scas_636.16
          Length = 1554

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 112/522 (21%), Positives = 193/522 (36%), Gaps = 112/522 (21%)

Query: 598  EEVFKNVETLSSEGLRVLAFATK--SFTESQALK------------VSEDLRKNRDFVES 643
            E+   ++E  ++EGLR L    +  S++E Q                 E+L    D +E 
Sbjct: 873  EKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIER 932

Query: 644  DLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHY 703
            DL+  G   I D  +     ++    +AGI + +LTGD   TA  I     +L  ++   
Sbjct: 933  DLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELL 992

Query: 704  ---------------PKEVVDSMV----------------MTAAQFDQ------------ 720
                           P E+V+++V                + AA+ D             
Sbjct: 993  VIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIID 1052

Query: 721  -------LTDEEIDNLLLL------PLVIARCAPQTKVRMIDALHRREKFCAMT---GDG 764
                   LT + +    LL       ++  R +P  K  ++  +  ++    MT   GDG
Sbjct: 1053 GEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLV--KDTLDVMTLAIGDG 1110

Query: 765  VNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 824
             ND   ++ A+VG+ +       A   SD  +    + + L  V  G+     + + + Q
Sbjct: 1111 SNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLV-HGKWCYKRLAEMIPQ 1169

Query: 825  LLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLGL--EKSAPDI 882
               +NV   L L       D D   +F  + +   + +  TS  P + LG+  +  +  +
Sbjct: 1170 FFYKNVIFTLALFWYGVHNDFDGSYLFEYTYL-TFYNLAFTS-LPVIFLGILDQDVSATV 1227

Query: 883  MEKEPQDSKAGIFTWEI----ILDMLIYGTWMAACCLACFITVIYGKGN--GELGINCNN 936
                PQ  ++GI   E      L  +  G + +  C   F  +IY K N   + G+  ++
Sbjct: 1228 SMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICY-FFPYLIYRKTNIITQNGLGLDH 1286

Query: 937  SYSESCDNVYHGRAATFASMTWCALILAWEVI--DMRRSFFKMQPETDTPYTQWMKDIWS 994
             Y       Y G   T  ++T C   +  E    D   +FF     +   Y  W   IWS
Sbjct: 1287 RY-------YVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFL--STIVYFGWTG-IWS 1336

Query: 995  N---QFLFW---SVIFGFVSVFPVVYI-------PVINKDVF 1023
            +    + FW   S ++G  S + V ++       P    DVF
Sbjct: 1337 SSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVF 1378

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of
           the Drs2p-like family of the P-type ATPase superfamily
           of membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 58/128 (45%), Gaps = 20/128 (15%)

Query: 324 ICVAVSMIPSSLVVVLTITMSVGAKIM--------ATRNVVV--RKLDSLEALGAVNDVC 373
           I +  ++IP SL V + I   V +K+M        A  N     R    LE LG V+ + 
Sbjct: 505 IIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIF 564

Query: 374 SDKTGTLTQGKMIVKQ------AWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKH 427
           SDKTGTLT  KMI ++      +W+ +   + + NS + F+        + R  P  +  
Sbjct: 565 SDKTGTLTDNKMIFRKFSLCGSSWLHN---VDLGNSEDNFEDNRDNTNSL-RLPPKAHNG 620

Query: 428 DSTEDVGI 435
            S + V I
Sbjct: 621 SSIDVVSI 628

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 24/112 (21%)

Query: 598  EEVFKNVETLSSEGLRVLAFATK-------------------SFTESQALKVSEDLRKNR 638
            E   + ++  S+EGLR L +A K                   S T+ + +KV E   +  
Sbjct: 1019 ERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTD-RKIKVDEAGAE-- 1075

Query: 639  DFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIA 690
              +E  L   G+  I D  +   + A+++  +AGI + MLTGD   TA  I 
Sbjct: 1076 --IEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIG 1125

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 81/191 (42%), Gaps = 31/191 (16%)

Query: 529  VEPHYKHIAEFPFDSSIKRMSAVY-----VSLDEDNAHRVFTKGAFERVLDCCTKWLPDG 583
            V+  ++ +    F+SS KRMS +         DE  A  +  KGA   +     +     
Sbjct: 875  VQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKAL-LICKGADSVIYSRLDR----- 928

Query: 584  CNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQ-----------ALKVS- 631
              ++DA  +     E+   ++E  ++EGLR L  A +  T S+           A  V+ 
Sbjct: 929  -TQNDATLL-----EKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTN 982

Query: 632  --EDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAI 689
              E+L K  D +E +LI  G   I D  +     ++    +AGI + +LTGD   TA  I
Sbjct: 983  REEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINI 1042

Query: 690  AQEVGILPRNL 700
                 +L  ++
Sbjct: 1043 GFSCNVLNNDM 1053

>YGR208W (SER2) [2158] chr7 (911886..912815) Phosphoserine
           phosphatase, involved in synthesis of serine from
           3-phosphoglycerate [930 bp, 309 aa]
          Length = 309

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 72/169 (42%), Gaps = 28/169 (16%)

Query: 624 ESQALKVSEDLRKNR-DFVESDL----IFQGLV--GIYDPPRQE---TAGA---VKQFHK 670
           E Q  +++E    N  DF ES      + QGL    +YD  +Q+   T G     K  HK
Sbjct: 118 EEQVHEITERAMNNELDFKESLRERVKLLQGLQVDTLYDEIKQKLEVTKGVPELCKFLHK 177

Query: 671 AGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLL 730
               + +L+G F   A  I  ++G+             D       + D  TD ++    
Sbjct: 178 KNCKLAVLSGGFIQFAGFIKDQLGL-------------DFCKANLLEVD--TDGKLTGKT 222

Query: 731 LLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIA 779
           L P+V  +C  +T +++ +  +   +   M GDG ND P++  A  GIA
Sbjct: 223 LGPIVDGQCKSETLLQLCNDYNVPVEASCMVGDGGNDLPAMATAGFGIA 271

>Scas_227.0d
          Length = 307

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 7/83 (8%)

Query: 540 PFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEE 599
           PF+S+ ++   + V   E N +R F KGA E V + C        N  D+  +   +K++
Sbjct: 190 PFEST-RKWGGIIVKYKESNLYRFFIKGAAEIVSNNCHSKR----NSDDS--IVTLNKDQ 242

Query: 600 VFKNVETLSSEGLRVLAFATKSF 622
           + K +E L+++ LR L+ A + F
Sbjct: 243 INKEIENLANDALRALSLAHRDF 265

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 89/410 (21%), Positives = 152/410 (37%), Gaps = 86/410 (20%)

Query: 598  EEVFKNVETLSSEGLRVLAFATKSFTESQALKVS--------------EDLRKNRDFVES 643
            E+   ++E  ++EGLR L  A +  T S+  + +              E L    D +E 
Sbjct: 890  EKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIER 949

Query: 644  DLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNL--- 700
            DLI  G   I D  +     ++    +AGI + +LTGD   TA  I     +L  ++   
Sbjct: 950  DLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1009

Query: 701  ---------YHY---PKEVVDSMV----------------MTAAQFDQ------------ 720
                       Y   P EVV+S++                +  A+ D             
Sbjct: 1010 VVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVID 1069

Query: 721  -------LTDEEIDNLLLL------PLVIARCAPQTKVRMIDALHRREKFCAMT---GDG 764
                   LT +++    LL       ++  R +P  K  ++  +  +     MT   GDG
Sbjct: 1070 GDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLV--KNTLDVMTLAIGDG 1127

Query: 765  VNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 824
             ND   ++ A+VGI +       A   SD  +    + + L  V  GR     + + + +
Sbjct: 1128 SNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLV-HGRWSYKRLSEMIPE 1186

Query: 825  LLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLG-LEKSAPDIM 883
               +NV   L L     + + D   +F  + + + + +  TS  P + LG L++   D +
Sbjct: 1187 FFYKNVIFTLALFWYGIYNNFDGSYLFEYTYL-MFYNLAFTS-IPVILLGILDQDVNDTI 1244

Query: 884  E-KEPQDSKAGIFTWEI----ILDMLIYGTWMAACCLACFITVIYGKGNG 928
                PQ  + GI   E      L  +  G + +  C   F   +  K NG
Sbjct: 1245 SLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICF--FFPYLLYKRNG 1292

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 88/407 (21%), Positives = 156/407 (38%), Gaps = 85/407 (20%)

Query: 598  EEVFKNVETLSSEGLRVLAFATKSFTESQALKVSE--------------DLRKNRDFVES 643
            E+   ++E  ++EGLR L  A +  + S+  K +E              +L    D +E 
Sbjct: 894  EKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIER 953

Query: 644  DLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILP------ 697
            +LI  G   I D  +      ++   +AGI + +LTGD   TA  I     +L       
Sbjct: 954  ELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELL 1013

Query: 698  ---------RNLYHYPKEVVDSMV---------MTAAQ---FDQLTDEE---------ID 727
                     +     P E+VD+++         +T ++   F+   D E         ID
Sbjct: 1014 VIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVID 1073

Query: 728  ---------------NLLLL-----PLVIARCAPQTKVRMIDALHRREKFCAMT---GDG 764
                             LLL      ++  R +P  K  ++  +  ++    MT   GDG
Sbjct: 1074 GDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLV--KDSLDVMTLAIGDG 1131

Query: 765  VNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 824
             ND   ++ A+VGI +       A   SD  +    + + L  V  GR     + + + +
Sbjct: 1132 SNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLV-HGRWSYKRLAEMIPE 1190

Query: 825  LLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLG-LEKSAPDIM 883
               +N+  AL L     + D D   ++  + + + + +  TS  P + LG L++   D +
Sbjct: 1191 FFYKNMIFALALFWYGIYNDFDGSYLYEYTYM-MFYNLAFTS-LPVIFLGILDQDVNDTI 1248

Query: 884  E-KEPQDSKAGIFTWE----IILDMLIYGTWMAACCLACFITVIYGK 925
                PQ  + GI   E      L  ++ G + +  C   F  ++Y K
Sbjct: 1249 SLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICF-FFPYLVYHK 1294

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 79/186 (42%), Gaps = 30/186 (16%)

Query: 529  VEPHYKHIAEFPFDSSIKRMSAVYV----SLDEDNAHRVFTKGAFERVLDCCTKWLPDGC 584
            V+  Y+ +    F+S+ KRMS +      + +E+    +  KGA   +    +K      
Sbjct: 875  VQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSK------ 928

Query: 585  NESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATK--SFTESQ-----------ALKVS 631
              +D K +     E+   ++E  ++EGLR L  A +  S+ E Q           AL   
Sbjct: 929  -NNDEKLL-----EKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDR 982

Query: 632  ED-LRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIA 690
            ED + K  D +E +L   G   I D  +     ++    +AGI + +LTGD   TA  I 
Sbjct: 983  EDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIG 1042

Query: 691  QEVGIL 696
                +L
Sbjct: 1043 FSCNLL 1048

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 93/448 (20%), Positives = 171/448 (38%), Gaps = 93/448 (20%)

Query: 529  VEPHYKHIAEFPFDSSIKRMSAVYV--SLDEDNAHR--VFTKGAFERVLDCCTKWLPDGC 584
            V+  ++ +    F+S+ KRMS +    + DE++  +  +  KGA   +     +      
Sbjct: 837  VQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDR------ 890

Query: 585  NESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATK--------SFTESQALKVS----- 631
            + +D K +     E    ++E  ++EGLR L  A +        ++ E + L  +     
Sbjct: 891  SRNDPKLL-----ERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNR 945

Query: 632  -EDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIA 690
             E L +  D +E  L+  G   I D  +     ++     AGI + +LTGD   TA  I 
Sbjct: 946  EEALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIG 1005

Query: 691  QEVGILP---------------RNLYHYPKEVVDSMV----------------MTAAQFD 719
                +L                 +L     +VV +++                + AA+ D
Sbjct: 1006 FSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEELAAARKD 1065

Query: 720  Q-------------------LTDEEIDNLLLL------PLVIARCAPQTKVRMIDALHRR 754
                                L  E+I    LL       ++  R +P  K  ++  +   
Sbjct: 1066 HTPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVKES 1125

Query: 755  EKFCAMT-GDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRR 813
                 +  GDG ND   ++ A+VGI +       A  ++D  +    + + L  V  GR 
Sbjct: 1126 LDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLVLV-HGRW 1184

Query: 814  MSDNIQKFVLQLLAENVAQALYLM-IGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMG 872
                + + + Q   +N+   L L   G+C  + D   +F  + + + + +  TS  P + 
Sbjct: 1185 SYKRLAEMIPQFFYKNITFTLALFWFGIC-SNYDGSYLFEYTYL-MFYNLAFTS-LPVIF 1241

Query: 873  LG-LEKSAPDIME-KEPQDSKAGIFTWE 898
            LG +++ A D++    PQ  K GI   E
Sbjct: 1242 LGIMDQDASDVLSVVVPQLYKVGILRTE 1269

>Scas_576.8
          Length = 1591

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 95/432 (21%), Positives = 161/432 (37%), Gaps = 80/432 (18%)

Query: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVR-KLDS---------LEALGAVNDV 372
            A+ +  S++P SL + + I  +  A  +    ++   KLD           + +G +  +
Sbjct: 621  AVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDMGQIEYI 680

Query: 373  CSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTED 432
             SDKTGTLTQ  M  K+  +           +        GI++       + +     D
Sbjct: 681  FSDKTGTLTQNVMEFKKCTINGISYGRAYTEALAGLRKRQGIDVEEEGRREKEEIAKDRD 740

Query: 433  VGIIT----SFKNKFYNDKLPAGLNSKLFLNWLKTA--------------ALANIAHVYQ 474
              I T    S  ++FY D +     SK F+N LK A              ALA    V  
Sbjct: 741  TMINTLRNLSHNSQFYPDDIT--FISKEFVNDLKGASGDMQQKCCEHFMLALALCHSVLV 798

Query: 475  DPETEEWKA----HGDPTEIAIQVFAHKLDMPRNALTXXXXXXXXXXXXXXLGEKTSSVE 530
            +P   + K        P E A+   A  +       T              L  +   V+
Sbjct: 799  EPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGKTKTG-----------LIIEVQGVQ 847

Query: 531  PHYKHIAEFPFDSSIKRMSAVY----VSLDEDNAHRVFTKGA----FERVLDCCTKWLPD 582
              ++ +    F+S+ KRMS +      + D++    +  KGA    + R+    TK   +
Sbjct: 848  KEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRL---GTK---N 901

Query: 583  GCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVS----------- 631
            G N       +E   E+   ++E  ++EGLR L  A +  +  + L+ +           
Sbjct: 902  GAN-------SENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVT 954

Query: 632  ---EDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKA 688
               E L    D +E +L   G   I D  +     ++    +AGI + +LTGD   TA  
Sbjct: 955  NREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAIN 1014

Query: 689  IAQEVGILPRNL 700
            I     +L  ++
Sbjct: 1015 IGFSCNLLNNDM 1026

>YOR273C (TPO4) [5059] chr15 complement(834449..836428) Polyamine
            transport protein, member of the multidrug-resistance
            12-spanner (DHA12) family of the major facilitator
            superfamily (MFS-MDR) [1980 bp, 659 aa]
          Length = 659

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 10/81 (12%)

Query: 997  FLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGLAVAYTIAFWIGAELYKYFKRCY 1056
            F+F +++FGF   + V+Y     + V+ H  +G      +   +  WIGA  Y Y  R Y
Sbjct: 328  FIF-AILFGFFEAYAVIY-----RGVY-HMSMGISGLPFIGIGVGLWIGAFFYLYIDRKY 380

Query: 1057 FKNK---GRAQNPEKDLESRR 1074
               K   G     EK+  S+R
Sbjct: 381  LFPKPPAGTQPLTEKERTSKR 401

>Scas_499.3
          Length = 346

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 14/93 (15%)

Query: 123 KTMNSLKSLST----PSA-HVIRDGNDETIPSKQLVPGD---LCVVKAGDTVPADLRLIE 174
           + + SLK   T    P A +V+R+ +  T+ + +L+  D   L        +P D+ LI+
Sbjct: 238 QRLQSLKEFRTMGIKPFAINVLRNEHWVTLQTNELLTMDVVSLTTTTEESAIPCDMILID 297

Query: 175 --CVNFETDEALLTGESLPIAKEASQVYPATED 205
             C+    +EA+ +GES P+ KE+ Q+ P  +D
Sbjct: 298 GACI---VNEAM-SGESTPLLKESIQLRPGEDD 326

>YBR047W (YBR047W) [238] chr2 (331793..332320) Protein of unknown
           function [528 bp, 175 aa]
          Length = 175

 Score = 31.2 bits (69), Expect = 2.8,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query: 522 LGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWL- 580
           L E ++ +E HYK +  F  +  IK+++  Y   + D    VF    F   L+   ++  
Sbjct: 57  LPEDSNYIEKHYKELQVFLNEFLIKKLNKTYADFEGDPDELVFQLEKFIE-LEVTPRYTN 115

Query: 581 ---PDGCNE 586
              PDGC E
Sbjct: 116 HSAPDGCEE 124

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 32,884,103
Number of extensions: 1395008
Number of successful extensions: 3895
Number of sequences better than 10.0: 89
Number of HSP's gapped: 3811
Number of HSP's successfully gapped: 200
Length of query: 1084
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 972
Effective length of database: 12,718,893
Effective search space: 12362763996
Effective search space used: 12362763996
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)