Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.88439537619460.0
Scas_685.1138437213630.0
KLLA0E07942g39037613540.0
ACR166W38837313031e-180
CAGL0F06853g38837312661e-174
YKL021C (MAK11)46838912631e-173
Kwal_23.50357441381564e-11
KLLA0D07546g6473131512e-10
Scas_624.1112051471512e-10
ADL082C5691601432e-09
YDL145C (COP1)12011471432e-09
Kwal_56.2452612101471432e-09
CAGL0G09845g5001441413e-09
Scas_695.153272911393e-09
AAL009C3032941384e-09
YJL112W (MDV1)7141751404e-09
CAGL0L02629g7953151404e-09
Scas_631.174741381395e-09
Sklu_2442.23033041358e-09
KLLA0D04840g3033041351e-08
Sklu_2172.62631551331e-08
Scas_704.406081571351e-08
KLLA0F04884g12122181352e-08
Sklu_2160.37601621342e-08
CAGL0H03729g3032931313e-08
Scas_707.227301521333e-08
Sklu_2291.49971321334e-08
ADR077C12041451325e-08
CAGL0L00781g6731631315e-08
YIL046W (MET30)6401601316e-08
YFL009W (CDC4)7791471316e-08
CAGL0I03718g12011471317e-08
YMR116C (ASC1)3191431287e-08
AGL024W7561301299e-08
AEL269C4552141281e-07
YGL137W (SEC27)8891921291e-07
Scas_465.410021331291e-07
Kwal_56.239209373501281e-07
AEL246C8151421272e-07
KLLA0F11231g4341731252e-07
KLLA0E12287g3262661242e-07
CAGL0A00561g4121371252e-07
KLLA0B01958g8901921263e-07
YPR178W (PRP4)4651191243e-07
Kwal_23.57696271581244e-07
YCR072C5152311234e-07
Kwal_26.89534581621226e-07
KLLA0E23529g8262531236e-07
Scas_692.254881611226e-07
KLLA0F27511g6231561226e-07
YNL006W (LST8)3032931199e-07
Kwal_23.64297502531211e-06
AGR180W8062441211e-06
ADR176W4611661191e-06
YGL004C (RPN14)4171361182e-06
CAGL0H08932g9021621192e-06
AFL118W8321921182e-06
YOR269W (PAC1)4941581163e-06
CAGL0M02277g4271461154e-06
KLLA0E18986g9901081155e-06
Kwal_56.24163729851146e-06
Scas_713.509831421146e-06
Kwal_26.87764331401137e-06
CAGL0K00957g7932131137e-06
Sklu_2420.24412291128e-06
Kwal_27.111269961211139e-06
AGR168W8251541139e-06
Scas_702.168162081121e-05
KLLA0F10263g6821581121e-05
YBR103W (SIF2)5351451111e-05
Kwal_26.7570218901081e-05
Scas_721.115*3181371091e-05
YPL183C10131291111e-05
KLLA0E04741g4591401102e-05
Scas_720.45755821102e-05
Scas_592.4*3181371082e-05
AGL234W6291581092e-05
CAGL0M04279g9401421093e-05
Kwal_0.2123031291073e-05
ACR137W4252651073e-05
Scas_721.328221421074e-05
AGL196C9351621074e-05
KLLA0D16390g9361331075e-05
CAGL0C03608g6431621075e-05
Kwal_47.175554171311065e-05
Sklu_2431.127491521065e-05
KLLA0A08822g5821831066e-05
CAGL0M05335g8061421066e-05
Scas_630.66211221057e-05
AEL314W7151411057e-05
Kwal_23.63245143101057e-05
AFR199C3342631039e-05
Scas_585.84601381049e-05
KLLA0A04928g8612081041e-04
Kwal_27.126677211531041e-04
YBR198C (TAF5)7981681031e-04
KLLA0F13244g8142431031e-04
Kwal_23.53514741191021e-04
CAGL0M09845g9361641031e-04
KLLA0E11297g5121311021e-04
CAGL0D02090g277881002e-04
Sklu_2384.33282881012e-04
YPL151C (PRP46)4511331012e-04
AER263C5131401022e-04
Kwal_55.220674511381012e-04
YLR409C (UTP21)9392061022e-04
YLR129W (DIP2)9433551022e-04
KLLA0C07425g4441401012e-04
KLLA0B02827g9421721012e-04
Scas_718.6*5461351012e-04
Kwal_27.115858232321003e-04
Sklu_1926.55091811003e-04
CAGL0K12188g5351211003e-04
KLLA0C08547g515140994e-04
CAGL0E02805g8402051004e-04
CAGL0J03476g517287994e-04
AFL009C41394984e-04
Kwal_27.12053755146994e-04
CAGL0D05588g47776985e-04
Kwal_33.15475783227995e-04
YGL003C (CDH1)566165985e-04
ADL322C501154985e-04
Scas_680.11347102976e-04
CAGL0L10890g457151976e-04
Sklu_2423.1944153986e-04
CAGL0A00605g640158976e-04
YMR146C (TIF34)34757967e-04
Kwal_23.4118939164978e-04
KLLA0F19734g1133244978e-04
CAGL0E00561g836214978e-04
CAGL0C00737g816237960.001
Sklu_2364.4555173960.001
YNL317W (PFS2)465301960.001
CAGL0L06952g347237950.001
Scas_629.12671197960.001
CAGL0M04081g455301950.001
AAR057W922144950.001
KLLA0F21406g705154950.001
Scas_720.95515123940.001
Scas_397.2410117940.001
Sklu_2416.5459138930.002
Scas_603.558978940.002
AFL056C976117940.002
CAGL0C01441g1005133940.002
AFL007C551166930.002
YBL008W (HIR1)840143930.002
Kwal_34.15818349238920.002
CAGL0L09757g326277920.002
YCR084C (TUP1)713209930.002
KLLA0E07073g452298920.003
ACL099W357277910.003
Scas_692.29456150920.003
ADL184W449295920.003
KLLA0F22000g793274920.003
Kwal_14.906328130910.003
ADR264C34695910.003
AER337W445141910.003
Sklu_2173.2515125900.004
CAGL0L03201g579151910.004
AER081C102354910.004
KLLA0C08976g911162900.005
KLLA0A08866g423172890.005
Sklu_675.1308240880.007
Kwal_47.17465800153890.008
YOR272W (YTM1)460154880.008
CAGL0K09284g911162880.009
YCR057C (PWP2)923122880.009
Scas_720.83d915140880.010
CAGL0L02761g419241870.011
CAGL0M08646g337240860.011
KLLA0D00814g408141870.011
Scas_512.3534185870.012
CAGL0C02937g467161860.012
YGR200C (ELP2)788197870.013
Scas_719.30940155860.014
KLLA0E18139g326192850.015
Scas_705.4649055860.015
YPL247C523177860.016
Kwal_47.1908332436850.016
Scas_605.18424136850.017
YKL018W (SWD2)329135850.017
Kwal_23.6240913141850.020
ADR242C521154840.022
Kwal_26.8975445143830.031
Scas_657.13411155830.031
Kwal_26.862842261830.032
Scas_679.28815231830.033
Scas_659.947597830.033
Scas_542.5327188820.034
Kwal_27.12070418129820.035
Scas_711.1169547830.036
Scas_442.2*795158830.039
Kwal_33.1497181886820.045
Kwal_55.21450503309810.054
Scas_658.1442114810.060
Kwal_55.2155935168800.069
Kwal_27.12586509123800.074
YLR222C (UTP13)817195800.085
CAGL0J04818g65475800.089
YEL056W (HAT2)401136790.090
Scas_670.21595197790.093
AAL157C479107790.098
CAGL0B03575g419166780.11
YGL100W (SEH1)349259780.12
Sklu_2406.11426189780.12
ACR097W467186780.12
AER114W63378780.13
Kwal_47.17567590150780.13
CAGL0B02013g112082790.13
Scas_700.27*43366780.14
KLLA0F17237g523167780.14
Sklu_2364.241149760.19
KLLA0D06787g43649760.19
Kwal_26.7655743109770.20
KLLA0A01650g40169750.25
Scas_689.6213982760.25
YMR102C83491760.26
YER082C (UTP7)554107750.29
KLLA0F15598g478101750.30
Sklu_1880.3471319750.31
KLLA0E21879g33361740.31
YLL011W (SOF1)48923750.32
KLLA0F07403g34759740.32
Scas_719.5262888750.33
YKR036C (CAF4)659247750.34
KLLA0C07513g439142740.39
CAGL0J07854g43283740.39
Kwal_56.22345396247730.45
KLLA0D12760g49344730.46
Kwal_33.15591714120730.51
Kwal_47.17572434139730.52
KLLA0E21263g429290730.53
Scas_717.6890860730.59
ABL141C51873720.63
YKL213C (DOA1)71592730.63
YER124C (DSE1)57360720.65
Scas_706.24460191720.66
YNL182C (IPI3)55594720.67
AGR067W1125204730.68
CAGL0G04345g71178720.71
AER255C467295720.74
YOR212W (STE4)42359710.84
ACR091W32863710.89
ACR017W423138710.97
Scas_660.8510117711.00
Scas_712.3439936701.0
Scas_721.7325212701.1
AFL157C43843701.1
ABR101C82763701.2
CAGL0G00704g44075701.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.884
         (390 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.884                                                           754   0.0  
Scas_685.11                                                           529   0.0  
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...   526   0.0  
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...   506   e-180
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...   492   e-174
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...   491   e-173
Kwal_23.5035                                                           65   4e-11
KLLA0D07546g complement(647984..649927) some similarities with s...    63   2e-10
Scas_624.11                                                            63   2e-10
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    60   2e-09
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    60   2e-09
Kwal_56.24526                                                          60   2e-09
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    59   3e-09
Scas_695.15                                                            58   3e-09
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    58   4e-09
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    59   4e-09
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    59   4e-09
Scas_631.17                                                            58   5e-09
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            57   8e-09
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    57   1e-08
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       56   1e-08
Scas_704.40                                                            57   1e-08
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    57   2e-08
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         56   2e-08
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    55   3e-08
Scas_707.22                                                            56   3e-08
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         56   4e-08
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    55   5e-08
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    55   5e-08
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    55   6e-08
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    55   6e-08
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    55   7e-08
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    54   7e-08
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    54   9e-08
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    54   1e-07
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    54   1e-07
Scas_465.4                                                             54   1e-07
Kwal_56.23920                                                          54   1e-07
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    54   2e-07
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    53   2e-07
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    52   2e-07
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    53   2e-07
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    53   3e-07
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    52   3e-07
Kwal_23.5769                                                           52   4e-07
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    52   4e-07
Kwal_26.8953                                                           52   6e-07
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    52   6e-07
Scas_692.25                                                            52   6e-07
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    52   6e-07
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    50   9e-07
Kwal_23.6429                                                           51   1e-06
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    51   1e-06
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    50   1e-06
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    50   2e-06
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    50   2e-06
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    50   2e-06
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    49   3e-06
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    49   4e-06
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    49   5e-06
Kwal_56.24163                                                          49   6e-06
Scas_713.50                                                            49   6e-06
Kwal_26.8776                                                           48   7e-06
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    48   7e-06
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            48   8e-06
Kwal_27.11126                                                          48   9e-06
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    48   9e-06
Scas_702.16                                                            48   1e-05
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    48   1e-05
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    47   1e-05
Kwal_26.7570                                                           46   1e-05
Scas_721.115*                                                          47   1e-05
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    47   1e-05
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    47   2e-05
Scas_720.45                                                            47   2e-05
Scas_592.4*                                                            46   2e-05
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    47   2e-05
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    47   3e-05
Kwal_0.212                                                             46   3e-05
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    46   3e-05
Scas_721.32                                                            46   4e-05
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    46   4e-05
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    46   5e-05
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    46   5e-05
Kwal_47.17555                                                          45   5e-05
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      45   5e-05
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    45   6e-05
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    45   6e-05
Scas_630.6                                                             45   7e-05
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    45   7e-05
Kwal_23.6324                                                           45   7e-05
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    44   9e-05
Scas_585.8                                                             45   9e-05
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    45   1e-04
Kwal_27.12667                                                          45   1e-04
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    44   1e-04
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    44   1e-04
Kwal_23.5351                                                           44   1e-04
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    44   1e-04
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    44   1e-04
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    43   2e-04
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            44   2e-04
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    44   2e-04
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    44   2e-04
Kwal_55.22067                                                          44   2e-04
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    44   2e-04
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    44   2e-04
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    44   2e-04
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    44   2e-04
Scas_718.6*                                                            44   2e-04
Kwal_27.11585                                                          43   3e-04
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         43   3e-04
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    43   3e-04
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    43   4e-04
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    43   4e-04
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    43   4e-04
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    42   4e-04
Kwal_27.12053                                                          43   4e-04
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    42   5e-04
Kwal_33.15475                                                          43   5e-04
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    42   5e-04
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    42   5e-04
Scas_680.11                                                            42   6e-04
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    42   6e-04
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             42   6e-04
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    42   6e-04
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    42   7e-04
Kwal_23.4118                                                           42   8e-04
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    42   8e-04
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    42   8e-04
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    42   0.001
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         42   0.001
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    42   0.001
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    41   0.001
Scas_629.12                                                            42   0.001
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    41   0.001
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    41   0.001
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    41   0.001
Scas_720.95                                                            41   0.001
Scas_397.2                                                             41   0.001
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           40   0.002
Scas_603.5                                                             41   0.002
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    41   0.002
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    41   0.002
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    40   0.002
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    40   0.002
Kwal_34.15818                                                          40   0.002
CAGL0L09757g complement(1046898..1047878) highly similar to sp|P...    40   0.002
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    40   0.002
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    40   0.003
ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH] complement(1...    40   0.003
Scas_692.29                                                            40   0.003
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    40   0.003
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    40   0.003
Kwal_14.906                                                            40   0.003
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    40   0.003
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    40   0.003
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            39   0.004
CAGL0L03201g complement(366795..368534) some similarities with s...    40   0.004
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    40   0.004
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    39   0.005
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    39   0.005
Sklu_675.1 YMR146C, Contig c675 761-1687                               39   0.007
Kwal_47.17465                                                          39   0.008
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    39   0.008
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    39   0.009
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    39   0.009
Scas_720.83d                                                           39   0.010
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    38   0.011
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    38   0.011
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    38   0.011
Scas_512.3                                                             38   0.012
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    38   0.012
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    38   0.013
Scas_719.30                                                            38   0.014
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    37   0.015
Scas_705.46                                                            38   0.015
YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein ...    38   0.016
Kwal_47.19083                                                          37   0.016
Scas_605.18                                                            37   0.017
YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 a...    37   0.017
Kwal_23.6240                                                           37   0.020
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    37   0.022
Kwal_26.8975                                                           37   0.031
Scas_657.13                                                            37   0.031
Kwal_26.8628                                                           37   0.032
Scas_679.28                                                            37   0.033
Scas_659.9                                                             37   0.033
Scas_542.5                                                             36   0.034
Kwal_27.12070                                                          36   0.035
Scas_711.11                                                            37   0.036
Scas_442.2*                                                            37   0.039
Kwal_33.14971                                                          36   0.045
Kwal_55.21450                                                          36   0.054
Scas_658.1                                                             36   0.060
Kwal_55.21559                                                          35   0.069
Kwal_27.12586                                                          35   0.074
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    35   0.085
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    35   0.089
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    35   0.090
Scas_670.21                                                            35   0.093
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    35   0.098
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    35   0.11 
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    35   0.12 
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      35   0.12 
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    35   0.12 
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    35   0.13 
Kwal_47.17567                                                          35   0.13 
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    35   0.13 
Scas_700.27*                                                           35   0.14 
KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces...    35   0.14 
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         34   0.19 
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    34   0.19 
Kwal_26.7655                                                           34   0.20 
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    33   0.25 
Scas_689.6                                                             34   0.25 
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    34   0.26 
YER082C (UTP7) [1514] chr5 complement(324268..325932) Component ...    33   0.29 
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    33   0.30 
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            33   0.31 
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    33   0.31 
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    33   0.32 
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    33   0.32 
Scas_719.52                                                            33   0.33 
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    33   0.34 
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    33   0.39 
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    33   0.39 
Kwal_56.22345                                                          33   0.45 
KLLA0D12760g complement(1090428..1091909) weakly similar to sgd|...    33   0.46 
Kwal_33.15591                                                          33   0.51 
Kwal_47.17572                                                          33   0.52 
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    33   0.53 
Scas_717.68                                                            33   0.59 
ABL141C [451] [Homologous to ScYNL182C - SH] (131672..133228) [1...    32   0.63 
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    33   0.63 
YER124C (DSE1) [1554] chr5 complement(407338..409059) Protein in...    32   0.65 
Scas_706.24                                                            32   0.66 
YNL182C (IPI3) [4418] chr14 complement(295960..297627) Protein c...    32   0.67 
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    33   0.68 
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    32   0.71 
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    32   0.74 
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    32   0.84 
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    32   0.89 
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    32   0.97 
Scas_660.8                                                             32   1.00 
Scas_712.34                                                            32   1.0  
Scas_721.7                                                             32   1.1  
AFL157C [3038] [Homologous to ScYPL247C - SH] (140404..141720) [...    32   1.1  
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    32   1.2  
CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces cer...    32   1.3  
AER439W [2939] [Homologous to ScYGL213C (SKI8) - SH] complement(...    31   1.3  
KLLA0F10593g complement(976698..978008) similar to sp|P53136 Sac...    31   1.4  
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    31   1.5  
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    31   1.5  
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    31   1.6  
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          31   1.6  
KLLA0F24882g complement(2317798..2319027) similar to sp|P07258 S...    31   1.7  
CAGL0J03960g complement(373177..374484) similar to sp|Q12206 Sac...    31   1.7  
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    31   1.7  
Kwal_33.15136                                                          31   1.8  
Kwal_27.12239                                                          31   1.8  
CAGL0I07073g complement(681102..682283) similar to sp|Q02793 Sac...    31   1.9  
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    31   1.9  
YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein ...    31   2.0  
Sklu_2167.5 YGL213C, Contig c2167 8275-9186                            31   2.0  
AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH] (425925..42...    31   2.1  
CAGL0K11836g complement(1142213..1143781) similar to tr|Q12021 S...    30   2.5  
Scas_637.8                                                             30   2.5  
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    30   2.6  
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    30   2.6  
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    30   2.7  
Scas_721.29                                                            30   2.8  
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             30   3.1  
Scas_571.4                                                             30   3.2  
Kwal_55.21144                                                          30   3.4  
YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein i...    30   3.5  
YGL213C (SKI8) [1783] chr7 complement(90057..91250) Protein invo...    30   3.8  
Scas_684.7                                                             30   3.8  
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    30   3.9  
Kwal_47.17310                                                          30   4.1  
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    30   4.2  
CAGL0B03289g 319012..321624 similar to sp|P38149 Saccharomyces c...    30   4.3  
Kwal_26.7738                                                           30   4.3  
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    30   4.5  
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    30   4.5  
Kwal_56.23685                                                          30   4.7  
Kwal_47.18023                                                          30   4.9  
Kwal_56.24596                                                          29   5.0  
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    29   5.2  
CAGL0M08008g 795893..800059 similar to sp|P47104 Saccharomyces c...    30   5.4  
KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces c...    30   5.4  
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    30   5.4  
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    29   5.7  
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    30   5.7  
YGL111W (NSA1) [1874] chr7 (299979..301370) Essential protein of...    29   5.8  
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    29   5.8  
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    29   6.0  
Scas_719.7*                                                            30   6.2  
Sklu_2092.4 YMR131C, Contig c2092 3964-5526                            29   6.5  
Kwal_56.24332                                                          29   8.0  
CAGL0M03333g 379851..381758 similar to sp|P39998 Saccharomyces c...    29   8.1  
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    29   8.1  
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    29   8.4  
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    29   9.5  
Kwal_56.23207                                                          29   9.7  
Sklu_1710.1 YDR267C, Contig c1710 17-739                               28   9.8  

>Kwal_14.884
          Length = 395

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/376 (96%), Positives = 364/376 (96%)

Query: 1   MSQNQFRIVVGSYEHXXXXXXXXXXXXTPIFTPIFHFQAHSLSVKCLDISKRYLVSGSND 60
           MSQNQFRIVVGSYEH            TPIFTPIFHFQAHSLSVKCLDISKRYLVSGSND
Sbjct: 1   MSQNQFRIVVGSYEHNLLCLSLNLSLSTPIFTPIFHFQAHSLSVKCLDISKRYLVSGSND 60

Query: 61  EHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASD 120
           EHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASD
Sbjct: 61  EHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASD 120

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVL 180
           DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVL
Sbjct: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVL 180

Query: 181 KLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENID 240
           KLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENID
Sbjct: 181 KLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENID 240

Query: 241 GKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLV 300
           GKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLV
Sbjct: 241 GKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLV 300

Query: 301 TIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDESVEKYEMMKKRVAEEADLGEQSEV 360
           TIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDESVEKYEMMKKRVAEEADLGEQSEV
Sbjct: 301 TIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDESVEKYEMMKKRVAEEADLGEQSEV 360

Query: 361 EEDTESLKKIMMGNRP 376
           EEDTESLKKIMMGNRP
Sbjct: 361 EEDTESLKKIMMGNRP 376

>Scas_685.11
          Length = 384

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/372 (68%), Positives = 301/372 (80%), Gaps = 11/372 (2%)

Query: 1   MSQNQFRIVVGSYEHXXXXXXXXXXXXTPIFTPIFHFQAHSLSVKCLDISKRYLVSGSND 60
           M++NQFRI+VGSYEH            TP+FTPIFHFQAH+LSVKCLD+SKRYLVSGSND
Sbjct: 1   MAKNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSND 60

Query: 61  EHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASD 120
           EHIRIYDLQKRKELGTLL+HQGSIT LKFSK    + +N D  G      N+KWL+SAS+
Sbjct: 61  EHIRIYDLQKRKELGTLLAHQGSITNLKFSKS---KTENGDGEG-----SNNKWLLSASE 112

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVL 180
           D+ ++IWRVKDWENFGTLKGH +RIND DIHPSNR+AISVSEDHSIRLWNLMTVKKA VL
Sbjct: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172

Query: 181 KLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENID 240
           KL+ Y+QNGQFVRW G+ G++FAVALL KVLIYKT+ AKVH E+D  K +IM +E E +D
Sbjct: 173 KLRNYSQNGQFVRWIGN-GDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLD 231

Query: 241 GKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLV 300
           GK YI +A  +G +  +P + L  EE   E   PEF+L GH+NRVKDFKFYKN+FG Y+V
Sbjct: 232 GKIYICVAMSDGNIHFYPTEGLLTEEPKVEE--PEFSLLGHSNRVKDFKFYKNDFGTYMV 289

Query: 301 TIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDESVEKYEMMKKRVAEEADLGEQSEV 360
           +IGSDG++VVWDM  K+++AVYDCGERLNCLA+ DE+VEKYE MKKR +E ADLGEQSEV
Sbjct: 290 SIGSDGRVVVWDMEKKDELAVYDCGERLNCLAVVDETVEKYETMKKRDSESADLGEQSEV 349

Query: 361 EEDTESLKKIMM 372
           E DTE LKK+M 
Sbjct: 350 ESDTEELKKVMF 361

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/376 (67%), Positives = 303/376 (80%), Gaps = 13/376 (3%)

Query: 1   MSQNQFRIVVGSYEHXXXXXXXXXXXXTPIFTPIFHFQAHSLSVKCLDISKRYLVSGSND 60
           M  NQFRI+VGSYEH             P+FTPIFHFQAHSLSVKCLDISKRYLVSGSND
Sbjct: 1   MPDNQFRIIVGSYEHNLLCLSLNLSLTQPLFTPIFHFQAHSLSVKCLDISKRYLVSGSND 60

Query: 61  EHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASD 120
           E+IRIYDLQKRKELGTLL HQGSIT L+FS+G   +D +  D  L      +KWL+SAS+
Sbjct: 61  ENIRIYDLQKRKELGTLLGHQGSITNLRFSRG---KDADGQDIQL------NKWLLSASE 111

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVL 180
           DH +++WRVKDWENFGTLKGH +RINDFDIHPSNR+A+SVSEDHSIRLWNLMTVKKAGVL
Sbjct: 112 DHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLWNLMTVKKAGVL 171

Query: 181 KLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENID 240
           KL+KYNQNGQFVRWCG++G + AV LL K+LI+KT TAKVHRE+D  ++++M +E E ID
Sbjct: 172 KLRKYNQNGQFVRWCGENGSYIAVGLLNKLLIFKTETAKVHREIDFSRNTLMHLEREIID 231

Query: 241 GKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTP----EFNLQGHTNRVKDFKFYKNEFG 296
           G++YIV+   +G V  + A  LY+E   EE  +P    EF+L GH+NRVKDF+FY N+FG
Sbjct: 232 GEEYIVVGLNSGAVQFWKASKLYEEVPDEEEESPKLEAEFSLLGHSNRVKDFQFYHNKFG 291

Query: 297 HYLVTIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDESVEKYEMMKKRVAEEADLGE 356
           HYLVTIGSDG+IVVWDM  ++QVAVYDCGERLNC+A+CDES+EKY+ +KKR  EE ++GE
Sbjct: 292 HYLVTIGSDGRIVVWDMKTRDQVAVYDCGERLNCVAVCDESIEKYDTVKKRAPEEVEVGE 351

Query: 357 QSEVEEDTESLKKIMM 372
            S+VE D E LKKIM+
Sbjct: 352 PSDVEADPEELKKIML 367

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score =  506 bits (1303), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 248/373 (66%), Positives = 295/373 (79%), Gaps = 10/373 (2%)

Query: 1   MSQNQFRIVVGSYEHXXXXXXXXXXXXTPIFTPIFHFQAHSLSVKCLDISKRYLVSGSND 60
           M+ NQFRIVVGSYEH            TP+FTPIFHFQAH+LSVK LDIS+RYLVSGSND
Sbjct: 1   MAGNQFRIVVGSYEHNLLCLSLNLELETPLFTPIFHFQAHALSVKTLDISRRYLVSGSND 60

Query: 61  EHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASD 120
           EHIRIYDLQKRKELGTLL+H GSIT+L+FS+ T  +D  +        +GN KWL+SAS+
Sbjct: 61  EHIRIYDLQKRKELGTLLNHNGSITSLRFSRATTDKDGKQ--------QGN-KWLLSASE 111

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVL 180
           DH ++IWRVKDWENFG LKGH +RIND DIHPSNR+A SVSEDHSIRLWNLMT KKA VL
Sbjct: 112 DHTIIIWRVKDWENFGKLKGHNARINDLDIHPSNRVA-SVSEDHSIRLWNLMTAKKAAVL 170

Query: 181 KLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENID 240
           KLKKYNQNG++VRWCG    FFAV L+TKVLIY  +TAKVH E+ TG  +IM ME+E+ID
Sbjct: 171 KLKKYNQNGKYVRWCGKDAGFFAVGLVTKVLIYNAATAKVHHEISTGNKTIMHMEVEHID 230

Query: 241 GKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLV 300
            K+YI +    G++  + A+ LY+E   ++   P F+LQGHTNRVKDF+FYKN  GHYLV
Sbjct: 231 EKEYICVGLSTGSIQFYDAEKLYEESEDQKAAEPAFSLQGHTNRVKDFRFYKNSMGHYLV 290

Query: 301 TIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDESVEKYEMMKKRVAEEADLGEQSEV 360
           + GSDGKIVVWD+  +EQ+AVYDCGERLNCLA+CDESVEKY+ + KR A  AD+ +QSEV
Sbjct: 291 SAGSDGKIVVWDIVKQEQLAVYDCGERLNCLAVCDESVEKYDTVLKRTAATADIEDQSEV 350

Query: 361 EEDTESLKKIMMG 373
           EED E LK+IM+G
Sbjct: 351 EEDAEELKQIMLG 363

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score =  492 bits (1266), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 250/373 (67%), Positives = 297/373 (79%), Gaps = 10/373 (2%)

Query: 1   MSQNQFRIVVGSYEHXXXXXXXXXXXXTPIFTPIFHFQAHSLSVKCLDISKRYLVSGSND 60
           MS+NQFRIVVGSYEH            TP+FTPIFHFQAHSLSVKCLDISKRYLVSGSND
Sbjct: 1   MSRNQFRIVVGSYEHNLLCLSLDLTLETPVFTPIFHFQAHSLSVKCLDISKRYLVSGSND 60

Query: 61  EHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASD 120
           EHIRIYDLQKRKELGTLL+HQGSIT LKFSK +  E K+      T+G    KWL+SAS+
Sbjct: 61  EHIRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQEPKS------TSG----KWLLSASE 110

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVL 180
           D+ +++WRVKDWENFGTLKGH +RIND DIHPSNR+  SVSEDHSIRLWNLMTVKKA VL
Sbjct: 111 DNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLWNLMTVKKAAVL 170

Query: 181 KLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENID 240
           KLKKYNQNGQFVRW    G++FAV+L+TKVLIY ++TAKV+RE+DTG+ +IM ME   + 
Sbjct: 171 KLKKYNQNGQFVRWLKAQGKYFAVSLMTKVLIYDSTTAKVYREIDTGRKTIMHMETVVLA 230

Query: 241 GKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLV 300
             +YIVL   +G V  +  + + + + +E    PEF+L GHTNRVKD KFY NEFG Y+V
Sbjct: 231 DVEYIVLGMSDGKVLFYKVEEILNSKETEFTEEPEFSLLGHTNRVKDLKFYVNEFGTYMV 290

Query: 301 TIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDESVEKYEMMKKRVAEEADLGEQSEV 360
           TIGSDGK++VWDM  ++QVAVYDCGERLNCLA+CDE++EK + MKKR  ++ +LGEQSEV
Sbjct: 291 TIGSDGKVIVWDMDKRDQVAVYDCGERLNCLAVCDETIEKADTMKKRTIDQIELGEQSEV 350

Query: 361 EEDTESLKKIMMG 373
           E DTE LKK+M G
Sbjct: 351 ESDTEELKKVMFG 363

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score =  491 bits (1263), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 239/389 (61%), Positives = 290/389 (74%), Gaps = 22/389 (5%)

Query: 3   QNQFRIVVGSYEHXXX-------XXXXXXXXXTPIFTPIFHFQAHSLSVKCLDISKRYLV 55
           +NQFRI+VGSYEH                   TP F PIFHFQAHSLS+KCL +S+RYLV
Sbjct: 61  KNQFRIIVGSYEHNILCLSLDIPNQKENDAAKTPHFMPIFHFQAHSLSIKCLAVSRRYLV 120

Query: 56  SGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWL 115
           SGSNDEHIRIYDLQKRKELGTLLSHQGSITAL+FS        + +D  ++ G  NSKWL
Sbjct: 121 SGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPAS----SSEDAAVSKGSKNSKWL 176

Query: 116 ISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175
           +SAS+DH +++WRVKDWE  GTLKGH +R+ND DIHP+NRIAISVS+DHSIRLWNLMT++
Sbjct: 177 LSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMTLR 236

Query: 176 KAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRME 235
            A VLKL+KYN NG  VRW G  G++FAV L  +VLIY+T +AKV +E+   + ++M +E
Sbjct: 237 NAAVLKLRKYNTNGTCVRWLGAKGDYFAVGLRDRVLIYETGSAKVFKEIVFQRKTLMHIE 296

Query: 236 --IENIDGKDYIVLAFGNGTVSMFPAKSLYDE---------EASEEPVTPEFNLQGHTNR 284
             I   D K+Y+ +   +G V  +P + L+++         +  +E ++P F+L GHTNR
Sbjct: 297 THILPFDNKEYLSVGISDGNVHFYPCEELFEKVEENEKQEDDDDKEDISPAFSLLGHTNR 356

Query: 285 VKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDESVEKYEMM 344
           +KDFKFY NEFG YLVTIGSDGKIVVWDMS KEQVAVYDCGERLNCL LCDES+EKY  M
Sbjct: 357 IKDFKFYTNEFGTYLVTIGSDGKIVVWDMSTKEQVAVYDCGERLNCLTLCDESIEKYNTM 416

Query: 345 KKRVAEEADLGEQSEVEEDTESLKKIMMG 373
           KKR AE AD+G+QSEVE DTE LKKIM G
Sbjct: 417 KKRDAETADIGDQSEVESDTEELKKIMFG 445

>Kwal_23.5035
          Length = 744

 Score = 64.7 bits (156), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 65/138 (47%), Gaps = 23/138 (16%)

Query: 37  FQAHSLS-VKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKI 95
            + H++  V CL     Y+++G++D+ IR+YD +  K +  L  H G + ALK+      
Sbjct: 365 LRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKY------ 418

Query: 96  EDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI--HPS 153
                         G+   L+S S D ++ +W +K  +     KGH S +   DI  H  
Sbjct: 419 --------------GHDGILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNG 464

Query: 154 NRIAISVSEDHSIRLWNL 171
            +  ++ S DH++ +W L
Sbjct: 465 KKFIVTGSRDHTLHVWKL 482

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 65/166 (39%), Gaps = 45/166 (27%)

Query: 37  FQAHSLSVKCLDI----SKRYLVSGSNDEHIRIYDLQKRKE------------------- 73
           F+ H+ +V+CLDI     K+++V+GS D  + ++ L                        
Sbjct: 447 FKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPY 506

Query: 74  -LGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDW 132
            +G L  H  ++  +                   +G GN   ++S S D NL++W +   
Sbjct: 507 FVGVLRGHMAAVRTV-------------------SGHGN--IVVSGSYDFNLMVWDIAQM 545

Query: 133 ENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAG 178
           +    L GH  RI            IS   D ++++W+L  V K G
Sbjct: 546 KCLYVLTGHTDRIYSTIYDYQRNRCISAGMDSTVKVWDLADVSKNG 591

 Score = 28.9 bits (63), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 114 WLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
           ++I+ +DD  + ++  K  +    L GH   +     +  + I +S S D S+R+WN+ +
Sbjct: 382 YVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALK-YGHDGILVSGSTDRSVRVWNIKS 440

Query: 174 VKKAGVLK 181
            K   V K
Sbjct: 441 GKCTHVFK 448

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/313 (23%), Positives = 128/313 (40%), Gaps = 88/313 (28%)

Query: 44  VKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDT 103
           V CL     Y+++G++D+ I +YD +    L  L  H+G + ALKF  G  +   + D +
Sbjct: 263 VTCLQFENNYIITGADDKKINVYDAENDLFLLELNGHEGGVWALKFVDGKILVSGSTDRS 322

Query: 104 ----GLTTGR--------------------GNSKWLISASDDHNLVIWRVKDWENF---- 135
                + TG+                    G+SK++++ S D+ L +W++   +      
Sbjct: 323 VRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKELDKGS 382

Query: 136 ----------------GTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGV 179
                           G L+GH S +     H   RI IS S DH++ +W+++++K   +
Sbjct: 383 QEPIFYRTPEENPYFVGVLRGHMSSVRTVSGH--GRIVISGSYDHNLMVWDIISMKLLYI 440

Query: 180 LKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENI 239
           L               G +   ++      +  YK +   +   +DT   ++M  ++ENI
Sbjct: 441 LT--------------GHTDRVYST-----IYDYKRNRC-ISASMDT---TVMIWDLENI 477

Query: 240 DGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYL 299
           +          NGT +        ++ AS + V     L GHT  V       N+F   L
Sbjct: 478 E---------NNGTTTTI------NDGASIKVVGSMKCLYGHTALVG-LLCLSNKF---L 518

Query: 300 VTIGSDGKIVVWD 312
           V+  +DG I  WD
Sbjct: 519 VSAAADGSIRGWD 531

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 72/154 (46%), Gaps = 21/154 (13%)

Query: 37  FQAHSLSVKCLDI----SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKG 92
           F+ H+ +V+CL++      +Y+V+GS D  + ++ L   KEL      +GS   + +   
Sbjct: 337 FKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKELD-----KGSQEPIFY--- 388

Query: 93  TKIEDKNEDDTGLTTGR--------GNSKWLISASDDHNLVIWRVKDWENFGTLKGHASR 144
            +  ++N    G+  G         G+ + +IS S DHNL++W +   +    L GH  R
Sbjct: 389 -RTPEENPYFVGVLRGHMSSVRTVSGHGRIVISGSYDHNLMVWDIISMKLLYILTGHTDR 447

Query: 145 INDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAG 178
           +            IS S D ++ +W+L  ++  G
Sbjct: 448 VYSTIYDYKRNRCISASMDTTVMIWDLENIENNG 481

>Scas_624.11
          Length = 1205

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 68/147 (46%), Gaps = 21/147 (14%)

Query: 32  TPIFHFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           T +  F+ H   V+ +D   ++   VSG +D  I+++ L+  K L TL  H   I  + F
Sbjct: 44  TLLHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFF 103

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
            K                      W+ISASDD  + IW  ++ +    L GH   +    
Sbjct: 104 HK-------------------ELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQ 144

Query: 150 IHPSNRIAISVSEDHSIRLWNLMTVKK 176
            HP++ + +S S D +IR+W++  ++K
Sbjct: 145 FHPTDDLVVSASLDETIRVWDISGLRK 171

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 6/75 (8%)

Query: 115 LISASDDHNLVIWR---VKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           ++S SDD  + +W+    K WE   T +GH + ++    HP+ +  +SV ED ++R+W+L
Sbjct: 224 IVSGSDDRQVKLWKYNSTKAWE-VDTCRGHTNNVDCVIFHPTQKFILSVGEDKTLRIWDL 282

Query: 172 MTVKKAGVLKLKKYN 186
              K+  V + K+ N
Sbjct: 283 D--KRIPVKQFKREN 295

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 59/134 (44%), Gaps = 11/134 (8%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF--------SKGTKIEDKNEDDTG 104
           +++S S+D+ IRI++ Q RKE+  L  H   +   +F        S       +  D +G
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLVVSASLDETIRVWDISG 168

Query: 105 LT---TGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVS 161
           L    +  G S +    +   NL+     D      L+GH   +N    HP+  + +S S
Sbjct: 169 LRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGS 228

Query: 162 EDHSIRLWNLMTVK 175
           +D  ++LW   + K
Sbjct: 229 DDRQVKLWKYNSTK 242

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 55/135 (40%), Gaps = 27/135 (20%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLL----SHQGSITALKFSKGTKIEDKNEDDTGL 105
           S+ +++       I+++D +    +GTLL     H+G + ++ F     I          
Sbjct: 22  SRPWVLVALFSSTIQLWDYR----MGTLLHRFEDHEGPVRSVDFHPTQPI---------- 67

Query: 106 TTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHS 165
                     +S  DD+ + +W ++  +   TL GH   I     H      IS S+D +
Sbjct: 68  ---------FVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQT 118

Query: 166 IRLWNLMTVKKAGVL 180
           IR+WN    K+   L
Sbjct: 119 IRIWNWQNRKEIACL 133

 Score = 35.8 bits (81), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
           TK E K+    G+     +  W++ A     + +W  +        + H   +   D HP
Sbjct: 5   TKFESKSTRAKGIAF-HPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFHP 63

Query: 153 SNRIAISVSEDHSIRLWNLMTVK 175
           +  I +S  +D++I++W+L T K
Sbjct: 64  TQPIFVSGGDDYTIKVWSLETNK 86

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 75/160 (46%), Gaps = 22/160 (13%)

Query: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93
           I  F+ H   V  L ++ + L++GS D  + I+DL   K +  L  H   + AL+F    
Sbjct: 252 IQEFKGHMDGVLSLQLTNKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD-Q 310

Query: 94  KIEDKNEDDT----------GLTTGRGNS----------KWLISASDDHNLVIWRVKDWE 133
           K+   + D T           ++T RG+           K ++S S D  + +W V+   
Sbjct: 311 KLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRT 370

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
            + TL+GH   +N   +HP +    S S+D +IR+W++ T
Sbjct: 371 CY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT 409

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 67/162 (41%), Gaps = 22/162 (13%)

Query: 34  IFHFQAHSLSVKCLDISKRYLV--SGSNDEHIRIYDLQKRKELGTLLSHQGSIT-ALKFS 90
            +  + H+  V C+ +  +     SGS+D  IR++D++    +     H G +   +  +
Sbjct: 371 CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT 430

Query: 91  KGTKIEDKNED------------DTGLTTGRGNSKW-----LISASDDHNLVIWRVKDWE 133
            G+ + +  +D            D  +     +        L+S S D+ + +W VK   
Sbjct: 431 LGSDLIEDPKDAVVPPDATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGA 490

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175
              T  GH   +  +DI   N   +S S D S ++W+L T K
Sbjct: 491 CIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDLQTGK 530

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 66/147 (44%), Gaps = 21/147 (14%)

Query: 32  TPIFHFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           T +  F+ H   V+ LD   ++   VS  +D  I+++ L   K L TL  H   +  + F
Sbjct: 44  TLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFF 103

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
            +                      W+ISASDD  + IW  ++ +    L GH   +    
Sbjct: 104 HR-------------------ELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQ 144

Query: 150 IHPSNRIAISVSEDHSIRLWNLMTVKK 176
            HP++ + +S S D +IR+W++  ++K
Sbjct: 145 FHPTDDLIVSASLDETIRIWDISGLRK 171

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 70/147 (47%), Gaps = 17/147 (11%)

Query: 54  LVSGSNDEHIRIYD---LQKRKELGTLLSHQGSITA----LKFSKG----TKIEDKNEDD 102
           +VS S DE IRI+D   L+KR       S +  ++A    L  S G      I + +   
Sbjct: 152 IVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRG 211

Query: 103 TGLTTGRGNSKWLISASDDHNLVIWRV---KDWENFGTLKGHASRINDFDIHPSNRIAIS 159
               +       ++S SDD  + +WR+   K WE   T +GH + ++    HP   + IS
Sbjct: 212 VNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWE-VDTCRGHTNNVDSVIFHPHQNLIIS 270

Query: 160 VSEDHSIRLWNLMTVKKAGVLKLKKYN 186
           V ED ++R+W+L   K+  V + K+ N
Sbjct: 271 VGEDKTLRVWDLD--KRTPVKQFKREN 295

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK-IEDKNEDDT-------G 104
           +++S S+D+ IRI++ Q RKE+  L  H   +   +F      I   + D+T       G
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISG 168

Query: 105 LT---TGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVS 161
           L    +  G S +    S   NL+   + D      L+GH   +N    HP+  + +S S
Sbjct: 169 LRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGS 228

Query: 162 EDHSIRLWNLMTVK 175
           +D  ++LW +   K
Sbjct: 229 DDRQVKLWRMSATK 242

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/295 (21%), Positives = 112/295 (37%), Gaps = 53/295 (17%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLL----SHQGSITALKFSKGTKIEDKNEDDTGL 105
           S+ +++       I+++D +    +GTLL     H+G +  L F     I          
Sbjct: 22  SRPWVLVALFSSTIQLWDYR----MGTLLHRFEDHEGPVRGLDFHPTQPI---------- 67

Query: 106 TTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHS 165
                     +SA DD+ + +W +   +   TL GH   +     H      IS S+D +
Sbjct: 68  ---------FVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQT 118

Query: 166 IRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELD 225
           IR+WN    K+     L  +N      ++        + +L   + I+  S  +  R   
Sbjct: 119 IRIWNWQNRKEIAC--LTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLR-KRHSA 175

Query: 226 TGKSSI---MRMEIENIDGK------DYIVLAFGNGT--VSMFPAKSLYDEEASEEPV-- 272
            G SS    M  +   +DG        +I+     G    S  P   L    + +  V  
Sbjct: 176 PGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKL 235

Query: 273 -----TPEFNL---QGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQV 319
                T  + +   +GHTN V    F+ ++  + ++++G D  + VWD+  +  V
Sbjct: 236 WRMSATKAWEVDTCRGHTNNVDSVIFHPHQ--NLIISVGEDKTLRVWDLDKRTPV 288

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
           TK E K+    G+     +  W++ A     + +W  +        + H   +   D HP
Sbjct: 5   TKFESKSTRAKGIAF-HPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHP 63

Query: 153 SNRIAISVSEDHSIRLWNLMTVK 175
           +  I +S  +D++I++W+L T K
Sbjct: 64  TQPIFVSAGDDYTIKVWSLDTNK 86

>Kwal_56.24526
          Length = 1210

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 67/147 (45%), Gaps = 21/147 (14%)

Query: 32  TPIFHFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           T +  F+ H   V+ +D   ++   VS  +D  I+++ L  +K L TL  H   +  + F
Sbjct: 44  TLLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFF 103

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
            +                      W+ISASDD  + IW  ++ +    L GH   +   D
Sbjct: 104 HR-------------------ELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAD 144

Query: 150 IHPSNRIAISVSEDHSIRLWNLMTVKK 176
            HP+  + +S S D ++R+W++  ++K
Sbjct: 145 FHPTEDLVVSASLDETVRVWDISGLRK 171

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 87/196 (44%), Gaps = 30/196 (15%)

Query: 40  HSLSVKCLDI--SKRYLVSGSNDEHIRIYD---LQKRKELGTLLSHQGSITA-------- 86
           H+  V C D   ++  +VS S DE +R++D   L+KR    +  + +  I A        
Sbjct: 136 HNHFVMCADFHPTEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGG 195

Query: 87  -----LKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRV---KDWENFGTL 138
                +KF     I + +       +       ++S  DD  + +WR+   K WE   T 
Sbjct: 196 FGDCVVKF-----ILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWE-VDTC 249

Query: 139 KGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDS 198
           +GH + ++    HP   + ISV ED ++R+W+L   K+  V + K+ N     VR    +
Sbjct: 250 RGHTNNVDSVIFHPHQNLIISVGEDKTVRVWDLD--KRTPVKQFKRENDRFWLVR-AHPN 306

Query: 199 GEFFAVALLTKVLIYK 214
              F  A  + ++++K
Sbjct: 307 INLFGAAHDSGIMVFK 322

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 96/271 (35%), Gaps = 50/271 (18%)

Query: 83  SITALKFSKGTKIEDKNEDDTGLTTG---RGNSKWLISASDDHNLVIWRVKDWENFGTLK 139
           SI    +  GT +  K ED  G   G          +SA DD+ + +W +   +   TL 
Sbjct: 34  SIQLWDYRMGTLLH-KFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLN 92

Query: 140 GHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSG 199
           GH   +     H      IS S+D +IR+WN    K+   L       +  FV  C D  
Sbjct: 93  GHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACL-----TGHNHFVM-CADFH 146

Query: 200 EFFAVALLTKVLIYKTSTAKVHRELDT-------GKSSIMRMEIENIDGKDYIVLAFGNG 252
                   T+ L+   S  +  R  D           S   +E +    ++ +   FG+ 
Sbjct: 147 P-------TEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDC 199

Query: 253 TVS-MFPAKSLYDEEASEEPVTPEF-----------------------NLQGHTNRVKDF 288
            V  +    S     AS  P  P                           +GHTN V   
Sbjct: 200 VVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSV 259

Query: 289 KFYKNEFGHYLVTIGSDGKIVVWDMSNKEQV 319
            F+ ++  + ++++G D  + VWD+  +  V
Sbjct: 260 IFHPHQ--NLIISVGEDKTVRVWDLDKRTPV 288

 Score = 36.6 bits (83), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 1/83 (1%)

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
           TK E K+    GL     +  W++ A    ++ +W  +        + H   +   D HP
Sbjct: 5   TKFESKSTRAKGLAF-HPSRPWVLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGIDFHP 63

Query: 153 SNRIAISVSEDHSIRLWNLMTVK 175
           +  + +S  +D++I++W+L T K
Sbjct: 64  TQPLFVSAGDDYTIKVWSLDTKK 86

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 68/144 (47%), Gaps = 20/144 (13%)

Query: 33  PIFHFQAHSLSVKCLD--ISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
            +   Q H+ ++ C+D  I    L +G  D  I I+DL+K  +L  +  H+  +T+LKF 
Sbjct: 374 AVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLRKSDKLTKITEHKSIVTSLKFD 433

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
           K                   N   LIS+  D ++ ++   ++    +L GHA ++  FDI
Sbjct: 434 KA------------------NDHNLISSGYDRSIFVYSKDNYLKVSSLIGHADKVLTFDI 475

Query: 151 HPSNRIAISVSEDHSIRLWNLMTV 174
             +N+  IS   D S++ W+ ++ 
Sbjct: 476 DKNNKNLISGGWDRSVKHWSTVST 499

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 110/271 (40%), Gaps = 38/271 (14%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           Y+ SGS +  + I D    +   TL +H G +  + ++                    N 
Sbjct: 226 YVASGSWNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWT-------------------SND 266

Query: 113 KWLISASDDHNLVIWRVKDWE--NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
             LI+  +DH + +    D E     ++ GH  RI D  +HPS +   + S D + RLW+
Sbjct: 267 SVLITGGEDHLITVSNRSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWD 326

Query: 171 LMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTK-VLIYKTSTAKVHRELDTGKS 229
              ++K   L L++ +    +       G   + A   K  +I+   + K   +L     
Sbjct: 327 ---IEKQKQLLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAK 383

Query: 230 SIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFK 289
           +I  M+  +IDG     LA G G   +    +++D   S++       +  H + V   K
Sbjct: 384 TIYCMDW-SIDGH---TLATGGGDGVI----TIWDLRKSDKLT----KITEHKSIVTSLK 431

Query: 290 FYKNEFGHYLVTIGSDGKIVVWDMSNKEQVA 320
           F K    H L++ G D  I V+   N  +V+
Sbjct: 432 FDKAN-DHNLISSGYDRSIFVYSKDNYLKVS 461

>Scas_695.15
          Length = 327

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 121/291 (41%), Gaps = 39/291 (13%)

Query: 54  LVSGSNDEHIRIYDLQKRKE--LGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGN 111
           L++ +  +++R+YD++      + T   H+G++T++ F +                   +
Sbjct: 66  LLAAAGYQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQ-------------------D 106

Query: 112 SKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           +KW++++S+D  + +W V+        K H + +N+  IHP+    IS   D +I++W+L
Sbjct: 107 NKWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGTIKIWDL 165

Query: 172 MTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYK------TSTAKVHRELD 225
              +    L     N + Q +    D     A        +++       S  K   +  
Sbjct: 166 GENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGDCYVWEMPNHTDASNLKPINKFS 225

Query: 226 TGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRV 285
             K  I R+ + +    D   +A    T S      ++    +E+    E  L GH   V
Sbjct: 226 AHKDYITRVVLSS----DVKHMA----TCSADRTAKIWSVGETEDDFNLETTLDGHQRWV 277

Query: 286 KDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGER-LNCLALCD 335
            D  F  +    YLVT  SD  + +WD+S +E V  Y    +   C+AL D
Sbjct: 278 WDCAFSADSA--YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 326

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 67/161 (41%), Gaps = 22/161 (13%)

Query: 156 IAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRW-CGDSGEFFAVALLTKVLIY- 213
           I +S   DH+IR W  +T    GV      + + Q  R    +  +  A A    V +Y 
Sbjct: 24  ILVSAGYDHTIRFWEALT----GVCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYD 79

Query: 214 -KTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPV 272
            +T+        +  K ++  +  +  D K ++V +  +GT+ ++  +S         P 
Sbjct: 80  IRTTNPNAVATFEGHKGNVTSVSFQQ-DNK-WMVTSSEDGTIKVWDVRS---------PS 128

Query: 273 TPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
            P  N + H   V +   + N+    L++   DG I +WD+
Sbjct: 129 VPR-NYK-HNAPVNEVVIHPNQG--ELISCDRDGTIKIWDL 165

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 127/294 (43%), Gaps = 44/294 (14%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKE--LGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTG 108
           KRYL +  +  H+R+YD++      + +   H+G++T++ F +                 
Sbjct: 44  KRYLAAAGH-LHVRMYDIRTTNPNPVTSFEGHRGNVTSIAFQQ----------------- 85

Query: 109 RGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRL 168
             ++KW++S+S+D  + +W V+        K H + +N+  IHP+    IS  +D +I++
Sbjct: 86  --DNKWMVSSSEDGTIKVWDVRSPSVQRNYK-HDAPVNEVVIHPNQGELISCDQDGNIKI 142

Query: 169 WNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYK------TSTAKVHR 222
           W+L   +    L L+  N   Q +    D     A        ++K      T++ K   
Sbjct: 143 WDLGENQCTNQLALED-NTALQSLSIASDGSMLVAGNNKGNCYVWKMPNHTDTASLKPVT 201

Query: 223 ELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHT 282
           +  +    I R+ + ++D K ++     + T  ++           E+    E  L  H+
Sbjct: 202 KFRSHSKYITRV-LLSVDVK-HLATCSADHTARVWSV---------EDNFQLETTLDAHS 250

Query: 283 NRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGER-LNCLALCD 335
             V D  F  +    YLVT  SD  + +WD+S +E V  Y    +   C+AL D
Sbjct: 251 RWVWDCAFSADSA--YLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 13/104 (12%)

Query: 210 VLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASE 269
           +  ++  T    R +    S + R+EI +   K Y+  A G+  V M+  ++      + 
Sbjct: 14  IRFWEALTGVCSRTIQHADSQVNRLEITS--DKRYLAAA-GHLHVRMYDIRT-----TNP 65

Query: 270 EPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
            PVT   + +GH   V    F ++    ++V+   DG I VWD+
Sbjct: 66  NPVT---SFEGHRGNVTSIAFQQDN--KWMVSSSEDGTIKVWDV 104

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 48/117 (41%), Gaps = 22/117 (18%)

Query: 28  TPIFTPIFHFQAHS--LSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLL-SHQGSI 84
           T    P+  F++HS  ++   L +  ++L + S D   R++ ++   +L T L +H   +
Sbjct: 194 TASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNFQLETTLDAHSRWV 253

Query: 85  TALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGH 141
               FS                    +S +L++A  DH + +W +   E      GH
Sbjct: 254 WDCAFS-------------------ADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 81/175 (46%), Gaps = 15/175 (8%)

Query: 30  IFTPIFH-FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTL-LSHQGSITA- 86
           I +P  H F+AH+  V  L +   +LVSGS D  IR +DL+  K L T+ LS    +T  
Sbjct: 490 IDSPCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTS 549

Query: 87  --LKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASR 144
             +  SK T +  +NE  + +   +     L + + D  + +W ++  +   TLKGH   
Sbjct: 550 TNVDLSKSTLLTQRNERPS-IGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDA 608

Query: 145 INDFDIHPSNRIAISVSEDHSIRLWNLMT-------VKKAGVLKLKKYNQNGQFV 192
           I       +    ++ S D ++R+W+L T          A VL L  + +N   V
Sbjct: 609 ITSLKFDSA--CLVTGSYDRTVRIWDLRTGLLNKFHAYSAPVLSLDLFQENAAVV 661

 Score = 35.8 bits (81), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           DH + IW +      G L GH + IN   I+      ++   D +++LWNL
Sbjct: 420 DHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNL 470

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 69/315 (21%), Positives = 125/315 (39%), Gaps = 62/315 (19%)

Query: 44  VKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDT 103
           V CL     Y+++G++D+ IRIYD   +K L  L  H G + ALK++             
Sbjct: 372 VTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGHDGGVWALKYA------------- 418

Query: 104 GLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI--HPSNRIAISVS 161
               G G    L+S S D ++ IW +   +     KGH S +   DI  H   +  ++ S
Sbjct: 419 ----GNG---ILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGS 471

Query: 162 EDHSIRLWNLMTVKKAGVLK--LKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAK 219
            D+++ +W L  +  + + +     Y+ NG       +   +F   L   +   +T +  
Sbjct: 472 RDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVLRGHIASVRTVSG- 530

Query: 220 VHRELDTGKS--------SIMRMEIENI--------------DGKDYIVLAFGNGTVSMF 257
            H  +    S         I++M+   I                ++  + A  + T+ ++
Sbjct: 531 -HGRIVISGSYDNNLIVWDIIQMKCLYILMGHTDRIYSTIYDYKRNRCISASMDSTIKIW 589

Query: 258 PAKSLYDE------EASEEPVT----PEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGK 307
             +++++         +  P T    P   LQGHT  V   K        +LV+  +DG 
Sbjct: 590 DLQNIWNNGECVNVTNATVPCTKITGPMMTLQGHTALVGLLKLSD----KFLVSAAADGS 645

Query: 308 IVVWDMSNKEQVAVY 322
           +  WD S+  +   Y
Sbjct: 646 LRGWDSSDYSRKFAY 660

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 78/162 (48%), Gaps = 29/162 (17%)

Query: 37  FQAHSLSVKCLDISK----RYLVSGSNDEHIRIYDLQKRKE------LGTLLSHQGSITA 86
           F+ H+ +V+CLDI +    +Y+V+GS D  + I+ L +  +      +  + S+ G    
Sbjct: 446 FKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNG---P 502

Query: 87  LKFSKGTKIEDKNEDDTGLTTGR--------GNSKWLISASDDHNLVIWRVKDWENFGTL 138
           L F       ++N    G+  G         G+ + +IS S D+NL++W +   +    L
Sbjct: 503 LFFHS----PEENPYFVGVLRGHIASVRTVSGHGRIVISGSYDNNLIVWDIIQMKCLYIL 558

Query: 139 KGHASRIND--FDIHPSNRIAISVSEDHSIRLWNLMTVKKAG 178
            GH  RI    +D +  NR  IS S D +I++W+L  +   G
Sbjct: 559 MGHTDRIYSTIYD-YKRNR-CISASMDSTIKIWDLQNIWNNG 598

>Scas_631.17
          Length = 474

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 20/138 (14%)

Query: 34  IFHFQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
           I + Q H+  +  +D S    ++ +G  D  I I+D++K  E   LL+H   +T ++F K
Sbjct: 352 IMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQK 411

Query: 92  GTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIH 151
            T                     L+S   D  + I+   +W    TL+GH  +I D DI 
Sbjct: 412 ST------------------GHCLVSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDIS 453

Query: 152 PSNRIAISVSEDHSIRLW 169
              ++ +S   D S++LW
Sbjct: 454 EDAQLIVSSGWDRSLKLW 471

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 90/210 (42%), Gaps = 21/210 (10%)

Query: 115 LISASDDHNLVIWR----VKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           L+S +DD  + I      VK  +    L+GH  R+ + D HPS R   S S D + RLW+
Sbjct: 244 LVSGADDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWD 303

Query: 171 LMTVKKAGVLKLKK-YNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKS 229
           + +  +   L+ ++ + +    + +  D     +  L    +++   T K    L     
Sbjct: 304 IESETE---LQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAK 360

Query: 230 SIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFK 289
            I  ++  + DG  +I    G+G ++++  +            T    L  H N V   +
Sbjct: 361 PIYSVDW-SPDGY-HIATGGGDGVINIWDIRK----------TTETTRLLAHNNIVTGVR 408

Query: 290 FYKNEFGHYLVTIGSDGKIVVWDMSNKEQV 319
           F K+  GH LV+ G D +I ++   N  QV
Sbjct: 409 FQKST-GHCLVSCGYDKQIRIYSSDNWIQV 437

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 127/304 (41%), Gaps = 64/304 (21%)

Query: 51  KRYLVSGSNDEHIRIYDLQ--KRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTG 108
           KR+L +  +  H+R+YD++      + +   H+G++T++ F +                 
Sbjct: 44  KRFLAAAGH-LHVRLYDIRTTNPNPVTSFEGHRGNVTSISFQQ----------------- 85

Query: 109 RGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRL 168
             ++KW++S+S+D  + +W V+        K HA  +N+  IHP+    IS  +D +IR+
Sbjct: 86  --DNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAP-VNEVVIHPNQGELISCDQDGNIRI 142

Query: 169 WNL--------MTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFA--------VALLTKVLI 212
           W+L        +T +    L+      +G  +    + G  +          A L  V  
Sbjct: 143 WDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNCYVWQMPNHTDAANLKPVTK 202

Query: 213 YKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPV 272
           +++ T  + R L       +  +++++             T S      ++   + E+  
Sbjct: 203 FRSHTKYITRVL-------LSSDVKHL------------ATCSADHTARVW---SIEDNF 240

Query: 273 TPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGER-LNCL 331
             E  L GH   V D  F  +    YLVT  SD  + +WD+S +E V  Y    +   C+
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSA--YLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298

Query: 332 ALCD 335
           AL D
Sbjct: 299 ALND 302

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/304 (22%), Positives = 126/304 (41%), Gaps = 64/304 (21%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKE--LGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTG 108
           K+YL +  +  H+R+YD++      + +   H+G++T++ F +                 
Sbjct: 44  KKYLAAAGH-LHVRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQ----------------- 85

Query: 109 RGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRL 168
              ++W++S+S+D  + +W V+        K H + +N+  IHP+    IS  +D +IR+
Sbjct: 86  --ENRWMVSSSEDGTIKVWDVRSPSVQRNYK-HNAPVNEVAIHPNQGELISCDQDGNIRI 142

Query: 169 WNL--------MTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFA--------VALLTKVLI 212
           W+L        +T +    L+      +G  +    + G  +          + L  V  
Sbjct: 143 WDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVWKMPHHTDASTLEPVTK 202

Query: 213 YKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPV 272
           +K+ T  + R L       +  +++++             T S      +++ E + E  
Sbjct: 203 FKSHTKYITRVL-------LSADVKHL------------ATCSADHTARVWNIEDNFE-- 241

Query: 273 TPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGER-LNCL 331
             E  L GH   V D  F  +    YLVT  SD  + +WD+S  E V  Y    +   C+
Sbjct: 242 -LETTLDGHQRWVWDCAFSADSA--YLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAVCV 298

Query: 332 ALCD 335
           AL D
Sbjct: 299 ALND 302

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/170 (20%), Positives = 68/170 (40%), Gaps = 31/170 (18%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQK---------RKELGTLLSH- 80
           P+  F+ H  +V  +   +  R++VS S D  I+++D++             +  +  H 
Sbjct: 67  PVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAIHP 126

Query: 81  -QGSITALKFSKGTKIED----------KNEDDTGLTT--GRGNSKWLISASDDHNLVIW 127
            QG + +       +I D            ED+T L +     +   L++ ++  N  +W
Sbjct: 127 NQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVW 186

Query: 128 RVKDWENFGTL------KGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           ++    +  TL      K H   I    +    +   + S DH+ R+WN+
Sbjct: 187 KMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNI 236

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 47/112 (41%), Gaps = 22/112 (19%)

Query: 33  PIFHFQAHS--LSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLL-SHQGSITALKF 89
           P+  F++H+  ++   L    ++L + S D   R+++++   EL T L  HQ  +    F
Sbjct: 199 PVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTLDGHQRWVWDCAF 258

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGH 141
           S                    +S +L++A  DH + +W +   E      GH
Sbjct: 259 S-------------------ADSAYLVTACSDHYVRLWDLSTSEIVRQYGGH 291

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 44/104 (42%), Gaps = 13/104 (12%)

Query: 210 VLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASE 269
           +  ++  T    R +    S + R+EI +   K Y+  A G+  V ++  +S        
Sbjct: 14  IRFWEALTGVCSRTIQHADSQVNRLEITS--DKKYLAAA-GHLHVRLYDIRS-------N 63

Query: 270 EPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
            P  P  + +GH   V    F +     ++V+   DG I VWD+
Sbjct: 64  NP-NPVSSFEGHKGNVTSIAFQQE--NRWMVSSSEDGTIKVWDV 104

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 68/155 (43%), Gaps = 24/155 (15%)

Query: 32  TPIFHFQAHSLSVKCL--DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           T + +F  H  ++  L  D +   L+SGS D  I I+DL     L  L SH+ SIT    
Sbjct: 108 TVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITG--- 164

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
                I  +NED            WLIS S D  + IW +K  +   T   H S      
Sbjct: 165 -----IWCENED------------WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLA 207

Query: 150 IHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKK 184
           IH  N + I+ S +  I++WNL   K  G   +KK
Sbjct: 208 IH--NDLVITTSTESQIKIWNLDLDKDMGSKLMKK 240

 Score = 28.5 bits (62), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 140 GHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWC 195
           GH S I      P+    IS S+D  I +W+L  V + G+ KL+ +  +   + WC
Sbjct: 115 GHKSAITVLRFDPTGTRLISGSKDSDIIIWDL--VGEVGLYKLRSHKDSITGI-WC 167

>Scas_704.40
          Length = 608

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 72/157 (45%), Gaps = 22/157 (14%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
           F+ H   V  L  + R L +GS D  + I+DL   K +  L  H   +  L F +  K+ 
Sbjct: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEA-KLV 307

Query: 97  DKNEDDT----------GLTTGRGNS----------KWLISASDDHNLVIWRVKDWENFG 136
             + D T           ++T RG++          K ++S S D  + IW V+    + 
Sbjct: 308 TGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCY- 366

Query: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
           TL+GH   +N   +HP +    S S+D +IR+W++ T
Sbjct: 367 TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 69/175 (39%), Gaps = 36/175 (20%)

Query: 35  FHFQAHSLSVKCLDISKRYLV--SGSNDEHIRIYDLQKRKELGTLLSHQGSITAL----- 87
           +  + H+  V C+ +  +     SGS+D  IR++D++    L     H G +  +     
Sbjct: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTI 425

Query: 88  ---------KFSKGTKIEDK------------------NEDDTGLTTGRGNSKWLISASD 120
                      S   + +D+                  +E++  L         L+S S 
Sbjct: 426 IDAENLVVDNISGSNEGDDEPASTTTPTAAIAAEAATNDEENQTLDKSIPYPTHLLSCSL 485

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175
           D+ + +W V+  +   T  GH   +  +DI   N   IS S D SI++W+L + K
Sbjct: 486 DNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGK 538

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 91/218 (41%), Gaps = 60/218 (27%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF----------------------- 89
           +++S S+D+ IRI++ Q RKE+  L  H   +   +F                       
Sbjct: 109 WIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDISG 168

Query: 90  ------SKGTK-IEDKNEDDTGLTTG-----------RGNSK---W---------LISAS 119
                 + GT+  E++      L  G            G+++   W         ++S S
Sbjct: 169 LRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGS 228

Query: 120 DDHNLVIWRV---KDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK 176
           DD  + +WR+   K WE   T +GH + ++    HP   + ISV ED ++R+W+L   K+
Sbjct: 229 DDRQVKLWRMSATKAWE-VDTCRGHTNNVDSVIFHPQQNLIISVGEDKTVRVWDLD--KR 285

Query: 177 AGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYK 214
             + + K+ N     VR    +   F  A  + ++I+K
Sbjct: 286 TPIKQFKRENDRFWLVR-AHPNLNLFGAAHDSGIMIFK 322

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 63/145 (43%), Gaps = 21/145 (14%)

Query: 34  IFHFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
           +  F+ H   V+ +D   ++   VS  +D  I+++ L+  K L TL  H   +  + F  
Sbjct: 46  LHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHH 105

Query: 92  GTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIH 151
                                 W+IS+SDD  + IW  ++ +    L GH   +     H
Sbjct: 106 ELP-------------------WIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFH 146

Query: 152 PSNRIAISVSEDHSIRLWNLMTVKK 176
           P   + +S S D ++R+W++  ++K
Sbjct: 147 PVEDLVVSASLDETVRVWDISGLRK 171

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 86/232 (37%), Gaps = 38/232 (16%)

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTV 174
            +SA DD+ + +W ++  +   TL GH   +     H      IS S+D +IR+WN    
Sbjct: 68  FVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNR 127

Query: 175 KKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSI--- 231
           K+     L  +N      ++        + +L   V ++  S  +  R    G  S    
Sbjct: 128 KEIAC--LTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDISGLR-KRHSAPGTQSFEEQ 184

Query: 232 MRMEIENIDGKDYIVLAFGNGTVS-MFPAKSLYDEEASEEPVTPEF-------------- 276
           MR +   +DG       FG+  V  +    +     AS  P  P                
Sbjct: 185 MRQQQNLLDG------GFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRM 238

Query: 277 ---------NLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQV 319
                      +GHTN V    F+  +  + ++++G D  + VWD+  +  +
Sbjct: 239 SATKAWEVDTCRGHTNNVDSVIFHPQQ--NLIISVGEDKTVRVWDLDKRTPI 288

 Score = 33.1 bits (74), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 36/79 (45%), Gaps = 1/79 (1%)

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
           TK E K+    G+     +  W++ A     + +W  +        + H   +   D HP
Sbjct: 5   TKFESKSTRAKGIAF-HPSRPWVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDFHP 63

Query: 153 SNRIAISVSEDHSIRLWNL 171
           +  + +S  +D++I++W+L
Sbjct: 64  TQPLFVSAGDDYTIKVWSL 82

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 71/162 (43%), Gaps = 25/162 (15%)

Query: 37  FQAHSLSVKCLDISKR---YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93
           F+ H   V C+  + +      S   D  ++I+ L ++    T+ +H+     + F    
Sbjct: 18  FEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHE--TRGVNFVDYY 75

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153
            ++DK               +LI++SDD ++ IW  +      TL+GH + ++    HPS
Sbjct: 76  PLQDK--------------PYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPS 121

Query: 154 NRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWC 195
             I IS SED ++++WN  T K    L L      G    WC
Sbjct: 122 LPIIISGSEDGTVKIWNANTYKLEKTLNL------GLERSWC 157

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 273 TPEFNLQGHTNRVKDF-KFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVA 320
           +P F +  H  R  +F  +Y  +   YL+T   D  + +WD   K  VA
Sbjct: 56  SPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVA 104

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/293 (20%), Positives = 125/293 (42%), Gaps = 47/293 (16%)

Query: 54  LVSGSNDEHIRIYDLQ--KRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGN 111
           L++ +  ++IR+YD++      + +   H+G++T++ F +                   +
Sbjct: 46  LLAAAGHQNIRLYDIKTSNSNPVASFEGHRGNVTSVSFQQ-------------------D 86

Query: 112 SKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           +KW++++S+D  + +W ++        K H + +N+  IHP+    IS   D +IR+W+L
Sbjct: 87  NKWMVTSSEDGTIKVWDIRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 172 --------MTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRE 223
                   +T +    L+      +G  +    + G  +   +         S  K   +
Sbjct: 146 GENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVWEMPNHT---DASNLKPATK 202

Query: 224 LDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTN 283
                S I R+ + + D K ++     + T  ++  +  ++ E++         L GH  
Sbjct: 203 FKAHPSYITRVLLSS-DVK-HMATCSADHTARIWSVEDNFNLEST---------LDGHQR 251

Query: 284 RVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGER-LNCLALCD 335
            V D  F  +    YLVT  SD  + +WD+S ++ +  Y    +   C+AL D
Sbjct: 252 WVWDCAFSADSA--YLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAVCVALND 302

 Score = 32.0 bits (71), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 13/104 (12%)

Query: 210 VLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASE 269
           +  ++  T    R +    S + R+EI N D K  ++ A G+  +       LYD + S 
Sbjct: 14  IRFWEALTGVCLRTIQHPDSQVNRLEITN-DKK--LLAAAGHQNIR------LYDIKTSN 64

Query: 270 EPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
               P  + +GH   V    F ++    ++VT   DG I VWD+
Sbjct: 65  S--NPVASFEGHRGNVTSVSFQQD--NKWMVTSSEDGTIKVWDI 104

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 71/174 (40%), Gaps = 39/174 (22%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQK---------RKELGTLLSH- 80
           P+  F+ H  +V  +   +  +++V+ S D  I+++D++             +  ++ H 
Sbjct: 67  PVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHP 126

Query: 81  -QGSITALKFSKGTKIED----------KNEDDTGLTT--GRGNSKWLISASDDHNLVIW 127
            QG + +       +I D            EDD  L +     +   L++A++  N  +W
Sbjct: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVW 186

Query: 128 RVKDWENFGTLKGHASRINDFDIHPS--NRIAIS--------VSEDHSIRLWNL 171
            + +  +   LK        F  HPS   R+ +S         S DH+ R+W++
Sbjct: 187 EMPNHTDASNLKP----ATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSV 236

>Scas_707.22
          Length = 730

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 72/152 (47%), Gaps = 24/152 (15%)

Query: 29  PIFTP-IFHFQAHSLSV-KCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITA 86
           P F P       H+ SV  CL     Y+++G++D  +RIYD + +K L  L  H+G + A
Sbjct: 342 PSFKPERTTLTGHATSVVTCLQFEDDYVITGADDRQLRIYDARSKKFLKELSGHEGGVWA 401

Query: 87  LKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIN 146
           LK+           D  G+         ++S S D ++ IW +K        KGH S + 
Sbjct: 402 LKY-----------DADGI---------IVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVR 441

Query: 147 DFDI--HPSNRIAISVSEDHSIRLWNLMTVKK 176
             +I  + + +  ++ S D+++ +W L+  +K
Sbjct: 442 CLEIVTYKNMKYIVTGSRDNTLHVWKLIKEEK 473

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 68/157 (43%), Gaps = 43/157 (27%)

Query: 37  FQAHSLSVKCLDI----SKRYLVSGSNDEHIRIYDLQKRKE------------------L 74
           F+ H+ +V+CL+I    + +Y+V+GS D  + ++ L K ++                  +
Sbjct: 433 FKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYFV 492

Query: 75  GTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWEN 134
           G L  H  S+  +                   +G GN   +IS S D+NL++W +   + 
Sbjct: 493 GVLRGHMASVRTI-------------------SGHGN--IVISGSYDNNLMVWDIAQMKC 531

Query: 135 FGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
              L GH  RI         +  IS S D +I++W+L
Sbjct: 532 LYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDL 568

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query: 40  HSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKN 99
           +S S+     +K Y+ +G+    + I+DL    ++  LL H+GSI  +  SK        
Sbjct: 140 YSGSISVFSDTKVYINAGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSK-------- 191

Query: 100 EDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAIS 159
                      N ++++S SDD ++ +W +K  E   T  GH +RI       ++   +S
Sbjct: 192 -----------NGEYVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVS 240

Query: 160 VSEDHSIRLWNL 171
           VSED + R+W++
Sbjct: 241 VSEDCTCRVWDI 252

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 46  CLDISKRYLVSGSNDEHIRIYDLQ 69
           CL+I + Y++ GS    I IYDLQ
Sbjct: 471 CLEICENYILVGSRFSSIAIYDLQ 494

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 62/145 (42%), Gaps = 21/145 (14%)

Query: 34  IFHFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
           +  F+ H   V+ +D   ++   VS  +D  I+++ L   K L TL  H   +  + F  
Sbjct: 46  LHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHLDYVRTVFF-- 103

Query: 92  GTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIH 151
                                 W+ISASDD  + IW  ++      L GH   +     H
Sbjct: 104 -----------------HTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFH 146

Query: 152 PSNRIAISVSEDHSIRLWNLMTVKK 176
           P+  + +S S D ++R+W++  ++K
Sbjct: 147 PTEDLVVSASLDETVRIWDISGLRK 171

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 4/60 (6%)

Query: 115 LISASDDHNLVIWRV---KDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           ++S SDD  + +WR+   K WE   T +GH + ++    HP   + ISV ED +IR+W+L
Sbjct: 224 IVSGSDDRQVKLWRMSSTKAWE-VDTCRGHTNNVDSVIFHPFQNLIISVGEDSTIRVWDL 282

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 85/229 (37%), Gaps = 32/229 (13%)

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTV 174
            +SA DD+++ +W +   +   TL GH   +     H      IS S+D +IR+WN    
Sbjct: 68  FVSAGDDYSIKVWSLSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNR 127

Query: 175 KKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRM 234
           ++   L    +N      ++        + +L   V I+  S  +  R    G  S    
Sbjct: 128 REIACLT--GHNHFVMCAQFHPTEDLVVSASLDETVRIWDISGLR-KRHSAPGSQS---F 181

Query: 235 EIENIDGKDYIVLAFGNGTVS-MFPAKSLYDEEASEEPVTPEF----------------- 276
           E + I  ++     FG+  V  +    +     AS  P  P                   
Sbjct: 182 EEQMITQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSST 241

Query: 277 ------NLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQV 319
                   +GHTN V    F+   F + ++++G D  I VWD+  +  V
Sbjct: 242 KAWEVDTCRGHTNNVDSVIFHP--FQNLIISVGEDSTIRVWDLDKRTPV 288

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 58/153 (37%), Gaps = 49/153 (32%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           +++S S+D+ IRI++ Q R+E+  L  H   +   +F     +                 
Sbjct: 109 WIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDL----------------- 151

Query: 113 KWLISASDDHNLVIWRVKDWEN------------------------FG------TLKGHA 142
             ++SAS D  + IW +                             FG       L+GH 
Sbjct: 152 --VVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHT 209

Query: 143 SRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175
             +N    HP+  + +S S+D  ++LW + + K
Sbjct: 210 RGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTK 242

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 30/62 (48%)

Query: 114 WLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
           W++ A     + +W  +        + H   +   D HP+  + +S  +D+SI++W+L T
Sbjct: 25  WVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLST 84

Query: 174 VK 175
            K
Sbjct: 85  HK 86

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 72/163 (44%), Gaps = 22/163 (13%)

Query: 31  FTPIFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
              I  F+ H   V  L  + R L +GS D  + I+DL   K +  L  H   +  L F 
Sbjct: 324 LCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD 383

Query: 91  KGTKIEDKNEDDT----------GLTTGRGNS----------KWLISASDDHNLVIWRVK 130
              K+   + D T           ++T RG++          K ++S S D  + +W V+
Sbjct: 384 D-QKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVE 442

Query: 131 DWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
               + TLKGH   +N   +HP +    S S+D +IR+W++ T
Sbjct: 443 SRTCY-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484

 Score = 35.0 bits (79), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 68/172 (39%), Gaps = 34/172 (19%)

Query: 34  IFHFQAHSLSVKCLDISKRYL--VSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
            +  + H+  V C+ +  +     S S+D  IR++D++    L     H G +   K   
Sbjct: 446 CYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQ--KVIP 503

Query: 92  GTKIEDKN---------EDDTGLTTGRGN-------------------SKWLISASDDHN 123
            T I+ +N         E+D   + G G                       L+S + D+ 
Sbjct: 504 LTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNT 563

Query: 124 LVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175
           + +W V+      T  GH   +  +DI   N   IS S D SI++W+L + K
Sbjct: 564 IKLWEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGK 613

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 72/160 (45%), Gaps = 22/160 (13%)

Query: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93
           I  F+ H   V  L  + R L +GS D  I I+DL   K +  L  H   +  L F    
Sbjct: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD-R 353

Query: 94  KIEDKNEDDT----------GLTTGRGNS----------KWLISASDDHNLVIWRVKDWE 133
           K+   + D T           ++T RG+S          K ++S S D  + +W V+   
Sbjct: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRT 413

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
            + TL+GH   +N   +HP +    S S+D +IR+W++ T
Sbjct: 414 CY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 67/171 (39%), Gaps = 32/171 (18%)

Query: 35  FHFQAHSLSVKCLDISKRYL--VSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL----- 87
           +  + H+  V C+ +  +     S S+D  IR++D++    L     H G +  +     
Sbjct: 415 YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTI 474

Query: 88  ---------KFSKGTKIED--------------KNEDDTGLTTGRGNSKWLISASDDHNL 124
                      S G+  +D               NE +T L         L+S   D+ +
Sbjct: 475 KDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTI 534

Query: 125 VIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175
            +W VK  +   T  GH   +  +DI   N   IS S D SI++W+L + K
Sbjct: 535 KLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQSGK 583

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 68/147 (46%), Gaps = 24/147 (16%)

Query: 29  PIFTPI-FHFQAHSLSV-KCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITA 86
           P F P     + H  SV  CL     Y+++G++D+ IR+YD   +K L  L  H G + A
Sbjct: 368 PKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWA 427

Query: 87  LKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIN 146
           LK++ G           G+         L+S S D  + +W +K        KGH S + 
Sbjct: 428 LKYAHG-----------GI---------LVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVR 467

Query: 147 DFDI--HPSNRIAISVSEDHSIRLWNL 171
             DI  + + +  ++ S D+++ +W L
Sbjct: 468 CLDIVEYKNIKYIVTGSRDNTLHVWKL 494

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 67/169 (39%), Gaps = 48/169 (28%)

Query: 37  FQAHSLSVKCLDISK----RYLVSGSNDEHIRIYDLQKRKEL------------------ 74
           F+ H+ +V+CLDI +    +Y+V+GS D  + ++ L K   +                  
Sbjct: 459 FKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEE 518

Query: 75  -----GTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRV 129
                G L  H  S+  +                   +G GN   ++S S D+ L++W V
Sbjct: 519 NPYFVGVLRGHMASVRTV-------------------SGHGN--IVVSGSYDNTLIVWDV 557

Query: 130 KDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAG 178
              +    L GH  RI         +  IS S D +IR+W+L  +   G
Sbjct: 558 AQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIWNNG 606

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 63/165 (38%), Gaps = 43/165 (26%)

Query: 28  TPIFTPIFH--FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSIT 85
           TP   P F    + H  SV+ +      +VSGS D  + ++D+ + K L  L  H   I 
Sbjct: 515 TPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIY 574

Query: 86  ALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFG--------- 136
           +  +                       K  ISAS D  + IW +++  N G         
Sbjct: 575 STIYDH-------------------ERKRCISASMDTTIRIWDLENIWNNGECSYATNSA 615

Query: 137 -----------TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
                      TL+GH + +    +  S++  +S + D SIR W+
Sbjct: 616 SPCAKILGAMYTLQGHTALVGLLRL--SDKFLVSAAADGSIRGWD 658

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 64/147 (43%), Gaps = 21/147 (14%)

Query: 32  TPIFHFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           T +  F+ H   V+ +D   ++   VS  +D  I+++ L+  + L TL  H   +  + F
Sbjct: 44  TLLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYTLTGHLDYVRTVFF 103

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
                                   W+ISASDD  + IW  ++ +    L GH   +    
Sbjct: 104 -------------------HSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQ 144

Query: 150 IHPSNRIAISVSEDHSIRLWNLMTVKK 176
            H +  + +S S D ++R+W++  ++K
Sbjct: 145 FHQTEDLVVSASLDETVRVWDISGLRK 171

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 87/218 (39%), Gaps = 60/218 (27%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKG-------------------- 92
           +++S S+D+ +RI++ Q RKEL  L  H   +   +F +                     
Sbjct: 109 WVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASLDETVRVWDISG 168

Query: 93  ----------TKIEDKNEDDTGLTTGR-GNSK-------------W---------LISAS 119
                     T  ED       L  G  G+ K             W         +++  
Sbjct: 169 LRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFHPTLPLIVTGG 228

Query: 120 DDHNLVIWRV---KDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK 176
           DD  + +WR+   K WE   T +GH + ++    HP   + +SV+ED ++R+W+L   K+
Sbjct: 229 DDRQVKLWRMSSNKAWE-VDTCRGHTNNVDCVVFHPDQNLILSVAEDKTLRIWDLD--KR 285

Query: 177 AGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYK 214
             V + K+ N     +R    +   F  A  + ++I+K
Sbjct: 286 TPVKQFKRENDRFWLIR-SHPNMSLFGAAHDSGIMIFK 322

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 50/122 (40%), Gaps = 27/122 (22%)

Query: 63  IRIYDLQKRKELGTLL----SHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISA 118
           I+++D +    +GTLL     H+G + A+ F     I                    +SA
Sbjct: 35  IQLWDYR----MGTLLHRFEGHEGPVRAVDFHPTQPI-------------------FVSA 71

Query: 119 SDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAG 178
            DD ++ +W ++      TL GH   +     H      IS S+D ++R+WN    K+  
Sbjct: 72  GDDASIKVWSLETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELA 131

Query: 179 VL 180
            L
Sbjct: 132 CL 133

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 1/81 (1%)

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
           TK E K+    G+     +  W + A     + +W  +        +GH   +   D HP
Sbjct: 5   TKFESKSTRAKGIAF-HPSRPWALVALFSSTIQLWDYRMGTLLHRFEGHEGPVRAVDFHP 63

Query: 153 SNRIAISVSEDHSIRLWNLMT 173
           +  I +S  +D SI++W+L T
Sbjct: 64  TQPIFVSAGDDASIKVWSLET 84

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 67/143 (46%), Gaps = 17/143 (11%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
           F  H   V  +DI K+   ++SGS D+ I+++ + K + L TLL H   ++ ++      
Sbjct: 103 FVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRV----- 156

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
           + ++  DD  +T        +ISA +D  +  W +  ++      GH S IN     P  
Sbjct: 157 VPNEKADDDSVT--------IISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDG 208

Query: 155 RIAISVSEDHSIRLWNLMTVKKA 177
            +  S  +D  I LWNL   KKA
Sbjct: 209 TLIASAGKDGEIMLWNL-AAKKA 230

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 6/88 (6%)

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVK-DWENFG----TLKGHASRI 145
           +GT +E  N   T L T  G    L+SAS D  L+ W++  D + FG    + KGH+  +
Sbjct: 10  RGT-LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 146 NDFDIHPSNRIAISVSEDHSIRLWNLMT 173
            D  +      A+S S D ++RLW++ T
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLWDVAT 96

 Score = 35.0 bits (79), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 116 ISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           +SAS D  L +W V   E +    GH S +   DI     + IS S D +I++W +
Sbjct: 81  LSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTI 136

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 54.3 bits (129), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 61/130 (46%), Gaps = 22/130 (16%)

Query: 44  VKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDT 103
           V C      Y+++G++D+ I +YD  + +    L+ H+G + ALK++ G +I        
Sbjct: 370 VTCFQFEGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKYA-GDEI-------- 420

Query: 104 GLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI--HPSNRIAISVS 161
                      L+S S D  + IW VK  +     +GH S +   D+  H   +  ++ S
Sbjct: 421 -----------LVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGS 469

Query: 162 EDHSIRLWNL 171
            D+++ +W L
Sbjct: 470 RDNTLHVWKL 479

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 82/192 (42%), Gaps = 25/192 (13%)

Query: 37  FQAHSLSVKCLDISK----RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKG 92
           F+ H+ +V+CLD+ +    +Y+V+GS D  + ++ L          S   +  A++  + 
Sbjct: 444 FRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPN------SPDYNPNAMR--QF 495

Query: 93  TKIEDKNEDDTGLTTGR--------GNSKWLISASDDHNLVIWRVKDWENFGTLKGHASR 144
             IED N    G+  G         G+   ++S S DHNL++W +   +    L GH  R
Sbjct: 496 NSIED-NPFFVGVLRGHMASVRTVSGHGNIVVSGSYDHNLMVWDIAKMKLLYVLTGHTDR 554

Query: 145 INDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVL----KLKKYNQNGQFVRWCGDSGE 200
           I         +  IS S D ++++W+L  +   G +           +G     CG +  
Sbjct: 555 IYSTLYDHKRKRCISASMDTTVKVWDLSDINNNGPVSQINSTSALKVSGSVRTLCGHTAL 614

Query: 201 FFAVALLTKVLI 212
              + L  K L+
Sbjct: 615 VGLLGLSDKYLV 626

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 7/127 (5%)

Query: 48  DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTT 107
           D  ++  +S S D  ++++DL      G + S   S +ALK S   +    +    GL  
Sbjct: 561 DHKRKRCISASMDTTVKVWDLSDINNNGPV-SQINSTSALKVSGSVRTLCGHTALVGLLG 619

Query: 108 GRGNSKWLISASDDHNLVIWRVKDW-ENFGTLKGHASRINDFDIHPSNRIAISVSEDHSI 166
              + K+L+SA+ D +L  W   D+ + F     + S I  F +  S+ I +S SE H  
Sbjct: 620 L--SDKYLVSAAADGSLRGWDASDYSKRFSFHHTNQSAITTFFV--SDNILVSGSE-HQF 674

Query: 167 RLWNLMT 173
            +++L T
Sbjct: 675 NIYDLRT 681

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 98/214 (45%), Gaps = 32/214 (14%)

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTV 174
           L+S   D+ + +W +    +F  L+GHA R++   +HPS R+A S S D +  LW+L   
Sbjct: 230 LLSGGGDNLVKLWDMTS-NSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDL--- 285

Query: 175 KKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRM 234
           ++   L+L++ +    +       G   A A L  V            +L +G+  IM++
Sbjct: 286 ERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAI--------WDLRSGE-PIMKL 336

Query: 235 E--IENIDGKDY------IVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVK 286
           E     I G D+      +  A  +GTV ++  +++  E A          L  H     
Sbjct: 337 EGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESA----------LLAHQVAAL 386

Query: 287 DFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVA 320
           D KF KN  G +LV+ G D  + +++  N +++A
Sbjct: 387 DVKFKKNN-GTFLVSCGHDRLVNIFNADNWQKLA 419

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 58/139 (41%), Gaps = 20/139 (14%)

Query: 33  PIFHFQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           PI   + H+ ++  +D S     L +   D  +R++D++       LL+HQ +   +KF 
Sbjct: 332 PIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDVKFK 391

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
           K                   N  +L+S   D  + I+   +W+   +L+GH  R+   DI
Sbjct: 392 KN------------------NGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVFTVDI 433

Query: 151 HPSNRIAISVSEDHSIRLW 169
                   S  +D S++ W
Sbjct: 434 TEDGSTIYSGGKDRSLKQW 452

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 88/192 (45%), Gaps = 36/192 (18%)

Query: 34  IFHFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKEL-GTLLSHQGSITALKFS 90
           +  F+AH   ++ + +  +K Y++SGS+D  +++++ +    L  T   H+  +  + F+
Sbjct: 90  VVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFN 149

Query: 91  -------------KGTKIED--KNEDDTGLTTG--RG----------NSKWLISASDDHN 123
                        +  K+    ++  +  LTTG  RG          +  ++I+ASDD  
Sbjct: 150 PKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLT 209

Query: 124 LVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLK 183
           + IW  +      TL+GH S ++    HP+  I IS SED ++++WN  T K    L + 
Sbjct: 210 IKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNV- 268

Query: 184 KYNQNGQFVRWC 195
                G    WC
Sbjct: 269 -----GLERSWC 275

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%)

Query: 114 WLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           W+I  SDD  + ++     E     + H   I    +HP+    +S S+D +++LWN
Sbjct: 69  WIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWN 125

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 42/105 (40%), Gaps = 19/105 (18%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRG 110
           K Y+++ S+D  I+I+D Q +  + TL  H  +++   F     I               
Sbjct: 198 KPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPI--------------- 242

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNR 155
               +IS S+D  L IW    ++   TL     R      HP+ R
Sbjct: 243 ----IISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGR 283

>Scas_465.4
          Length = 1002

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 19/133 (14%)

Query: 40  HSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKN 99
           +S S+K     K Y+ +G+    + I+DL    +L  L+ H+GSI     S         
Sbjct: 138 YSGSIKEFSPEKVYISAGTVMGGVLIWDLFLETKLYNLVGHEGSIFYATISD-------- 189

Query: 100 EDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAIS 159
                      N +++ S SDD ++ +W ++  E   T  GH +RI +     ++   IS
Sbjct: 190 -----------NGRYITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQLIS 238

Query: 160 VSEDHSIRLWNLM 172
           VSED++ R+W+++
Sbjct: 239 VSEDNTCRVWDIL 251

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 62/155 (40%), Gaps = 30/155 (19%)

Query: 32  TPIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           T +++   H  S+    IS   RY+ S S+D  I++++LQ  +EL T   H   I  LKF
Sbjct: 170 TKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKF 229

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIND-- 147
                                N   LIS S+D+   +W +   E  G      S+I +  
Sbjct: 230 -------------------FNNDTQLISVSEDNTCRVWDILQDEGNGNTSLTLSQIYEVH 270

Query: 148 -------FDIHPSNRIAISVSEDHSIRLWNLMTVK 175
                   DI   + +A++   D  ++L  +   K
Sbjct: 271 LIKNVWGVDIQEKDMVAVTSGNDGRLKLTKIQDTK 305

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 124 LVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK------- 176
           ++IW +        L GH   I    I  + R   S S+D SI+LWNL T ++       
Sbjct: 161 VLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGH 220

Query: 177 -AGVLKLKKYNQNGQFV 192
            A +  LK +N + Q +
Sbjct: 221 TARIWNLKFFNNDTQLI 237

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 15/74 (20%)

Query: 111 NSKWLISASDDHNLVIWRVKD---WENFGTLKGHAS--------RINDFDI----HPSNR 155
           N K++IS+S    L +W + D      F T++            RI DFD     H  N 
Sbjct: 711 NGKYMISSSAREELFLWEINDDYKLHPFITIRQTLPASSDNPDLRIMDFDAIFLEHSDNF 770

Query: 156 IAISVSEDHSIRLW 169
           I  +V  D S++LW
Sbjct: 771 IISTVYSDSSVKLW 784

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 6/56 (10%)

Query: 262 LYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKE 317
           L++ +  EE  T      GHT R+ + KF+ N+    L+++  D    VWD+   E
Sbjct: 205 LWNLQTGEELCTG----WGHTARIWNLKFFNND--TQLISVSEDNTCRVWDILQDE 254

>Kwal_56.23920
          Length = 937

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 75/350 (21%), Positives = 132/350 (37%), Gaps = 78/350 (22%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK-GTKIEDKNED--------- 101
           R L  G ND  I+I+DL  +  L +   H+ +IT L F + GT++   + D         
Sbjct: 88  RLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLV 147

Query: 102 -DTGLTTGRGNS-----------KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
            + GL   R +            +WLIS S D  + +W +K  +   T   H        
Sbjct: 148 GEVGLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMG 207

Query: 150 IHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKL------KKYNQNGQFVRW--CGDSGEF 201
           +H    + I+   D+ I+LWNL   + AG + +      K+  Q G  +++    D   F
Sbjct: 208 VHED--LVITAGADNQIKLWNLNFEESAGSMLIEKGTHEKQSRQRGVAIQFTTVSDETTF 265

Query: 202 FAV-----ALLTKVLIYKTSTAKV--HRELDTGKSSIMRMEIE----------------- 237
           F +     ++ T  L  +   AK    RE    +  +   EI+                 
Sbjct: 266 FFIQNADRSVETFRLRKQDEIAKALKKREKRLTEKGLSEDEIQQNLKDSFTSFIMHPFQI 325

Query: 238 --------------NIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEF---NLQG 280
                             K  +V+   N TV  +  K  Y +     P  P+    +++G
Sbjct: 326 VRSIYKVRSVCWATTTTSKLDLVVTTANNTVDYYSIK--YQKREPTMPSPPKLHSIDIRG 383

Query: 281 HTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERLNC 330
           H + V+      +   + L+   S+G + +W++     +  ++CG  L C
Sbjct: 384 HRSDVRAIDISGD---NKLLATASNGTLKIWNIKTNSCIRTFECGYALAC 430

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 68/159 (42%), Gaps = 24/159 (15%)

Query: 34  IFHFQAH--SLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
           +  F  H  ++++   D +   L+SGS D  I ++DL     L  L SH+ SIT L + +
Sbjct: 110 LISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGL-WCE 168

Query: 92  GTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIH 151
           G                    +WLIS S D  + +W +K  +   T   H        +H
Sbjct: 169 G-------------------EEWLISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMGVH 209

Query: 152 PSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQ 190
               + I+   D+ I+LWNL   + AG + ++K     Q
Sbjct: 210 ED--LVITAGADNQIKLWNLNFEESAGSMLIEKGTHEKQ 246

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 52/134 (38%), Gaps = 21/134 (15%)

Query: 39  AHSLSVKCLDIS--KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
            H L V  +DIS   + L++ S D++I+I+ L       +L +H  SI  + F      E
Sbjct: 565 GHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVP----E 620

Query: 97  DKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRI 156
             N                 S S D  +  W    +E    L  H   +    I    R 
Sbjct: 621 SHN---------------FFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLAISSDGRF 665

Query: 157 AISVSEDHSIRLWN 170
            +S S D SIR+W+
Sbjct: 666 VVSASHDQSIRVWS 679

 Score = 35.0 bits (79), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 66/135 (48%), Gaps = 5/135 (3%)

Query: 39  AHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
           AHS ++  LD++   + LV+GS D+ +  +D Q  +E     + + +   LK    T +E
Sbjct: 465 AHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFN-PKLKMFHDTTLE 523

Query: 97  DKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRI 156
             N+D   +     N    +S  D+  + ++ +   + F +L GH   +   DI   +++
Sbjct: 524 -LNDDVLAVKISPDNRLLAVSLLDN-TVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKL 581

Query: 157 AISVSEDHSIRLWNL 171
            I+ S D +I++W L
Sbjct: 582 LITSSADKNIKIWGL 596

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 62/142 (43%), Gaps = 22/142 (15%)

Query: 33  PIFHFQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           P+  F  H   V C+       Y+++GS+D+  R++D+Q    +   L H  S+ ++  S
Sbjct: 618 PLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVS 677

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHA-SRINDFD 149
                               + +WL + S+D  +++W +   +    ++GH  S +    
Sbjct: 678 P-------------------DGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLS 718

Query: 150 IHPSNRIAISVSEDHSIRLWNL 171
            +    I +S   D S+R+W+L
Sbjct: 719 FNKEGNILVSGGADQSVRVWDL 740

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 63/152 (41%), Gaps = 34/152 (22%)

Query: 34  IFHFQAHSLSVKCLDIS--KRYLVSGSNDEHIRIYDL----------QKRKELG---TLL 78
           ++ F   +  + CL  S   R + +G  D +I+++ L           K K+     TL+
Sbjct: 480 MYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI 539

Query: 79  SHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTL 138
            H G + ++ FS                    ++++L+SAS+D  + +W +  +    + 
Sbjct: 540 GHSGPVYSVSFSP-------------------DNRYLVSASEDKTVRLWSLDTYTCLVSY 580

Query: 139 KGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           KGH   + D    P      + S D + RLW+
Sbjct: 581 KGHNHPVWDVKFSPLGHYFATGSHDQTARLWS 612

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 6/90 (6%)

Query: 84  ITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHAS 143
           +T L+FS  +++      D+ +        W +  +   + +  + KD  N  TL GH+ 
Sbjct: 490 MTCLRFSDDSRLVAAGFQDSYIKL------WSLDGTPLESQLPSKAKDASNTVTLIGHSG 543

Query: 144 RINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
            +      P NR  +S SED ++RLW+L T
Sbjct: 544 PVYSVSFSPDNRYLVSASEDKTVRLWSLDT 573

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 64/163 (39%), Gaps = 25/163 (15%)

Query: 39  AHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK----- 91
            HS  V  +  S   RYLVS S D+ +R++ L     L +   H   +  +KFS      
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 92  GTKIEDKNE------------------DDTGLTTGRGNSKWLISASDDHNLVIWRVKDWE 133
            T   D+                    +D    T   N  ++++ S D    +W ++  +
Sbjct: 600 ATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGD 659

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK 176
           +     GH + +    + P  R   + SED  I +W++ T K+
Sbjct: 660 SVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKR 702

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 72/173 (41%), Gaps = 30/173 (17%)

Query: 37  FQAHSLSVKCL---DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93
              H+  V+C+    +   +  +GSND  I+I+DL   K   TL+ H  S+  +  SK  
Sbjct: 118 INGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISK-- 175

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153
                               ++ SAS+D  +  W ++         GH S ++  D+HPS
Sbjct: 176 -----------------RHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPS 218

Query: 154 NRIAISVSEDHSIRLWNLMTVKKAGVL--------KLKKYNQNGQFVRWCGDS 198
             I  +   D  +RLW++ +  +  VL        K+K    + Q +   GD+
Sbjct: 219 LDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDA 271

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 58/142 (40%), Gaps = 22/142 (15%)

Query: 32  TPIFHFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           T I  F  H   V  +D+  S   + +   D  +R++D++ R E+  L  H+  I  +K 
Sbjct: 198 TAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKC 257

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
                ++ +                +IS S D  + +W +   +    L  H+  I D  
Sbjct: 258 ---LPVDPQ----------------IISCSGDATVRLWDIIAGKASKVLTHHSRNIRDLT 298

Query: 150 IHPSNRIAISVSEDHSIRLWNL 171
           +HP+     SVS +  +R W L
Sbjct: 299 LHPAEFSFASVSTN-DVRSWKL 319

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 112/266 (42%), Gaps = 45/266 (16%)

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWEN-FG----TLKGHASRI 145
           +GT +E  N   T L+T       L+S S D  L+ WR+ + E  FG    + KGH+  +
Sbjct: 11  RGT-LEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIV 69

Query: 146 NDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVA 205
            D  +      A+S S D ++RLWNL T            N   +FV   G +G+  +VA
Sbjct: 70  QDVVVSADGNYAVSASWDKTLRLWNLAT-----------GNSEARFV---GHTGDVLSVA 115

Query: 206 L-LTKVLIYKTSTAKVHRELDT---------GKS---SIMRMEIENI-DGKDYIVLAFGN 251
           +      I   S  K  R  +T         G +   + +R+  +N+ DG+        +
Sbjct: 116 IDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLEDGE------VDD 169

Query: 252 GTVSMFPA---KSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKI 308
           G ++   A   K +     +E+    E +  GH N +   +   +  G    + G DG+I
Sbjct: 170 GRITFVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQ--PSPDGSLAASAGKDGQI 227

Query: 309 VVWDMSNKEQVAVYDCGERLNCLALC 334
            VW++ +K     +D  + +  LA  
Sbjct: 228 YVWNLKHKSAFMNFDAKDEVFALAFS 253

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 13/132 (9%)

Query: 42  LSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNED 101
           LSV  +D +   ++S S D+ IR+++         LL H   +T ++ +    +ED   D
Sbjct: 112 LSV-AIDANSSKIISASRDKTIRVWNTVGDCAY-VLLGHTDWVTKVRVAP-KNLEDGEVD 168

Query: 102 DTGLTTGRGNSKWLISASDDHNLVIWRVKD--WENFGTLKGHASRINDFDIHPSNRIAIS 159
           D  +T         +SA  D  +  W + +  +       GH + IN     P   +A S
Sbjct: 169 DGRIT--------FVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSPDGSLAAS 220

Query: 160 VSEDHSIRLWNL 171
             +D  I +WNL
Sbjct: 221 AGKDGQIYVWNL 232

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 60/137 (43%), Gaps = 19/137 (13%)

Query: 39  AHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDK 98
           + SL +   D S   +V G +   I +YD +   +L  + +H   +T +K      +   
Sbjct: 99  SESLDLISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAV--- 155

Query: 99  NEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAI 158
                           L+S S D  L +W ++D  N  TLKGH++ I D  I    R  +
Sbjct: 156 ----------------LLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVL 199

Query: 159 SVSEDHSIRLWNLMTVK 175
           S S D S+RLW L + K
Sbjct: 200 SSSLDGSVRLWELGSGK 216

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 84/192 (43%), Gaps = 36/192 (18%)

Query: 34  IFHFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELG-TLLSHQGSITALKFS 90
           +  F+AH   ++ + +  +K ++++GS+D  I++++ +K      T   H+  + ++ F+
Sbjct: 90  VTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFN 149

Query: 91  K-------------GTKIEDKNEDDTGLTTGRGNSK--------------WLISASDDHN 123
                           K+    +D    T     +K              +LI+ SDD  
Sbjct: 150 PKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGT 209

Query: 124 LVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLK 183
           + +W  +   N  TL+GH + ++    HP+  I IS SED ++++WN      A   KL+
Sbjct: 210 IKVWDYQTKSNVATLEGHMANVSYAVFHPTLPIIISGSEDGTLKIWN------ANTYKLE 263

Query: 184 KYNQNGQFVRWC 195
           K    G    WC
Sbjct: 264 KTLNIGLERSWC 275

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 52/126 (41%), Gaps = 5/126 (3%)

Query: 47  LDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLT 106
           LDI+K+     +  + ++  D    +    +  + G I    +   T++      D  + 
Sbjct: 3   LDINKKL---SARTDRVKGIDFHPEEPWVLITLYSGRIEIWNYETQTQVRSIPLCDAPVR 59

Query: 107 TGR--GNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDH 164
            GR      W++  SDD  L ++     E     + H   I    +HP+    ++ S+D 
Sbjct: 60  AGRFIARKNWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDL 119

Query: 165 SIRLWN 170
           +I+LWN
Sbjct: 120 TIKLWN 125

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/253 (20%), Positives = 99/253 (39%), Gaps = 38/253 (15%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRG 110
           K ++V GS+D  +R+Y+    +++    +H   I ++             DD  +     
Sbjct: 67  KNWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNW 126

Query: 111 NSKW-------------------------LISASDDHNLVIWRV-KDWENFGTLKGHASR 144
              W                           S   DH + +W + +D  NF TLK H ++
Sbjct: 127 EKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNF-TLKAHETK 185

Query: 145 -INDFDIHP--SNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEF 201
            +N  D +P       I+ S+D +I++W+  T  K+ V  L+ +  N  +  +       
Sbjct: 186 GVNYVDYYPLQDKPYLITTSDDGTIKVWDYQT--KSNVATLEGHMANVSYAVFHPTLPII 243

Query: 202 FAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKS 261
            + +    + I+  +T K+ + L+ G      +       ++YI   F NG    F   S
Sbjct: 244 ISGSEDGTLKIWNANTYKLEKTLNIGLERSWCIATHPSGKRNYIASGFDNG----FTVLS 299

Query: 262 LYDEEA--SEEPV 272
           L D++   S +PV
Sbjct: 300 LGDDQPKLSLDPV 312

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 51/128 (39%), Gaps = 24/128 (18%)

Query: 33  PIFHFQAH-SLSVKCLDI----SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL 87
           P F  +AH +  V  +D      K YL++ S+D  I+++D Q +  + TL  H  +++  
Sbjct: 175 PNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYA 234

Query: 88  KFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIND 147
            F     I                   +IS S+D  L IW    ++   TL     R   
Sbjct: 235 VFHPTLPI-------------------IISGSEDGTLKIWNANTYKLEKTLNIGLERSWC 275

Query: 148 FDIHPSNR 155
              HPS +
Sbjct: 276 IATHPSGK 283

 Score = 35.4 bits (80), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 274 PEFNLQGH-TNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVA 320
           P F L+ H T  V    +Y  +   YL+T   DG I VWD   K  VA
Sbjct: 175 PNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVA 222

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 19/119 (15%)

Query: 54  LVSGSNDEHIRIYDLQKRKE--LGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGN 111
           + +G  D  I ++D++KR E  L  +L+H+  +T ++FSK         +D G       
Sbjct: 364 VATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSK---------EDGG------- 407

Query: 112 SKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
            K L+S   D+ + ++    W   G+L GH  +I   DI  ++   +S   D SI+LWN
Sbjct: 408 -KKLVSCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN 465

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%)

Query: 135 FGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
            G L GH  RI+D   HPS +   S S D + RLW+  T
Sbjct: 258 LGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDAST 296

>Kwal_23.5769
          Length = 627

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 70/158 (44%), Gaps = 22/158 (13%)

Query: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93
           I  F+ H   V  L  + R L +GS D  + I+DL   K +  L  H+  + A+ F  G 
Sbjct: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD-GQ 368

Query: 94  KIEDKNEDD--------TGLTT----GRGNS--------KWLISASDDHNLVIWRVKDWE 133
           K+   + D         TG       G  +S        K ++S S D  + +W V+   
Sbjct: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRT 428

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
            + TL+GH   +    +HP +    S S+D +IR+W++
Sbjct: 429 CY-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDI 465

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 57/140 (40%), Gaps = 22/140 (15%)

Query: 56  SGSNDEHIRIYDLQKRKELGTLLSHQGSI----------TALKFSKGTKIEDKNEDDTGL 105
           SGS+D  IR++D++    +     H G +          T    +  T    +NE  T  
Sbjct: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512

Query: 106 TTGRGN----------SKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNR 155
               G              L+S S D+ + +W V+  +   T  GH   I  +DI   N 
Sbjct: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNF 570

Query: 156 IAISVSEDHSIRLWNLMTVK 175
             +S + D ++++W+L + K
Sbjct: 571 RIVSGAHDKTVKVWDLQSGK 590

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL 87
           +VSG++D+ ++++DLQ  K + T  SHQ  IT +
Sbjct: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 99/231 (42%), Gaps = 26/231 (11%)

Query: 35  FHFQAHSLSVKCLDISKRYLV-SGSNDEHIRIYDLQKR-KELGTLLSHQGSITALKFSKG 92
           +    H+ SV C+    + L+ SGS+D  +R++D+  + + +  L SH   +  L  S  
Sbjct: 272 YTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTD 331

Query: 93  TKIEDKNEDDTG-------------------LTTGRGNS-KWLISASDDHNLVIWR-VKD 131
             +     D TG                   +    GNS + +++ASDD+ + +W  +K 
Sbjct: 332 YALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKS 391

Query: 132 WENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQF 191
            +    + GH   +N     P  R  +S S D+SI+LW+    K   +   + +  +   
Sbjct: 392 TKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGK--FISTFRGHVASVYQ 449

Query: 192 VRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGK 242
           V W  D     + +  T + ++   T K+  +L   K  +  ++  ++DGK
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDW-SVDGK 499

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 54/140 (38%), Gaps = 21/140 (15%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           PI     H   V  +  S   RY+VS S D  I+++D +  K + T   H  S+  + +S
Sbjct: 394 PIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWS 453

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
              ++                   L+S S D  L +W V+  +    L GH   +   D 
Sbjct: 454 SDCRL-------------------LVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDW 494

Query: 151 HPSNRIAISVSEDHSIRLWN 170
               +   S  +D  +RLW 
Sbjct: 495 SVDGKRVCSGGKDKMVRLWT 514

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 62/152 (40%), Gaps = 31/152 (20%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSK 113
           +V+G+ D   RI+D   +  + TL  H   +  + +S   ++                  
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEV------------------ 200

Query: 114 WLISASDDHNLVIWRVKDWENFG-TLKGHASRINDFDIHP--------SNRIAISVSEDH 164
            + + S D+ + +W  K  +  G  L+GH+  I      P          R+A S S+D 
Sbjct: 201 -IATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLA-SSSKDG 258

Query: 165 SIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG 196
           +I++W+  TV +     +  +  +   V+W G
Sbjct: 259 TIKIWD--TVSRVCQYTMSGHTNSVSCVKWGG 288

>Kwal_26.8953
          Length = 458

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 69/162 (42%), Gaps = 30/162 (18%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
           FQ H+  V+ LDI   Y+++GSND  +R+      + L   + H   +  +K      +E
Sbjct: 258 FQPHAEWVRSLDIMGEYIITGSNDCTVRVSHWPTGRALSFGIGHDFPVEQVKI---IPME 314

Query: 97  DKNEDDTGLTTGRGNSK--------WLISASDDHNLVIWRVK-----------------D 131
               DD    T    +K         ++S S D+ L IW+V                   
Sbjct: 315 LSESDDPQNNTYSAFNKDYLPLGFSHVVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAH 374

Query: 132 WENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
           +    TLKGH+S + D  +       IS S+D S+R+W+L T
Sbjct: 375 FTLVKTLKGHSSWVRDIRVR--GNFIISCSDDRSVRVWDLET 414

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 100/253 (39%), Gaps = 40/253 (15%)

Query: 76  TLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENF 135
           T  +  G++T ++FS   ++      D+ +        W +  S   +++  + KD  N 
Sbjct: 493 TFHNTNGNMTCVEFSDDARLTAAGFQDSTIKV------WYLDGSPLQSILPSKAKDQSNS 546

Query: 136 GTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWC 195
            TL GH+  +      P NR  +S SED ++RLW+L T     ++  K +N    +V++ 
Sbjct: 547 ATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTF--TCLVCYKGHNHPVWYVKF- 603

Query: 196 GDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVS 255
              G +F  A           TA++          I    + ++D              S
Sbjct: 604 SPLGHYFITA-------SHDQTARLWSCDHIYPLRIFSGHLNDVD-------------CS 643

Query: 256 MFPAKSLYDEEASEEPVTPEFNLQ---------GHTNRVKDFKFYKNEFGHYLVTIGSDG 306
            F     Y    S +     +++Q         GHT+ V   +   +  G +L T   DG
Sbjct: 644 TFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPD--GRWLTTGSEDG 701

Query: 307 KIVVWDMSNKEQV 319
            I+VWD+   +++
Sbjct: 702 TIIVWDIGTGKRI 714

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 62/153 (40%), Gaps = 23/153 (15%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK-------------------- 91
           RYL+S S D+ +R++ L     L     H   +  +KFS                     
Sbjct: 566 RYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCD 625

Query: 92  ---GTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDF 148
                +I   + +D   +T   N  ++ + S D    +W ++  ++     GH S +   
Sbjct: 626 HIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTAL 685

Query: 149 DIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLK 181
           ++ P  R   + SED +I +W++ T K+   +K
Sbjct: 686 EVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMK 718

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/152 (19%), Positives = 61/152 (40%), Gaps = 34/152 (22%)

Query: 34  IFHFQAHSLSVKCLDIS--KRYLVSGSNDEHIRIYDL-------------QKRKELGTLL 78
           ++ F   + ++ C++ S   R   +G  D  I+++ L             + +    TL+
Sbjct: 491 MYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLV 550

Query: 79  SHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTL 138
            H G + ++ FS                    ++++L+SAS+D  + +W +  +      
Sbjct: 551 GHSGPVYSVAFSP-------------------DNRYLLSASEDKTVRLWSLDTFTCLVCY 591

Query: 139 KGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           KGH   +      P     I+ S D + RLW+
Sbjct: 592 KGHNHPVWYVKFSPLGHYFITASHDQTARLWS 623

>Scas_692.25
          Length = 488

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 66/161 (40%), Gaps = 28/161 (17%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
           F  H+  V+CLD+S  +++SGS D  +R+        L   + H+  I ++KF       
Sbjct: 275 FHPHNEWVRCLDVSGDFVLSGSQDASLRLTHWPSGNGLSIGIGHEFPIESVKFILPLSTN 334

Query: 97  DKNEDDTGLTTG---------RGNSKWLISASDDHNLVIWRVK----------------- 130
           +K                   + + K+  SAS D  + IW +                  
Sbjct: 335 EKASPTINYLRKPLEIDSDYEKMSFKYCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNS 394

Query: 131 DWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           +++   TLKGHAS + D  I        S S+D +IR WNL
Sbjct: 395 NFKCIMTLKGHASWVKDLRIR--GNYLFSCSDDKTIRCWNL 433

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 68/156 (43%), Gaps = 20/156 (12%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
           F+ H   V  L  + R L +GS D  + I+D +    +  L  H   +  + F     I 
Sbjct: 308 FKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMIT 367

Query: 97  DKNEDD---------TGLTTGRGNS----------KWLISASDDHNLVIWRVKDWENFGT 137
              +           + ++T RG+           K ++SAS D  + +W V+    + T
Sbjct: 368 ASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCY-T 426

Query: 138 LKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
           L+GH   +N   +HP +    S S+D ++R+W++ T
Sbjct: 427 LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 67/164 (40%), Gaps = 27/164 (16%)

Query: 35  FHFQAHSLSVKCLDISKRYLV--SGSNDEHIRIYDLQKRKELGTLLSHQGSITAL----- 87
           +  + H+  V C+ +  +     S S+D+ +R++D++    +     H G +  +     
Sbjct: 425 YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTI 484

Query: 88  -------------KFSKGTKIEDKNEDDTGLTTGRGNSKW---LISASDDHNLVIWRVKD 131
                        K       ED  +D TG+     N K+   L+S S D+ + +W V  
Sbjct: 485 KDTENLVVDEKIEKVPNPELEEDFADDCTGIFDP--NLKYPTHLLSCSLDNTIKLWEVSS 542

Query: 132 WENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175
                T  GH   +  +DI   N   +S S D SI++W+L   K
Sbjct: 543 GRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDLQNGK 584

 Score = 32.0 bits (71), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL 87
           +VSGS+D+ I+++DLQ  K + T   H+  I  +
Sbjct: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 59/293 (20%), Positives = 122/293 (41%), Gaps = 47/293 (16%)

Query: 54  LVSGSNDEHIRIYDLQ--KRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGN 111
           L++ +  +++R+YD++      + +   H+G++T++ F +                   +
Sbjct: 46  LLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQ-------------------D 86

Query: 112 SKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           ++W++++S+D  + +W V+   +      H + +N+  IHP+    IS   D +IR+W+L
Sbjct: 87  NRWMVTSSEDGTIKVWDVRS-PSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 172 --------MTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRE 223
                   +T +    L+      +G  +      G  +   +         S  K   +
Sbjct: 146 GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHT---DASHLKPVTK 202

Query: 224 LDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTN 283
                + I R+ + + D K ++     + T  ++         + ++    E  L GH  
Sbjct: 203 FRAHSTYITRILLSS-DVK-HLATCSADHTARVW---------SIDDDFKLETTLDGHQR 251

Query: 284 RVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGER-LNCLALCD 335
            V D  F  +    YLVT  SD  + +WD+S +E V  Y    +   C+AL D
Sbjct: 252 WVWDCAFSADSA--YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 64/169 (37%), Gaps = 17/169 (10%)

Query: 210 VLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASE 269
           +  ++  T    R +    S + R+EI N D K  ++   G+  V       LYD   + 
Sbjct: 14  IRFWEALTGVCSRTIQHSDSQVNRLEITN-DKK--LLATAGHQNVR------LYDIRTTN 64

Query: 270 EPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERLN 329
               P  + +GH   V    F ++    ++VT   DG I VWD+ +      Y     +N
Sbjct: 65  P--NPVASFEGHRGNVTSVSFQQD--NRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 330 CLALCDESVEKYEMMKKRVAEEADLGE----QSEVEEDTESLKKIMMGN 374
            + +     E     +       DLGE         ED  SL+ + M +
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMAS 169

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 47/112 (41%), Gaps = 22/112 (19%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLL-SHQGSITALKF 89
           P+  F+AHS  +  + +S   ++L + S D   R++ +    +L T L  HQ  +    F
Sbjct: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAF 258

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGH 141
           S                    +S +L++AS DH + +W +   E      GH
Sbjct: 259 S-------------------ADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291

>Kwal_23.6429
          Length = 750

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 96/253 (37%), Gaps = 50/253 (19%)

Query: 46  CLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALK-FSKGTKIEDKNEDDT- 103
           C     ++L +G+ D+ IRI+DL  R+ + TL  H+  I +L  F  G K+   + D T 
Sbjct: 477 CFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTV 536

Query: 104 ------------------GLTT---GRGNSKWLISASDDHNLVIW---------RVKDWE 133
                             G+TT     G+ K + + S D  + IW         R+    
Sbjct: 537 RIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSEN 596

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVR 193
             GT  GH   +            +S S D S++LWNL +    G     K N     V 
Sbjct: 597 ELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSAN--GGTAEGKANTAASEVT 652

Query: 194 WCGDSGEFFAVALLTK------------VLIYKTSTAKVHRELDTGKSSIMRMEIENID- 240
           + G      +VA                VL + T +      L   ++S++ + + N   
Sbjct: 653 YTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHP 712

Query: 241 -GKDYIVLAFGNG 252
            G +Y V A G+G
Sbjct: 713 LGPEYGVFATGSG 725

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 99/244 (40%), Gaps = 35/244 (14%)

Query: 114 WLISASDDHNLVIWRVKD----WENFGTLKGHASRINDFDI-HPSNR----IAISVSEDH 164
           WL +AS DH++++WR  +    +E F    GHA  +    + +  NR      ++ S D 
Sbjct: 396 WLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDL 455

Query: 165 SIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGD----------SGEFFAVALLTKVL-IY 213
           +I+ W +        ++L    +  ++ R   +          +   FA A   K   I+
Sbjct: 456 TIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATASYDKTCKIW 515

Query: 214 KTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVT 273
              T +V   L   K  +  +     D    +    G+ +++++          S E  T
Sbjct: 516 NVDTGEVEATLANHKRGLWGVAFCEYDW--LLATCSGDRSINLW----------SLESFT 563

Query: 274 PEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDC-GERLNCLA 332
               L+GHTN V+   F        LV+ G+DG + +WD S  E V   D    R+  LA
Sbjct: 564 VLKTLEGHTNAVQRVSFING--NKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALA 621

Query: 333 LCDE 336
           + ++
Sbjct: 622 VAND 625

 Score = 35.8 bits (81), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 55/301 (18%), Positives = 115/301 (38%), Gaps = 49/301 (16%)

Query: 37  FQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKR----KELGTLLSHQGSITALKFS 90
           ++ H+  +  LD +    +L + S D  + ++   +     +     L H G +TA+   
Sbjct: 378 YEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALP 437

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFG-------------T 137
                             R   ++L++AS+D  +  W+V +  +               T
Sbjct: 438 N--------------VMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYT 483

Query: 138 LKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGD 197
            + H   IN   + P++ I  + S D + ++WN+ T +    L   K    G  V +C  
Sbjct: 484 RRAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWG--VAFCEY 541

Query: 198 SGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMF 257
                  +    + ++   +  V + L+   +++ R+    I+G   +V    +G V   
Sbjct: 542 DWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSF--INGNKQLVSTGADGLVK-- 597

Query: 258 PAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKE 317
               ++D    E   T    L  H NR+       +  G  ++T  +DG    W+ +++E
Sbjct: 598 ----IWDCSTGECVRT----LDAHNNRIWALAVAND--GQLIITADADGVFQFWEDNSEE 647

Query: 318 Q 318
           +
Sbjct: 648 E 648

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 17/104 (16%)

Query: 48  DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTT 107
           D S   L  G  D  + ++D+       +L  H  +I+++KF          E D+G+  
Sbjct: 110 DESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKF--------YGEVDSGM-- 159

Query: 108 GRGNSKWLISASDDHNLV-IWRVKDWENFGTLKGHASRINDFDI 150
                 WL+++ D + +V IW +       T++ H + +   DI
Sbjct: 160 ------WLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLDI 197

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 72/166 (43%), Gaps = 32/166 (19%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGS-----ITALKFSK 91
           FQ H+  V+ L++   Y+++GSND  IR+        L   + H+       I  ++ + 
Sbjct: 251 FQPHNQWVRTLELHGDYVITGSNDATIRLSHWPSGNGLSMAVMHEFPIERVLIIPMRANT 310

Query: 92  GTKIEDKNEDDTGLTTGRGNS-------KWLISASDDHNLVIWRVK-------------- 130
             K E  ++D   L   + +        K+ IS S D+ +V+W++               
Sbjct: 311 AQKTE-ADDDQVELEYRKYDPDYSPLGFKYCISCSRDNLIVLWKIPLPKFIPHRPPQPNL 369

Query: 131 ---DWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
              ++E     KGH S + D  +    R   S S+D SIR W+L+T
Sbjct: 370 LQTNFEKVHVFKGHTSWVRDIKVR--GRHLFSCSDDRSIRCWDLVT 413

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 56/136 (41%), Gaps = 19/136 (13%)

Query: 38  QAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIED 97
           +A   +V    +  R  + G+ +  I++ D     +     +H   IT LKF        
Sbjct: 93  RADYTAVDTAKLQMRRFILGTTEGDIKVLDSNFNLQREIDQAHVSEITKLKF-------- 144

Query: 98  KNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIA 157
                    +G      LIS+S D  L IW VKD  N  TL GH + + D  I    R  
Sbjct: 145 -------FPSGEA----LISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNV 193

Query: 158 ISVSEDHSIRLWNLMT 173
           +S S D +IRLW   T
Sbjct: 194 LSASLDGTIRLWECGT 209

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 68/162 (41%), Gaps = 25/162 (15%)

Query: 37  FQAHSLSVKCLDISKR---YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93
           F+ H   V C+  + +      SG  D  ++++ L +     TL  H G    + +    
Sbjct: 136 FKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTL--HTGQEKGVNYVDYY 193

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153
            + DK               ++I++SDD  + I+  +      TL+GH S ++    HP+
Sbjct: 194 PLPDK--------------PYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPT 239

Query: 154 NRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWC 195
             I IS SED +++LWN  T K    L L      G    WC
Sbjct: 240 LPIIISGSEDGTVKLWNSSTYKLEKTLNL------GLERSWC 275

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/304 (20%), Positives = 124/304 (40%), Gaps = 43/304 (14%)

Query: 37  FQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
           F   S  VK +D+  S+ ++++      + I++ + ++E+ ++      + A KF     
Sbjct: 9   FSKRSNRVKGIDLHPSEPWVLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKF----- 63

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
           I  KN              W++  SDD+ + ++     E       H   I    +HPS 
Sbjct: 64  ITRKN--------------WIVVGSDDNKVRVFNYNTGEKVADFVAHPDYIRSIAVHPSK 109

Query: 155 RIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG----DSGEFFAVALLTKV 210
              ++ S+D +++LWN    +    L+ + +  +  FV        D   F +  L  KV
Sbjct: 110 PYILTGSDDLTVKLWNW---ENDWSLE-QTFKGHEHFVMCVAFNPKDPNVFASGCLDHKV 165

Query: 211 LIYKTSTAKVHRELDTGKS-SIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASE 269
            ++    +  +  L TG+   +  ++   +  K Y++ +  + TV +F      D +   
Sbjct: 166 KVWSLGQSTPNFTLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIF------DYQTKS 219

Query: 270 EPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCG-ERL 328
              T    L+GH + V    F+       +++   DG + +W+ S  +     + G ER 
Sbjct: 220 CVAT----LEGHMSNVSFAVFHPTL--PIIISGSEDGTVKLWNSSTYKLEKTLNLGLERS 273

Query: 329 NCLA 332
            C+A
Sbjct: 274 WCIA 277

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 84/192 (43%), Gaps = 36/192 (18%)

Query: 34  IFHFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKEL-GTLLSHQGSITALKFS 90
           +  F+AH   ++ L +  ++ Y++S S+D  +++++ +K   L  T   H+  + ++ F+
Sbjct: 90  VVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFN 149

Query: 91  K-------------GTKIEDKNEDDTGLTTG----RG----------NSKWLISASDDHN 123
                           KI    ++ +  T      +G          +  +LI++SDD  
Sbjct: 150 PKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRT 209

Query: 124 LVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLK 183
           + +W  +      TL+GH S ++    HP   I IS SED ++++WN  T K    L L 
Sbjct: 210 VKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNL- 268

Query: 184 KYNQNGQFVRWC 195
                G    WC
Sbjct: 269 -----GLERSWC 275

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%)

Query: 114 WLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           W+I  SDD  + ++     E     + H   I    +HP+    +S S+D +++LWN
Sbjct: 69  WIIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWN 125

 Score = 37.4 bits (85), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 46/231 (19%), Positives = 91/231 (39%), Gaps = 32/231 (13%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRG 110
           K +++ GS+D  IR+++    +++    +H   I AL             DD  +     
Sbjct: 67  KSWIIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNW 126

Query: 111 NSKWLI-------------------------SASDDHNLVIWRV-KDWENFGTLKGHASR 144
              W +                         +A  DH + IW + ++  NF TL+ H  +
Sbjct: 127 EKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNF-TLRAHLEK 185

Query: 145 -INDFDIHP--SNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEF 201
            +N  D +P       I+ S+D ++++W+  T  K+ V  L+ +  N  +  +       
Sbjct: 186 GVNFVDYYPFQDKPYLITSSDDRTVKVWDYQT--KSCVATLEGHLSNVSYAVYHPMLPII 243

Query: 202 FAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNG 252
            + +    V I+ ++T K+ R L+ G      +       +++I   F NG
Sbjct: 244 ISGSEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHPTGKRNFIAAGFDNG 294

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 65/158 (41%), Gaps = 25/158 (15%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
           FQ HS  V+ +D+   Y++SGS+D  +R+        L     H+  I  +KF     IE
Sbjct: 293 FQPHSQWVRSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHF--IE 350

Query: 97  DKNEDDTGLTTGRGNSKW----LISASDDHNLVIWRVK-----------------DWENF 135
           D  E      +      W     +SAS D  + IW +                  ++   
Sbjct: 351 DSPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCV 410

Query: 136 GTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
            TLKGH S + D  I    +   S ++D S+R W+L T
Sbjct: 411 LTLKGHLSWVRDISIR--GQYLFSCADDKSVRCWDLNT 446

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 61/146 (41%), Gaps = 21/146 (14%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
            +AH ++V+ L IS R  Y+ S S D+ ++ +DL+K   +     H   +  +       
Sbjct: 154 LKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVD 213

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
           +                   +++A  D  + +W ++      TL GH   I      P +
Sbjct: 214 V-------------------VVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLPVD 254

Query: 155 RIAISVSEDHSIRLWNLMTVKKAGVL 180
              IS S D SIRLW+L+  K   VL
Sbjct: 255 PQVISSSVDASIRLWDLVAGKSMKVL 280

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 65/153 (42%), Gaps = 26/153 (16%)

Query: 28  TPIFTPIFHF----QAHSLSVKCLDISK---RYLVSGSNDEHIRIYDLQKRKELGTLLSH 80
           TP +   +H       H   V+C+ + K    +  +GSND+ I+I++L   K   TL +H
Sbjct: 98  TPRWHAPWHLTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAH 157

Query: 81  QGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKG 140
             ++  L  S                       ++ S S+D  +  W ++         G
Sbjct: 158 DMTVRDLAIS-------------------NRHPYMFSVSEDKTVKCWDLEKNTAIRNYHG 198

Query: 141 HASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
           H S ++  DIHP+  + ++   D  +++W++ T
Sbjct: 199 HLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRT 231

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 63/142 (44%), Gaps = 22/142 (15%)

Query: 32  TPIFHFQAHSLSVKCLDISKRY--LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           T I ++  H   V  +DI      +V+   D  ++++D++ R  + TL  H+G IT ++ 
Sbjct: 191 TAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRC 250

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
                ++ +                +IS+S D ++ +W +   ++   L  H   + D  
Sbjct: 251 ---LPVDPQ----------------VISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDIS 291

Query: 150 IHPSNRIAISVSEDHSIRLWNL 171
           +HPS   + + +  + IR W L
Sbjct: 292 VHPS-EFSFASACTNDIRSWLL 312

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 19/108 (17%)

Query: 63  IRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDH 122
           I +++L  +K++ TL  H+GSI  +                   T   N K L S SDD 
Sbjct: 163 IIVWELDSKKKIHTLRGHEGSIFYV-------------------TTSNNGKLLASCSDDR 203

Query: 123 NLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           +++IW +   +      GH +RI +      +   ISVSED + R+WN
Sbjct: 204 SIIIWDMVSGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWN 251

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 43/89 (48%), Gaps = 9/89 (10%)

Query: 113 KWLISASDDHN-LVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           K L++A    N +++W +   +   TL+GH   I       + ++  S S+D SI +W++
Sbjct: 151 KVLVNAGTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDM 210

Query: 172 MTVK--------KAGVLKLKKYNQNGQFV 192
           ++ K         A +  LK +N + Q +
Sbjct: 211 VSGKLLSRAWGHTARIWNLKFFNDDTQLI 239

>Kwal_56.24163
          Length = 729

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           +  +LI++SDD  + IW  +      TL+GH + ++    HPS  I +S SED ++++WN
Sbjct: 54  DKPYLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWN 113

Query: 171 LMTVKKAGVLKLKKYNQNGQFVRWC 195
             T K    L L      G    WC
Sbjct: 114 SNTYKLEKTLNL------GLERSWC 132

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 51/129 (39%), Gaps = 24/129 (18%)

Query: 32  TPIFHFQAH-SLSVKCLDI----SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITA 86
           T  F  QAH +  V  +D      K YL++ S+D  ++I+D Q +  + TL  H  +++ 
Sbjct: 31  TANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCVATLEGHMANVSY 90

Query: 87  LKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIN 146
             F     I                   ++S S+D  L +W    ++   TL     R  
Sbjct: 91  AVFHPSLPI-------------------ILSGSEDGTLKVWNSNTYKLEKTLNLGLERSW 131

Query: 147 DFDIHPSNR 155
               HP+ +
Sbjct: 132 CIATHPTGK 140

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 273 TPEFNLQGHTNR-VKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAV 321
           T  F LQ H  R V    +Y  +   YL+T   D  + +WD   K  VA 
Sbjct: 31  TANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCVAT 80

>Scas_713.50
          Length = 983

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 66/142 (46%), Gaps = 14/142 (9%)

Query: 32  TPIFHFQAHSLSVKCL--DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           T + +   HS ++  L  D S   L+SGS D +I ++DL     L  L SH+ +IT +  
Sbjct: 139 TVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWC 198

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
           ++ T   + N+++  L        WLIS S D  + IW +K  +   T   H      + 
Sbjct: 199 NEVT---NNNQEENEL-------DWLISTSKDGLIKIWDLKIQQCVETHIAHTGEC--WS 246

Query: 150 IHPSNRIAISVSEDHSIRLWNL 171
           +   N + I+ S D  ++ W L
Sbjct: 247 LAVRNDLVITTSSDSQVKFWQL 268

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 54/133 (40%), Gaps = 21/133 (15%)

Query: 39  AHSLSVKCLDIS--KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
            H L V  +DIS   + +++ S D++I+I+ L       +L +HQ SI  +KF      E
Sbjct: 609 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVP----E 664

Query: 97  DKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRI 156
             N                 S S D  +  W    +E    L  H S +    I      
Sbjct: 665 SHN---------------FFSCSKDGIIKYWDGDKFECIQKLAAHQSEVWALAIANDASF 709

Query: 157 AISVSEDHSIRLW 169
            +S S DHSIR+W
Sbjct: 710 VVSSSHDHSIRIW 722

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 66/136 (48%), Gaps = 5/136 (3%)

Query: 38  QAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKI 95
           +AH  ++  LD++   + L++GS D+ ++ ++ Q  +EL    S +  +  L     T +
Sbjct: 508 EAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDK-FVPKLGLHHDTTL 566

Query: 96  EDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNR 155
           E    DD          K+L  +  D+ + ++ +   + F +L GH   +   DI   ++
Sbjct: 567 E--LSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSK 624

Query: 156 IAISVSEDHSIRLWNL 171
           + I+ S D +I++W L
Sbjct: 625 MIITSSADKNIKIWGL 640

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 29/67 (43%), Gaps = 9/67 (13%)

Query: 270 EPVTPEFN------LQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYD 323
           EP  P  N      LQG    ++      +   + L+   S+G + +W++  K  +  ++
Sbjct: 411 EPTQPIANKLYNVELQGQRTDIRSIDISDD---NKLLATASNGSLKIWNLKTKLCIRTFE 467

Query: 324 CGERLNC 330
           CG  L C
Sbjct: 468 CGYALTC 474

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 59/142 (41%), Gaps = 18/142 (12%)

Query: 61  EHIRIYDLQKRKELGTLLSH-----QGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWL 115
           E++ I+DL K  EL + L+       GS+ A K SK          +T        +  L
Sbjct: 72  ENVNIWDL-KTGELASFLNDGLVPPPGSVDA-KSSKPA--------ETTFLQHHKETNLL 121

Query: 116 ISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175
               +D  + +W +        L GH+S I       S    IS S D +I +W+L  V 
Sbjct: 122 AVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDL--VS 179

Query: 176 KAGVLKLKKYNQNGQFVRWCGD 197
           + G+ KL+ +      + WC +
Sbjct: 180 EVGLYKLRSHKDAITGI-WCNE 200

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           +SK +I++S D N+ IW +   +   +L  H   I +    P +    S S+D  I+ W+
Sbjct: 622 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWD 681

 Score = 28.9 bits (63), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 277 NLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVY 322
           NL GH++ +   KF  +  G  L++   D  I+VWD+ +  +V +Y
Sbjct: 143 NLNGHSSAITALKF--DTSGTRLISGSRDSNIIVWDLVS--EVGLY 184

>Kwal_26.8776
          Length = 433

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 60/140 (42%), Gaps = 22/140 (15%)

Query: 37  FQAHSLSVKCL---DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93
              H+  V+C+    +   +  +GSND  I+++D+   K   TL  H  ++ ++  S+  
Sbjct: 117 INGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRH 176

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153
            +                   + SAS+D  +  W ++         GH S +N  D+HP+
Sbjct: 177 PL-------------------MFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPT 217

Query: 154 NRIAISVSEDHSIRLWNLMT 173
             +  S   D  +RLW++ T
Sbjct: 218 LDLIASAGRDAVVRLWDIRT 237

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/139 (18%), Positives = 53/139 (38%), Gaps = 24/139 (17%)

Query: 34  IFHFQAHSLSVKCLDISKRY--LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALK-FS 90
           I  +  H   V  +D+      + S   D  +R++D++ R  + TL  H+  I  +K F 
Sbjct: 199 IRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFP 258

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
              +I                    +S S D  + +W ++  +    L  H+  +     
Sbjct: 259 VDPQI--------------------MSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAA 298

Query: 151 HPSNRIAISVSEDHSIRLW 169
           HP+   +++ +    +R W
Sbjct: 299 HPAES-SVATASTSDVRSW 316

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 87/213 (40%), Gaps = 21/213 (9%)

Query: 123 NLVIWRVKDWEN---FGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK--- 176
           N+ +W   D +    + TLKGH + +      P   I +S SEDH ++LW     +    
Sbjct: 36  NIALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPESEEL 95

Query: 177 AGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTS---TAKVHRELDTGKSSI-M 232
             +  +  Y+     +          +   L  + + +T    T  +  E    ++   +
Sbjct: 96  ECIQTITHYSHTIVSIETLAGLIVIGSAGGLVSIWVPETEGSDTYIISHEYSLPRNVFPL 155

Query: 233 RMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFN----LQGHTNRVKDF 288
              + N+ G  Y+ LA G  TV +F    +Y    SE  V   FN    L+GH + VK  
Sbjct: 156 CFSLSNVVGNKYL-LAIGGTTVKIF----IYSFVLSEGKVIENFNLAAELEGHEDWVKSI 210

Query: 289 KFYKNEF-GHYLVTIGS-DGKIVVWDMSNKEQV 319
           +F   E  G YL+  GS D  I +W +   + +
Sbjct: 211 QFRHQETPGDYLLCSGSQDRYIRIWRIRTNDLI 243

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 66/150 (44%), Gaps = 34/150 (22%)

Query: 39  AHSLSVKCLDIS--KRYLVSG---SNDEH--IRIYDLQKRKELGTLLS-HQGSITALKFS 90
            H   +  +D+S  ++ +VS    +N +H  IRI+DL    E+   LS H  +IT L+FS
Sbjct: 561 GHGYEITSVDVSPDQKLVVSACRSNNAQHAVIRIFDLDTWLEVKPNLSFHSLTITRLRFS 620

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTL-----KGHASRI 145
                               +SK+L+S   D    +W     +N  TL     K H+  I
Sbjct: 621 P-------------------DSKYLLSVCRDRKWAVWERNFDDNTFTLKYTDEKPHSRII 661

Query: 146 NDFDIHP--SNRIAISVSEDHSIRLWNLMT 173
            D +  P     + ++ S D  +++W+L T
Sbjct: 662 WDGEWAPLEFGNVFLTTSRDRKVKVWSLET 691

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 19/64 (29%)

Query: 67  DLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVI 126
           D   R    TL  H+  +T +KF  GT I                   L+SAS+DH++ +
Sbjct: 44  DADCRGIYATLKGHEAEVTCVKFMPGTDI-------------------LVSASEDHHVKL 84

Query: 127 WRVK 130
           W+ K
Sbjct: 85  WKYK 88

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 93/229 (40%), Gaps = 30/229 (13%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
              H ++VK + ISKR  Y+ S S D+ ++ +DL+K + +     H   +  +       
Sbjct: 168 LSGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLN 227

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
           +                   + +A  D  + +W ++      T+ GH S IN     P +
Sbjct: 228 L-------------------IATAGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLPVD 268

Query: 155 RIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG-DSGEF-FAVALLTKVLI 212
              +S S D ++RLW++   K   VL   K +     VR  G   GEF  + A    +  
Sbjct: 269 PQVVSCSADATVRLWDITAGKTLKVLTHHKRS-----VRDIGIHPGEFSISSACTDDIRS 323

Query: 213 YKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKS 261
           +K    ++     + K+ I  +   +I+  D +     NG +S +  K+
Sbjct: 324 WKLPEGQLLTNFQSEKTGI--INTLSINQDDVLFAGSDNGVLSFYDYKT 370

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 53/125 (42%), Gaps = 19/125 (15%)

Query: 49  ISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTG 108
           I   +  +GSND  I+I+DL   K   TL  H  ++  +  SK                 
Sbjct: 140 IDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISK----------------- 182

Query: 109 RGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRL 168
                ++ SAS+D  +  W ++         GH S ++  DIHP+  +  +   D  +RL
Sbjct: 183 --RHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRL 240

Query: 169 WNLMT 173
           W++ T
Sbjct: 241 WDIRT 245

>Kwal_27.11126
          Length = 996

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 58/121 (47%), Gaps = 19/121 (15%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRG 110
           K ++ +G+  + + ++DL+  + L     H+G+I  +  SK                   
Sbjct: 151 KVHINAGTVMDGVIVWDLESEQNLHHFTDHEGAIFFVTASK------------------- 191

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           N K+  S SDD ++ +W +K  +   T  GH +RI +     ++   ISVSED + R+W+
Sbjct: 192 NGKYAASCSDDRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWD 251

Query: 171 L 171
           +
Sbjct: 252 I 252

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 65/154 (42%), Gaps = 41/154 (26%)

Query: 69  QKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWR 128
           Q RK L  +  H GS+TALKFS                    ++K+L S SDD  L+IW 
Sbjct: 65  QLRKPLANMSRHTGSVTALKFSP-------------------DNKYLASGSDDKILLIWE 105

Query: 129 ---------------VKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
                          ++ W     L  H + I D    P + I ++V  D SI +WN  T
Sbjct: 106 KEEGAVQPLFDMENDLEHWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSIIVWNGST 165

Query: 174 VKKAGVLKLKKYNQNGQFVRWC--GDSGEFFAVA 205
            +     K+K+++ +   V+      + ++FA A
Sbjct: 166 FE-----KIKRFDVHQSHVKGVVFDPANKYFATA 194

 Score = 36.2 bits (82), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/139 (19%), Positives = 61/139 (43%), Gaps = 6/139 (4%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           P+ +   H+ SV  L  S   +YL SGS+D+ + I++ ++   +  L   +  +      
Sbjct: 69  PLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWE-KEEGAVQPLFDMENDLEHWNVR 127

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
           +     D +  D        +S  L++   D ++++W    +E       H S +     
Sbjct: 128 RRLVAHDNDIQDICWAP---DSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGVVF 184

Query: 151 HPSNRIAISVSEDHSIRLW 169
            P+N+   + S+D +++++
Sbjct: 185 DPANKYFATASDDRTVKVF 203

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 260 KSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQV 319
           + L+D E   E       L  H N ++D  +  +     LVT+G D  I+VW+ S  E++
Sbjct: 112 QPLFDMENDLEHWNVRRRLVAHDNDIQDICWAPD--SSILVTVGLDRSIIVWNGSTFEKI 169

Query: 320 AVYD 323
             +D
Sbjct: 170 KRFD 173

>Scas_702.16
          Length = 816

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 83/208 (39%), Gaps = 64/208 (30%)

Query: 38  QAHSLSVKCLDISK--RYLVSGSNDEHIRIY--------------------DLQKRKELG 75
           ++ S  +  +D+S   + + +G  D  IRI+                    D + +K L 
Sbjct: 14  ESRSYEIYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPIDKELKKPLA 73

Query: 76  TLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKD---- 131
           ++  H GS+T LKFS                    N K+L S SDD  L+IW + +    
Sbjct: 74  SMSRHTGSVTCLKFSP-------------------NGKYLASGSDDRILLIWTLDEERPI 114

Query: 132 ------------WENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGV 179
                       W     L  H + I D    P + + +SV  D ++ +WN +T +    
Sbjct: 115 QPIFGGESEKERWAVRKRLVAHDNDIQDICWAPDSSLLVSVGLDRAVIIWNGITFE---- 170

Query: 180 LKLKKYNQNGQFVRWC--GDSGEFFAVA 205
            KLK+++ +   V+      + ++FA A
Sbjct: 171 -KLKRFDVHQSHVKGVIFDPANKYFATA 197

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 58/139 (41%), Gaps = 5/139 (3%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           P+     H+ SV CL  S   +YL SGS+D  + I+ L + + +  +   +         
Sbjct: 71  PLASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERWAVR 130

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
           K     D +  D        +S  L+S   D  ++IW    +E       H S +     
Sbjct: 131 KRLVAHDNDIQDICWAP---DSSLLVSVGLDRAVIIWNGITFEKLKRFDVHQSHVKGVIF 187

Query: 151 HPSNRIAISVSEDHSIRLW 169
            P+N+   + S+D +++++
Sbjct: 188 DPANKYFATASDDRTMKIF 206

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 66/158 (41%), Gaps = 34/158 (21%)

Query: 46  CLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALK-FSKGTKIEDKNEDDT- 103
           C     ++L +G+ D+ IRI+DL+ +K + TL  H+  I +L  F  G K+   + D T 
Sbjct: 413 CFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTV 472

Query: 104 ---GLTTGR------------------GNSKWLISASDDHNLVIW---------RVKDWE 133
               LTTG                   G  K++ + S D  + +W         R+    
Sbjct: 473 RIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSEN 532

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
             GT  GH   +         +  +S S D S++LWNL
Sbjct: 533 ELGT--GHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNL 568

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 91/210 (43%), Gaps = 18/210 (8%)

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           + K+L + ++D  + IW ++  +   TLKGH   I   D  PS    +S S D ++R+W+
Sbjct: 417 DGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWD 476

Query: 171 LMTVKKAGVLKLKKYNQNG-QFVRWCGDSGEFFAVALLTK-VLIYKTSTAKV------HR 222
           L T    G   L    ++G   V      G+F A   L + V ++ + T  +        
Sbjct: 477 LTT----GTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSEN 532

Query: 223 ELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHT 282
           EL TG    +   +   DGK  +  +  + +V ++    L  +++  E    E    GH 
Sbjct: 533 ELGTGHRDSVYSVVFTRDGKGVVSGSL-DRSVKLWNLNGLSGQKSHAE---CEVTYTGHK 588

Query: 283 NRVKDFKFYKNEFGHYLVTIGSDGKIVVWD 312
           + V      +N+   Y+++   D  ++ WD
Sbjct: 589 DFVLSVATTQND--EYILSGSKDRGVLFWD 616

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 63/145 (43%), Gaps = 23/145 (15%)

Query: 63  IRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDH 122
           I +Y + ++   G L+ H G I+ L+F+   K+                   L+SASDD 
Sbjct: 341 IFVYQITEKTPTGKLIGHHGPISVLEFNDTNKL-------------------LLSASDDG 381

Query: 123 NLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKL 182
            L IW   +  +     GH+  I        +++ IS S D S+RLW+L   K+  +L L
Sbjct: 382 TLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKV-ISCSMDGSVRLWSL---KQNTLLAL 437

Query: 183 KKYNQNGQFVRWCGDSGEFFAVALL 207
              +    F       G+ +AVA +
Sbjct: 438 SIVDGVPIFAGRISQDGQKYAVAFM 462

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/155 (18%), Positives = 64/155 (41%), Gaps = 37/155 (23%)

Query: 124 LVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW-------------- 169
           + ++++ +    G L GH   I+  + + +N++ +S S+D ++R+W              
Sbjct: 341 IFVYQITEKTPTGKLIGHHGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGH 400

Query: 170 --NLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTG 227
             ++++    G  K+   + +G    W        A++++  V I+    ++        
Sbjct: 401 SQSIVSASWVGDDKVISCSMDGSVRLWSLKQNTLLALSIVDGVPIFAGRISQ-------- 452

Query: 228 KSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSL 262
                       DG+ Y V AF +G V+++  K L
Sbjct: 453 ------------DGQKYAV-AFMDGQVNVYDLKKL 474

>Kwal_26.7570
          Length = 218

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 6/90 (6%)

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVK-DWENFG----TLKGHASRI 145
           +GT +E  N   T L T       L+S S D +L+ W++  D + +G    + +GH+  +
Sbjct: 10  RGT-LEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIV 68

Query: 146 NDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175
            D  + P    A+S S D ++RLW L T K
Sbjct: 69  QDCTVTPDGEYALSASWDKTVRLWELATGK 98

>Scas_721.115*
          Length = 318

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 61/137 (44%), Gaps = 17/137 (12%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
           F  H   V  + I ++   ++SGS D+ I+++ + K + L TLL H   ++ ++ +    
Sbjct: 103 FVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRIAP--- 158

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
             D+N+D   +          ISA +D  +  W +  ++      GH   +N     P  
Sbjct: 159 -TDQNDDSVTV----------ISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDG 207

Query: 155 RIAISVSEDHSIRLWNL 171
            +  S  +D  I LWNL
Sbjct: 208 TLIASAGKDGEIMLWNL 224

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 103/259 (39%), Gaps = 40/259 (15%)

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVK-DWENFG----TLKGHASRI 145
           +GT +E  N   T L T  G    L+S S D  L+ W++  D + FG    + KGH+  +
Sbjct: 10  RGT-LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 146 NDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVA 205
            D  +      A+S S D ++RLW++ T +               + R+ G   +  +VA
Sbjct: 69  QDCTLTQDGAYALSASWDKTLRLWDVATGET--------------YQRFVGHKSDVMSVA 114

Query: 206 LLTKVLIYKTSTAKVHRELDTGKSSIM-----------RMEIENIDGKDYIVLAFGNGTV 254
           +  K  +  + +     ++ T K   +           ++ I   D  D  V     G  
Sbjct: 115 IDRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGND 174

Query: 255 SMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMS 314
            M  A +L   +        E +  GH   V       +  G  + + G DG+I++W+++
Sbjct: 175 KMVKAWNLNQFQI-------EADFVGHNGNVNTVTASPD--GTLIASAGKDGEIMLWNLA 225

Query: 315 NKEQVAVYDCGERLNCLAL 333
            K+ +      + +  LA 
Sbjct: 226 EKKAMYTLSAQDEVFALAF 244

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 59/129 (45%), Gaps = 19/129 (14%)

Query: 44  VKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDT 103
           +K     K Y+ +G+    + I+DL    ++  LL H+GSI  +  S             
Sbjct: 142 IKVFGPDKVYVNAGTVMGGVIIWDLFSETKIHNLLGHEGSIFYVNLSN------------ 189

Query: 104 GLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSED 163
                  N +++ S SDD ++ +W ++  +       H +RI +     ++   ISVSED
Sbjct: 190 -------NGRYVASCSDDRSIRLWDLETGKQLSVGWSHTARIWNLMFFDNDSKLISVSED 242

Query: 164 HSIRLWNLM 172
            + R+WN++
Sbjct: 243 CTCRVWNII 251

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 124 LVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGV 179
           ++IW +        L GH   I   ++  + R   S S+D SIRLW+L T K+  V
Sbjct: 161 VIIWDLFSETKIHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQLSV 216

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 18/129 (13%)

Query: 197 DSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGN--GTV 254
           D+ + + +    KVLI   +   + R+   G+ SI+   I  + G D + +  G   G V
Sbjct: 102 DNLQIYLLTCYNKVLICDLNCEVLFRKSLGGERSILYSGIIKVFGPDKVYVNAGTVMGGV 161

Query: 255 SMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKN--EFGHYLVTIGSDGKIVVWD 312
            ++    L+ E       T   NL GH   +    FY N    G Y+ +   D  I +WD
Sbjct: 162 IIW---DLFSE-------TKIHNLLGHEGSI----FYVNLSNNGRYVASCSDDRSIRLWD 207

Query: 313 MSNKEQVAV 321
           +   +Q++V
Sbjct: 208 LETGKQLSV 216

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 64/140 (45%), Gaps = 22/140 (15%)

Query: 34  IFHFQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
           I   Q HS  +  +D S+    L SGS D  I+++D++K+  + T+L+H   ++ +KF+K
Sbjct: 340 IMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNK 399

Query: 92  GTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIH 151
                              N  +L+S+  D  + I+   +W    +L+GH  ++   DI 
Sbjct: 400 ------------------QNGGYLVSSGYDKKVNIFNDGNWIKERSLEGHLDKVMSIDIV 441

Query: 152 PSNRIAISVSEDHSIRLWNL 171
             +    S   D S+  W +
Sbjct: 442 GPD--IYSAGWDRSVNKWGV 459

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 55/125 (44%), Gaps = 3/125 (2%)

Query: 117 SASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK 176
           +A  D   +IW ++  +N  +L+GH+  I   D   +     S S D +I++W++   KK
Sbjct: 322 TAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIR--KK 379

Query: 177 AGVLKLKKYNQNGQFVRWCGDSGEFF-AVALLTKVLIYKTSTAKVHRELDTGKSSIMRME 235
             V  +  +N     V++   +G +  +     KV I+        R L+     +M ++
Sbjct: 380 GNVETILAHNSIVSQVKFNKQNGGYLVSSGYDKKVNIFNDGNWIKERSLEGHLDKVMSID 439

Query: 236 IENID 240
           I   D
Sbjct: 440 IVGPD 444

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 276 FNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQV 319
            +LQGH+  +    + +N  G+ L +   DG I VWD+  K  V
Sbjct: 341 MSLQGHSKPIYSVDWSQN--GYQLASGSGDGTIKVWDIRKKGNV 382

>Scas_720.45
          Length = 755

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 114 WLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
           +LI++SDD    +W  +      TL+GH + ++    HP+  I IS SED ++++WN  T
Sbjct: 57  YLITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

Query: 174 VKKAGVLKLKKYNQNGQFVRWC 195
            K    L L      G    WC
Sbjct: 117 YKVEKTLSL------GLERSWC 132

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 41/105 (39%), Gaps = 19/105 (18%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRG 110
           K YL++ S+D   +++D Q +  + TL  H  +++   F     I               
Sbjct: 55  KPYLITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTLPI--------------- 99

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNR 155
               +IS S+D  L IW    ++   TL     R      HP+ +
Sbjct: 100 ----IISGSEDGTLKIWNSATYKVEKTLSLGLERSWCIATHPTGK 140

>Scas_592.4*
          Length = 318

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 61/137 (44%), Gaps = 17/137 (12%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
           F  H   V  + I ++   ++SGS D+ I+++ + K + L TLL H   ++ ++ +    
Sbjct: 103 FVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRIAP--- 158

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
             D+N+D   +          ISA +D  +  W +  ++      GH   +N     P  
Sbjct: 159 -TDQNDDAVTV----------ISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDG 207

Query: 155 RIAISVSEDHSIRLWNL 171
            +  S  +D  I LWNL
Sbjct: 208 TLIASAGKDGEIMLWNL 224

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 103/259 (39%), Gaps = 40/259 (15%)

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVK-DWENFG----TLKGHASRI 145
           +GT +E  N   T L T  G    L+S S D  L+ W++  D + FG    + KGH+  +
Sbjct: 10  RGT-LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 146 NDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVA 205
            D  +      A+S S D ++RLW++ T +               + R+ G   +  +VA
Sbjct: 69  QDCTLTQDGAYALSASWDKTLRLWDVATGET--------------YQRFVGHKSDVMSVA 114

Query: 206 LLTKVLIYKTSTAKVHRELDTGKSSIM-----------RMEIENIDGKDYIVLAFGNGTV 254
           +  K  +  + +     ++ T K   +           ++ I   D  D  V     G  
Sbjct: 115 IDRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGND 174

Query: 255 SMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMS 314
            M  A +L   +        E +  GH   V       +  G  + + G DG+I++W+++
Sbjct: 175 KMVKAWNLNQFQI-------EADFVGHNGNVNAVTASPD--GTLIASAGKDGEIMLWNLA 225

Query: 315 NKEQVAVYDCGERLNCLAL 333
            K+ +      + +  LA 
Sbjct: 226 EKKAMYTLSAQDEVFSLAF 244

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 65/158 (41%), Gaps = 34/158 (21%)

Query: 46  CLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALK-FSKGTKIEDKNEDDT- 103
           C     +YL +G+ D+ IRI+DL  +K L TL  H+  I +L  F  G K+   + D T 
Sbjct: 359 CFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTV 418

Query: 104 ------------------GLTT---GRGNSKWLISASDDHNLVIW---------RVKDWE 133
                             G+TT     G+ K++ + S D  + +W         R+    
Sbjct: 419 RIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSEN 478

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
              T  GH   +         +  IS S D S++LW+L
Sbjct: 479 ELST--GHKDSVYSVVFTRDGQGVISGSLDRSVKLWDL 514

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%)

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           + K+L + ++D  + IW +   +   TL+GH   I   D  P+    +S S D ++R+W+
Sbjct: 363 DGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWD 422

Query: 171 LMT 173
           L T
Sbjct: 423 LRT 425

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 59/142 (41%), Gaps = 24/142 (16%)

Query: 32  TPIFHFQAH--SLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           T +  F  H  +++V   D +   L+S S D  I ++DL     L  L SH+ +IT    
Sbjct: 112 TVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAIT---- 167

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
             G   ED+N              WLIS S D  + IW +K  +   T   H        
Sbjct: 168 --GLWCEDEN--------------WLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLG 211

Query: 150 IHPSNRIAISVSEDHSIRLWNL 171
           I     +A++ S D  ++LW L
Sbjct: 212 I--IEDMAVTCSADSQVKLWKL 231

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 54/133 (40%), Gaps = 21/133 (15%)

Query: 39  AHSLSVKCLDIS--KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
            H L V  +DIS   + +V+ S D++I+I+ L       +L +HQ SI  +KF      E
Sbjct: 568 GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP----E 623

Query: 97  DKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRI 156
             N                 S S D  +  W  + +E    L  H S +    +      
Sbjct: 624 SYN---------------FFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTF 668

Query: 157 AISVSEDHSIRLW 169
            IS   DHSIR+W
Sbjct: 669 VISTGHDHSIRVW 681

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 65/135 (48%), Gaps = 5/135 (3%)

Query: 39  AHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
           AH  ++  LD++   R LV+GS D+ +R +  +   E+        ++  L+    T +E
Sbjct: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFE-VSEVPVSDESNKTMPMLQLFHDTTLE 526

Query: 97  DKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRI 156
              +DD        + K++  +  D+ + ++ +   + F +L GH   +   DI   +++
Sbjct: 527 --LDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKL 584

Query: 157 AISVSEDHSIRLWNL 171
            ++ S D +I++W L
Sbjct: 585 IVTCSADKNIKIWGL 599

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 30/60 (50%)

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           +SK +++ S D N+ IW +   +   +L  H   I +    P +    S S+D +++ W+
Sbjct: 581 DSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWD 640

>Kwal_0.212
          Length = 303

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 66/129 (51%), Gaps = 25/129 (19%)

Query: 47  LDIS--KRYLVSGSNDEHIRIYDLQ--KRKELGTLLSHQGSITALKFSKGTKIEDKNEDD 102
           L+IS  KR+L +  +  ++R+YD++      + +   H+G++T++ F +           
Sbjct: 38  LEISSDKRFLAAAGH-LNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQ----------- 85

Query: 103 TGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSE 162
                    +KW++S+S+D  + +W V+        K H + +N+  IHP+    IS  +
Sbjct: 86  --------ENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQ 136

Query: 163 DHSIRLWNL 171
           D ++R+W+L
Sbjct: 137 DGNVRIWDL 145

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 5/64 (7%)

Query: 113 KWLISASDDHNLVIWRVKDWENF---GTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
           K L + S DH   +W + D  NF    TL  H   + D      +   ++   DH +RLW
Sbjct: 220 KHLATCSADHTARVWSIDD--NFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277

Query: 170 NLMT 173
           +L T
Sbjct: 278 DLST 281

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 3/62 (4%)

Query: 275 EFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGER-LNCLAL 333
           E  L  H   V D  F  +    YLVT  SD  + +WD+S +E V  Y    +   C+AL
Sbjct: 243 ETTLDNHQRWVWDCAFSADSA--YLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 334 CD 335
            D
Sbjct: 301 ND 302

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 107/265 (40%), Gaps = 37/265 (13%)

Query: 39  AHSLSVKCL---DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS----- 90
            H+  V+C+    +   +  +GSND  IR++DL   K   TL  H  ++  +  S     
Sbjct: 111 GHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPY 170

Query: 91  ----------------KGTKIEDKNEDDTGLTTG--RGNSKWLISASDDHNLVIWRVKDW 132
                           + T + D +   +G+ +     +   ++SA  D  + +W ++  
Sbjct: 171 MFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSR 230

Query: 133 ENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYN-QNGQF 191
               TL GH   IN     P +   +S S D +++LW+L+  K    L   K N ++  F
Sbjct: 231 SCVLTLAGHRGPINKVRCLPVDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAF 290

Query: 192 VRWCGDSGEF-FAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFG 250
                +  EF FA A    +  +K    ++    ++    I+     N DG   ++ A G
Sbjct: 291 -----NPTEFSFASACTDDIRSWKLVDGQLLTNFNSEALGIVNTLACNQDG---VLFAGG 342

Query: 251 N-GTVSMFPAKSLYDEEASEEPVTP 274
           + G +S F  K+ +  +  E    P
Sbjct: 343 DTGELSFFDYKTGHKFQKLETTAMP 367

>Scas_721.32
          Length = 822

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 57/142 (40%), Gaps = 22/142 (15%)

Query: 33  PIFHFQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           P+  F  H   V C+       Y+ +GS+D+  R++D+     +   L H   +     S
Sbjct: 625 PLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVS 684

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHA-SRINDFD 149
                               + +WL + S+D  + +W +   +    ++GH  + I+   
Sbjct: 685 P-------------------DGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLS 725

Query: 150 IHPSNRIAISVSEDHSIRLWNL 171
                 + +S   DHS+R+W+L
Sbjct: 726 YCKEGNVLVSGGADHSVRVWDL 747

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 64/168 (38%), Gaps = 25/168 (14%)

Query: 39  AHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK----- 91
            HS +V     S   RYL+SGS D+ +R++       L +   H   +  ++FS      
Sbjct: 547 GHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYF 606

Query: 92  GTKIEDKNE------------------DDTGLTTGRGNSKWLISASDDHNLVIWRVKDWE 133
            T   D+                     D    +   N  ++ + S D    +W +   +
Sbjct: 607 ATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGD 666

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLK 181
           +     GH + +    + P  R   + SED  I LW++ T K+  V++
Sbjct: 667 SVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMR 714

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 39/94 (41%), Gaps = 19/94 (20%)

Query: 76  TLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENF 135
           TL+ H G++ +  FS                    ++++L+S S+D  + +W    + + 
Sbjct: 544 TLIGHSGAVYSTSFSP-------------------DNRYLLSGSEDKTVRLWSTDTYTSL 584

Query: 136 GTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
            + KGH   + D    P      + S D + RLW
Sbjct: 585 VSYKGHNHPVWDVQFSPLGHYFATASHDQTARLW 618

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 22/97 (22%)

Query: 37  FQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSH-QGSITALKFSKGT 93
           F  H+  V C  +S   R+L +GS D  I ++D+   K L  +  H + +I +L + K  
Sbjct: 671 FLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEG 730

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVK 130
            +                   L+S   DH++ +W +K
Sbjct: 731 NV-------------------LVSGGADHSVRVWDLK 748

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG 196
           TL GH+  +      P NR  +S SED ++RLW+  T     ++  K +N     V++  
Sbjct: 544 TLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTY--TSLVSYKGHNHPVWDVQFS- 600

Query: 197 DSGEFFAVA 205
             G +FA A
Sbjct: 601 PLGHYFATA 609

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 71/162 (43%), Gaps = 22/162 (13%)

Query: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93
           +FH  + ++++   D +   L+SGS D  I ++DL     L  L SH+ +IT        
Sbjct: 112 VFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITG------- 164

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153
            I  +N+D            WLIS S D  + +W +K  +   T   H      + +   
Sbjct: 165 -IWCENDD------------WLISVSKDGLIKLWDMKVHQCVETHMAHTGEC--WSLAVK 209

Query: 154 NRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWC 195
           + + I+ + +  I+LW L   +  G + L+K +   Q  + C
Sbjct: 210 DNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRC 251

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 55/133 (41%), Gaps = 21/133 (15%)

Query: 39  AHSLSVKCLDIS--KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
            H L V  +DIS   + +++ S D++I+I+ L       +L +HQ SI  +KF      E
Sbjct: 565 GHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP----E 620

Query: 97  DKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRI 156
             N                 S S D  +  W    ++    L GH   +    +    + 
Sbjct: 621 SHN---------------FFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQA 665

Query: 157 AISVSEDHSIRLW 169
            +SVS D SIR+W
Sbjct: 666 VVSVSHDRSIRVW 678

 Score = 37.0 bits (84), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 70/138 (50%), Gaps = 9/138 (6%)

Query: 38  QAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKEL--GTLLSHQGSITALKFSKGT 93
           +AH+ ++  LD++   + LV+ S D+ ++ +D +  +EL  GTL      +  +K    T
Sbjct: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTL---DKFVPKMKLIHDT 520

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153
            + D  ED   +     + ++L  +  D+ + ++ +   + F +L GH   +   DI   
Sbjct: 521 TL-DLGEDLWCVKISPED-RFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHD 578

Query: 154 NRIAISVSEDHSIRLWNL 171
           +++ I+ S D +I++W L
Sbjct: 579 SKLIITSSADKNIKIWGL 596

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 53/127 (41%), Gaps = 21/127 (16%)

Query: 46  CLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDT 103
           C+ IS   R+L     D  ++++ L   K   +L  H+  + ++  S             
Sbjct: 530 CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISH------------ 577

Query: 104 GLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSED 163
                  +SK +I++S D N+ IW +   +   +L  H   I +    P +    S S+D
Sbjct: 578 -------DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKD 630

Query: 164 HSIRLWN 170
            +++ W+
Sbjct: 631 GTVKYWD 637

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 6/106 (5%)

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVL 180
           D  + IW ++          H+S I       +    IS S D +I LW+L  V + G+ 
Sbjct: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDL--VAETGLC 153

Query: 181 KLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDT 226
           KL+ +      + WC +     +V   +K  + K    KVH+ ++T
Sbjct: 154 KLRSHKDAITGI-WCENDDWLISV---SKDGLIKLWDMKVHQCVET 195

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 55/133 (41%), Gaps = 21/133 (15%)

Query: 39  AHSLSVKCLDIS--KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
            H L V  +D S   + L++ S D++I+I+ +       ++ +HQ SI +++F   T   
Sbjct: 562 GHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTHN- 620

Query: 97  DKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRI 156
                               S   D  +  W    ++    L GH S +    + P  R 
Sbjct: 621 ------------------FFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCIAVSPDGRT 662

Query: 157 AISVSEDHSIRLW 169
            +S S DHSIR+W
Sbjct: 663 VVSTSHDHSIRVW 675

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 80/357 (22%), Positives = 129/357 (36%), Gaps = 89/357 (24%)

Query: 34  IFHFQAH--SLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
           +  F  H   ++V  LD     LVSGS D  + I+DL     L  L SH+ +IT +    
Sbjct: 108 LMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWI-- 165

Query: 92  GTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVK-DWENFGTLKGHASRINDFDI 150
                D N D            WLIS + D  + +W +K   +   T   H  +   + +
Sbjct: 166 -----DHNMD------------WLISVAKDGLIKVWDLKAGGQCVETHMAHTGQC--WSM 206

Query: 151 HPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQF---VRWCGDSGEFFAVALL 207
                + I+ S D   ++W L   K  G    +K ++ G F    +  G S EF      
Sbjct: 207 AIDEEVIITTSMDSQAKIWELDLEKSNG----EKISERGTFETESKQRGVSTEFITAPNG 262

Query: 208 TKVL-------------------IYKTSTAKVHRELDTGKS------------------- 229
           T+                     I K    +  R  D G S                   
Sbjct: 263 TRFFYIQNNDKTIEIFRIRPEEEIRKALNRREKRLRDKGASEEEIQEAVNPNDISVLFHS 322

Query: 230 -SIMRME--------IENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTP-EFNLQ 279
            S +R          I+  + K  +VL   N T+  +     Y +  +E PV      LQ
Sbjct: 323 FSTVRSSYKIKSSNWIQASNSKLEVVLTTSNNTIESYQIP--YSKRDAEPPVRRYNVELQ 380

Query: 280 GHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDE 336
           GH   ++      +     L++  S+G++ VW+++ K+ +  + CG      ALC +
Sbjct: 381 GHRTDIRSMDISDD---GKLLSTASNGELKVWNLTTKKCIRTFSCG-----YALCSQ 429

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 83/193 (43%), Gaps = 39/193 (20%)

Query: 42  LSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF-SKGTKIEDKNE 100
           ++  C       L  G  D  I+++DL  +  L     H+  +T L+  S+GT+      
Sbjct: 76  VTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTR------ 129

Query: 101 DDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISV 160
                         L+S S D +L+IW +        L+ H   I    I  +    ISV
Sbjct: 130 --------------LVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLISV 175

Query: 161 SEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRW-CGDSGEFFAVALLTKVLIYKT--ST 217
           ++D  I++W+L    KAG          GQ V      +G+ +++A+  +V+I  +  S 
Sbjct: 176 AKDGLIKVWDL----KAG----------GQCVETHMAHTGQCWSMAIDEEVIITTSMDSQ 221

Query: 218 AKVHRELDTGKSS 230
           AK+  ELD  KS+
Sbjct: 222 AKIW-ELDLEKSN 233

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 65/138 (47%), Gaps = 9/138 (6%)

Query: 38  QAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKEL--GTLLSHQGSITALKFSKGT 93
           +AH+ ++  LD++   + LV+GS D+  + +D +  ++L  GT       I  LK    T
Sbjct: 461 EAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGT---KDKYIPQLKLVHDT 517

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153
            +E    DD          ++L  +  D+ + ++     + + +L GH   +   D    
Sbjct: 518 TLE--LTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVD 575

Query: 154 NRIAISVSEDHSIRLWNL 171
           +++ I+ S D +I++W +
Sbjct: 576 SKMLITSSADKNIKIWGV 593

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 69/162 (42%), Gaps = 30/162 (18%)

Query: 46  CLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALK-FSKGTKIEDKNEDDT- 103
           C     ++L +G+ D+ IRI+D+ +RK +  L  H+  I +L  F  G K+   + D T 
Sbjct: 380 CFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTI 439

Query: 104 ------------------GLTT---GRGNSKWLISASDDHNLVIWR------VKDWENFG 136
                             G+TT     GN  ++ + S D  + +W       V+  ++ G
Sbjct: 440 RIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEG 499

Query: 137 -TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKA 177
            T  GH   +         +  +S S D S++LWNL  +  A
Sbjct: 500 ETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGA 541

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 95/212 (44%), Gaps = 16/212 (7%)

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           + K+L + ++D  + IW +   +    L+GH   I   D   S    +S S D +IR+W+
Sbjct: 384 DGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWD 443

Query: 171 LMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTK-VLIYKTSTAKVHRELDT-GK 228
           L T + +  L ++        V     +G + A   L + V ++ +++  +   LD+ G+
Sbjct: 444 LHTGQCSLTLSIE---DGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGE 500

Query: 229 SSIMRME-----IENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTP---EFNLQG 280
           + +   +     +   DGK+ IV    + +V ++  +++     S +P T    E    G
Sbjct: 501 TGVGHKDSVYSVVFTRDGKN-IVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIG 559

Query: 281 HTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWD 312
           H + V      +N+   Y+++   D  ++ WD
Sbjct: 560 HKDFVLSVTTTEND--QYILSGSKDRGVIFWD 589

>Kwal_47.17555
          Length = 417

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 53/131 (40%), Gaps = 24/131 (18%)

Query: 43  SVKCLDISKR---YL-VSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDK 98
           S  C+D  +    YL  +G     I IYD Q      TL  H   IT +KF    ++   
Sbjct: 107 SFTCIDQYESDGDYLYATGDQGGIISIYDSQAEVTR-TLEGHYAEITDVKFFPSGEV--- 162

Query: 99  NEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAI 158
                           L+S S D  L +W   D  N  TLKGH S +    I    R  +
Sbjct: 163 ----------------LLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVM 206

Query: 159 SVSEDHSIRLW 169
           S S+D S++LW
Sbjct: 207 SSSKDGSLKLW 217

 Score = 32.7 bits (73), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%)

Query: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLK 181
           TL+GH + I D    PS  + +S S D  +++W+ +       LK
Sbjct: 143 TLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLK 187

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 66/152 (43%), Gaps = 34/152 (22%)

Query: 34  IFHFQAHSLSVKCLDIS--KRYLVSGSNDEHIRIYDL-----------QKRKELG--TLL 78
           ++ F   +  + CL+ S       +G  D +I+++ L           ++R+++   TL+
Sbjct: 414 MYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI 473

Query: 79  SHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTL 138
            H G++ +  FS                    ++K+L+SAS+D  + +W +  + +  + 
Sbjct: 474 GHSGTVYSTSFSP-------------------DNKYLLSASEDKTVRLWSMDTYSSLVSY 514

Query: 139 KGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           KGH   + D    P      + S D + RLW+
Sbjct: 515 KGHNHPVWDVSFSPLGHYFATASHDQTARLWS 546

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/142 (19%), Positives = 56/142 (39%), Gaps = 22/142 (15%)

Query: 33  PIFHFQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           P+  F  H   V C+       Y+ +GS D+  R++D+     +   L H   + +   S
Sbjct: 552 PLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVS 611

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHA-SRINDFD 149
                               + +WL + S+D  + +W +   +    ++GH  + +    
Sbjct: 612 P-------------------DGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLS 652

Query: 150 IHPSNRIAISVSEDHSIRLWNL 171
                 + +S   DHS+R+W+L
Sbjct: 653 YSKEGTVLVSGGADHSVRVWDL 674

 Score = 35.4 bits (80), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVR 193
           N  TL GH+  +      P N+  +S SED ++RLW++ T   + ++  K +N     V 
Sbjct: 468 NNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTY--SSLVSYKGHNHPVWDVS 525

Query: 194 WCGDSGEFFAVA 205
           +    G +FA A
Sbjct: 526 FS-PLGHYFATA 536

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/163 (19%), Positives = 61/163 (37%), Gaps = 25/163 (15%)

Query: 39  AHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK----- 91
            HS +V     S   +YL+S S D+ +R++ +     L +   H   +  + FS      
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYF 533

Query: 92  GTKIEDKNE------------------DDTGLTTGRGNSKWLISASDDHNLVIWRVKDWE 133
            T   D+                    +D    +   N  ++ + S D    +W +   +
Sbjct: 534 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGD 593

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK 176
           +     GH + +    + P  R   + SED  I +W++ T K+
Sbjct: 594 SVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKR 636

>KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces
           cerevisiae YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis, start by similarity
          Length = 582

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 70/183 (38%), Gaps = 46/183 (25%)

Query: 33  PIF-HFQAHSLSVKCL--DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           P F     HS  V  L  ++++  L SG ND  + +YD   R+ + ++  H  ++ A+ +
Sbjct: 392 PFFEQIDTHSQEVCGLKWNVNENKLASGGNDNMVYVYDGTLRQPMLSMEEHTAAVKAMAW 451

Query: 90  SKGTK--------IEDK-------------NEDDTG--------------LTTGRGNSKW 114
           S  T+          DK             NE DTG              + T  G SK+
Sbjct: 452 SPHTRGVLATGGGTADKKLKIWNISKAVKLNEVDTGSQLCNMLWSKNTDEIITSHGYSKY 511

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTV 174
                   NL +W     E    LKGH+ R+    +       +S + D ++R W L   
Sbjct: 512 --------NLTLWNYPTLEPMAVLKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFDK 563

Query: 175 KKA 177
            K+
Sbjct: 564 PKS 566

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/142 (19%), Positives = 60/142 (42%), Gaps = 22/142 (15%)

Query: 33  PIFHFQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           P+  F  H+  V  +       Y+ +GS+D+  R++D+     +   L H   + + + S
Sbjct: 609 PLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVS 668

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHA-SRINDFD 149
                               + +WL + S+D  + +W +   +    ++GH  + ++   
Sbjct: 669 P-------------------DGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLS 709

Query: 150 IHPSNRIAISVSEDHSIRLWNL 171
            +    + IS   DHS+R+W++
Sbjct: 710 FNKEGNVLISGGADHSVRVWDV 731

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 63/160 (39%), Gaps = 25/160 (15%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK--------------------- 91
           YLVSGS D+ ++++ +     L     H   +  +KFS                      
Sbjct: 547 YLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDH 606

Query: 92  --GTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
               +I   + +D    +   N  ++ + S D    +W V   ++     GH + +    
Sbjct: 607 IYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQ 666

Query: 150 IHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNG 189
           + P  R   + SED  I LW++ T K+  + +++ + +N 
Sbjct: 667 VSPDGRWLATGSEDGVICLWDIGTGKR--IKQMRGHGKNA 704

 Score = 35.0 bits (79), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 28/136 (20%), Positives = 47/136 (34%), Gaps = 37/136 (27%)

Query: 52  RYLVSGSNDEHIRIYDL------------------QKRKELGTLLSHQGSITALKFSKGT 93
           R   +G  D +I+I+ L                   +     TL+ H G++ +  FS   
Sbjct: 486 RLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSP-- 543

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153
                            ++ +L+S S+D  + +W +         KGH   + D    P 
Sbjct: 544 -----------------DNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPL 586

Query: 154 NRIAISVSEDHSIRLW 169
                S S D + RLW
Sbjct: 587 GHYFASASHDQTARLW 602

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG 196
           TL GH+  +      P N   +S SED +++LW++ T     ++  K +N     V++  
Sbjct: 528 TLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDT--HTALVNYKGHNHPVWDVKFS- 584

Query: 197 DSGEFFAVA 205
             G +FA A
Sbjct: 585 PLGHYFASA 593

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 55/130 (42%), Gaps = 27/130 (20%)

Query: 37  FQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSH-QGSITALKFSKGT 93
           F  H+  V    +S   R+L +GS D  I ++D+   K +  +  H + ++ +L F+K  
Sbjct: 655 FLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEG 714

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153
            +                   LIS   DH++ +W VK     GT +        F+ H  
Sbjct: 715 NV-------------------LISGGADHSVRVWDVK----HGTTEQGPEPEQPFNAHVG 751

Query: 154 NRIAISVSED 163
           + I  S+++D
Sbjct: 752 D-ITASINQD 760

>Scas_630.6
          Length = 621

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 58/122 (47%), Gaps = 6/122 (4%)

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           + ++L + ++D  + IW +K+ +    LKGH   I   D  P  +  +S S D SIR+W+
Sbjct: 352 DGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWD 411

Query: 171 LMTVKKAGVLKLKKYNQNG-QFVRWCGDSGEFFAVALLTK-VLIYKTSTAKVHRELDTGK 228
           L    K G   L    ++G   V    + G+  A   L + V I+ +ST  +   LD+  
Sbjct: 412 L----KTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDN 467

Query: 229 SS 230
            S
Sbjct: 468 ES 469

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 99/246 (40%), Gaps = 42/246 (17%)

Query: 46  CLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALK-FSKGTKIEDKNED--- 101
           C      +L +G+ D+ IRI+++++RK +  L  H+  I +L  F  G K+   + D   
Sbjct: 348 CFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSI 407

Query: 102 ----------------DTGLTT---GRGNSKWLISASDDHNLVIW---------RVKDWE 133
                           + G+TT        K + + S D ++ IW         R+    
Sbjct: 408 RIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDN 467

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLK-KYNQNGQFV 192
             G   GH   +         +  +S S D +++LWNL    ++G  K +  Y  +  FV
Sbjct: 468 ESG--NGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDT-QSGTGKCEVTYIGHKDFV 524

Query: 193 RWCGDSGE---FFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENI---DGKDYIV 246
                S +    F+ +    V+I+   +      L   + S++ +   N    DGK+Y +
Sbjct: 525 LSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRKSVISVATVNSNVDDGKNYKL 584

Query: 247 LAFGNG 252
            A G+G
Sbjct: 585 FATGSG 590

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 63/141 (44%), Gaps = 3/141 (2%)

Query: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK-G 92
           I+ F +H   +  L      LVSGS D  IR +DL   K + TL  +  +   L  S  G
Sbjct: 498 IYTFDSHIDEITALSFEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIG 557

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
           +   + N D   +   +     L + + D  + +W ++      TL+GH+  +       
Sbjct: 558 SGFLNTNNDHPIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDS 617

Query: 153 SNRIAISVSEDHSIRLWNLMT 173
            N +  S+  D+SIR+W+L T
Sbjct: 618 LNLVTGSL--DNSIRIWDLRT 636

>Kwal_23.6324
          Length = 514

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 67/310 (21%), Positives = 117/310 (37%), Gaps = 69/310 (22%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSK 113
           +V+GS D   RI+D      + TL  H   +  + +    ++                  
Sbjct: 158 MVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPDGEL------------------ 199

Query: 114 WLISASDDHNLVIWRVKDWENFG-TLKGHASRINDFDIHPSN--------RIAISVSEDH 164
            + + S D+ + +W     E++G  L+GHA  I      P +        R+A S S+D 
Sbjct: 200 -IATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLA-SASKDG 257

Query: 165 SIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFA-----------VALLTKVLIY 213
           +I++W+  T ++  VL L  +  +   V+W G  G  ++           +A   K +  
Sbjct: 258 TIKIWD--TTRRVCVLTLSGHTNSVSCVKW-GGRGILYSGSHDKTIRAWDMAAGGKCINI 314

Query: 214 KTSTAKVHRELDTGKSSIMRMEIENIDG--------------KDYIVLAFGNGTVS--MF 257
             S A     L       +R+   +  G              K+Y  +A  NG +   M 
Sbjct: 315 LKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELMV 374

Query: 258 PAKS-----LYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWD 312
            A       L+D   + +P+T    + GH   V    F  +  G Y+V+   D  I +WD
Sbjct: 375 TASDDFTMYLWDPLKASKPIT---RMTGHQKLVNHVAFSPD--GRYIVSASFDNSIKLWD 429

Query: 313 MSNKEQVAVY 322
             N   +A +
Sbjct: 430 GRNGTFIATF 439

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/145 (20%), Positives = 67/145 (46%), Gaps = 22/145 (15%)

Query: 54  LVSGSNDEHIRIYD-LQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           +V+ S+D  + ++D L+  K +  +  HQ  +  + FS                    + 
Sbjct: 373 MVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSP-------------------DG 413

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
           ++++SAS D+++ +W  ++     T +GH + +         R+ +S S+D ++++W++ 
Sbjct: 414 RYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVR 473

Query: 173 TVKKAGVLKLKKYNQNGQFVRWCGD 197
           T K +  + L  +N     V W  D
Sbjct: 474 TKKLS--VDLPGHNDEVYTVDWSVD 496

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 53/140 (37%), Gaps = 21/140 (15%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           PI     H   V  +  S   RY+VS S D  I+++D +    + T   H  S+  + +S
Sbjct: 393 PITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWS 452

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
              ++                   L+S S D  L +W V+  +    L GH   +   D 
Sbjct: 453 SDCRL-------------------LVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTVDW 493

Query: 151 HPSNRIAISVSEDHSIRLWN 170
               +   S  +D  +R+W 
Sbjct: 494 SVDGKRVCSAGKDKMVRIWT 513

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 57/263 (21%), Positives = 110/263 (41%), Gaps = 48/263 (18%)

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVK-DWENFG----TLKGHASRI 145
           +GT +E  N   T L+T       L+S S D  L+ W++  + + +G    + KGH+  +
Sbjct: 26  RGT-LEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIV 84

Query: 146 NDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFV-RWCGDSGEFFAV 204
            D  +    + A+S S D ++RLW+L               Q+G+ + R+ G   +  +V
Sbjct: 85  QDCTVTHDGKYALSASWDKTLRLWDL---------------QSGKCIKRFVGHKSDVMSV 129

Query: 205 ALLTKVL-IYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLY 263
           ++  +   I   S  K  +  +T    ++ +   N    D++        V + P++   
Sbjct: 130 SIDPRATQIVSASRDKTVKVWNTVGDCVVTLLGHN----DWV------SNVRIAPSEKSD 179

Query: 264 DE----EASEEPVTPEFNLQ---------GHTNRVKDFKFYKNEFGHYLVTIGSDGKIVV 310
           D      A  + V   ++LQ         GH N V       +  G    + G DG+I++
Sbjct: 180 DAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPD--GSIFASAGKDGQIIL 237

Query: 311 WDMSNKEQVAVYDCGERLNCLAL 333
           W+++ K  +   D  + +  +A 
Sbjct: 238 WNLNEKTALYTLDAKDEVFAVAF 260

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 70/168 (41%), Gaps = 29/168 (17%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF- 89
           P+  F+ HS  V+   ++   +Y +S S D+ +R++DLQ  K +   + H+  + ++   
Sbjct: 73  PVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSID 132

Query: 90  SKGTKIEDKNEDDT---------GLTTGRGNSKWL-----------------ISASDDHN 123
            + T+I   + D T          + T  G++ W+                 ISA  D  
Sbjct: 133 PRATQIVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKV 192

Query: 124 LVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           + +W ++ +       GH + +      P   I  S  +D  I LWNL
Sbjct: 193 VKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNL 240

>Scas_585.8
          Length = 460

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 58/138 (42%), Gaps = 25/138 (18%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIY--DLQKRKELGTLLSHQGSITALKFSKG 92
            QAH  +V C+  S    ++ SG  D  I+I+  +    KE     +H   I  + FS  
Sbjct: 127 MQAHDSAVSCIQYSHAGDWMCSGDADGGIKIWQPNFNMVKEFEN--AHTECIRDISFSN- 183

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
                             N    ++ SDD+ L IW   + +   TL GH   I   D HP
Sbjct: 184 ------------------NDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKSCDWHP 225

Query: 153 SNRIAISVSEDHSIRLWN 170
              + +S S+D+ ++LW+
Sbjct: 226 EMGLIVSASKDNLVKLWD 243

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 80/208 (38%), Gaps = 62/208 (29%)

Query: 36  HFQAH-SLSVKCLDISK--RYLVSGSNDEHIRIYDLQK-----------------RKELG 75
           H + H S  V   D+S   + L +G  D  IRI+ +                    K L 
Sbjct: 11  HREEHKSYEVYTCDVSPDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLS 70

Query: 76  TLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWR------- 128
           T+  H GS+T +KFS                    + K+L S SDD  L+IW        
Sbjct: 71  TMSRHAGSVTTVKFSP-------------------DGKYLASGSDDRILLIWELEGGTTQ 111

Query: 129 ---------VKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGV 179
                    ++ W     L  H + I D    P + I +SV  D +I +WN  T +    
Sbjct: 112 PMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPDSSIMVSVGLDRAIIIWNGSTFE---- 167

Query: 180 LKLKKYNQNGQFVRWC--GDSGEFFAVA 205
            K+K+++ +   V+      + ++FA A
Sbjct: 168 -KVKRFDVHQSHVKGVVFDPANKYFATA 194

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 63/150 (42%), Gaps = 21/150 (14%)

Query: 30  IFTPIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL 87
           +  P+     H+ SV  +  S   +YL SGS+D  + I++L+            G+   +
Sbjct: 65  LMKPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEG-----------GTTQPM 113

Query: 88  KFSKGTKIEDKN--------EDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLK 139
             ++ T IE  N        ++D        +S  ++S   D  ++IW    +E      
Sbjct: 114 FGAESTDIEHWNVRRRLVAHDNDIQDICWAPDSSIMVSVGLDRAIIIWNGSTFEKVKRFD 173

Query: 140 GHASRINDFDIHPSNRIAISVSEDHSIRLW 169
            H S +      P+N+   + S+D +I+++
Sbjct: 174 VHQSHVKGVVFDPANKYFATASDDRTIKMF 203

>Kwal_27.12667
          Length = 721

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 67/153 (43%), Gaps = 35/153 (22%)

Query: 38  QAHSLSVKCLDISKRY---LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
           +AH  S+ CLD    +     +G  D  ++I++L K+ ++G L  H  S++ ++      
Sbjct: 401 KAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQ------ 454

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWE---NFGTLKGHASR-INDFDI 150
           +ED              S  LI+   D  L +W ++  E   N G  +G     ++ FD 
Sbjct: 455 MED--------------SHSLITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDA 500

Query: 151 HPSNRIA--------ISVSEDHSIRLWNLMTVK 175
           H     A        +S S+D +IR W+L T K
Sbjct: 501 HVDEITALHFEGNSLVSGSQDRTIRQWDLTTGK 533

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 64/152 (42%), Gaps = 19/152 (12%)

Query: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTL-LSHQGSITALKFSKG 92
           +  F AH   +  L      LVSGS D  IR +DL   K L T+ ++     T+  FS  
Sbjct: 495 VHTFDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFS-- 552

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISA-----------SDDHNLVIWRVKDWENFGTLKGH 141
            KI   N   + L T   N   +I A           + D  + +W ++  +   TL+GH
Sbjct: 553 -KISSNNPRSSILLT--HNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGH 609

Query: 142 ASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
              +        N +  S+  D SIR+W+L T
Sbjct: 610 TDAVTGLQFDSVNLVTGSL--DRSIRIWDLRT 639

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 68/168 (40%), Gaps = 27/168 (16%)

Query: 33  PIFHFQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           P+  F  H   V C+       Y+ +GS+D+  R++D+     +   L H   + ++   
Sbjct: 601 PLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVC 660

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHA-SRINDFD 149
                               + +WL + S+D  + +W +   +    ++GH  + I    
Sbjct: 661 P-------------------DGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLS 701

Query: 150 IHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGD 197
                 + IS   DH++R+W+L   KKA      + ++   F+ + GD
Sbjct: 702 YSKEGNVLISGGADHTVRVWDL---KKATTEPSAEPDE--PFIGYLGD 744

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 60/156 (38%), Gaps = 38/156 (24%)

Query: 34  IFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQ-----------------KRKEL 74
           ++ FQ  +  + CLD S   R   +G  D +I+I+ L                  +    
Sbjct: 459 MYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTC 518

Query: 75  GTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWEN 134
            TL+ H G++ +  FS                    ++K+L+S S+D  + +W +     
Sbjct: 519 KTLVGHSGTVYSTSFSP-------------------DNKYLLSGSEDKTVRLWSMDTHTA 559

Query: 135 FGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
             + KGH   + D    P      + S D + RLW+
Sbjct: 560 LVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWS 595

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 62/163 (38%), Gaps = 25/163 (15%)

Query: 39  AHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK----- 91
            HS +V     S   +YL+SGS D+ +R++ +     L +   H   +  + FS      
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYF 582

Query: 92  GTKIEDKNE------------------DDTGLTTGRGNSKWLISASDDHNLVIWRVKDWE 133
            T   D+                    +D    +   N  ++ + S D    +W V   +
Sbjct: 583 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGD 642

Query: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK 176
           +     GH + +    + P  R   + SED  I +W++ T K+
Sbjct: 643 SVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKR 685

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG 196
           TL GH+  +      P N+  +S SED ++RLW++ T     ++  K +N     V +  
Sbjct: 520 TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDT--HTALVSYKGHNHPVWDVSFS- 576

Query: 197 DSGEFFAVA 205
             G +FA A
Sbjct: 577 PLGHYFATA 585

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/243 (21%), Positives = 97/243 (39%), Gaps = 34/243 (13%)

Query: 114 WLISASDDHNLVIWRV----KDWENFGTLKGHASRINDF---DIHPSN--RIAISVSEDH 164
           W+ +AS DH++++WR     +D+  +    GH   +N     ++ P +     I+ S D 
Sbjct: 404 WVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAVGLPNVMPRSWPEFIITASNDL 463

Query: 165 SIRLWNLMTV-----KKAGVLKLKKYNQNGQ----FVRWCGDSGEFFAVALLTKVL-IYK 214
           +I+ W +  V     +   ++K  +Y +              +   FA A   K   I+ 
Sbjct: 464 TIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLFATASYDKTCKIWN 523

Query: 215 TSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTP 274
               +    L   K  +  +     D    +    G+ T+ ++          S E    
Sbjct: 524 LDDGEFQATLANHKRGLWDVAFCQYD--KLLATCSGDKTIKIW----------SLESYAV 571

Query: 275 EFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDC-GERLNCLAL 333
              L+GHTN V+   F        L++ G+DG +++WD+S  E V   D    R+  LA+
Sbjct: 572 VKTLEGHTNAVQRCSFINK--NKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAV 629

Query: 334 CDE 336
            ++
Sbjct: 630 MND 632

 Score = 35.4 bits (80), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 56/138 (40%), Gaps = 21/138 (15%)

Query: 38  QAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKI 95
           +AH   +  + IS       + S D+  +I++L   +   TL +H+  +  + F +  K+
Sbjct: 492 RAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKL 551

Query: 96  EDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNR 155
                              L + S D  + IW ++ +    TL+GH + +        N+
Sbjct: 552 -------------------LATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNK 592

Query: 156 IAISVSEDHSIRLWNLMT 173
             IS   D  + +W+L T
Sbjct: 593 QLISTGADGLVIIWDLST 610

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 19/94 (20%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGN 111
           + L + S D+ I+I+ L+    + TL  H  ++    F       +KN            
Sbjct: 550 KLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFI------NKN------------ 591

Query: 112 SKWLISASDDHNLVIWRVKDWENFGTLKGHASRI 145
            K LIS   D  ++IW +   E+  TL  H +RI
Sbjct: 592 -KQLISTGADGLVIIWDLSTGESVKTLDAHNNRI 624

>Kwal_23.5351
          Length = 474

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 54/119 (45%), Gaps = 18/119 (15%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           ++ +GS D  ++++D++K  +  ++L+H   ++ + F K                   N 
Sbjct: 369 HVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKE------------------NG 410

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
            +L+S+S D  + ++    W    +L+GH  +I   DI        S   D S+++W L
Sbjct: 411 NFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGT----LKGHASRINDFDI 150
           ++  ++D  G      +S+ L +   D+ + IW  +   +       L+GH +R++    
Sbjct: 220 LDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKF 279

Query: 151 HPSNRIAISVSEDHSIRLWNL 171
           HPS+R   S S D + RLW++
Sbjct: 280 HPSDRFVASASFDMTWRLWDV 300

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 50/127 (39%), Gaps = 19/127 (14%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGR 109
           S R++ S S D   R++D+++  EL     H   +  L F                   +
Sbjct: 282 SDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDF-------------------Q 322

Query: 110 GNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
            +   L SA  D    +W ++   +   L+GHA  I      P+     + S D ++++W
Sbjct: 323 CDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVW 382

Query: 170 NLMTVKK 176
           ++    K
Sbjct: 383 DIRKANK 389

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 65/164 (39%), Gaps = 26/164 (15%)

Query: 35  FHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
           +     +++   +D   R +VS   D  I  YD  + K LG L      IT++ + +   
Sbjct: 496 YRLHKRAVTGVAVDGMNRKMVSCGLDGIIGFYDFNESKYLGKL-QMDAPITSMVYHR--- 551

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
                           +S     A DD ++V+      +    L GH +RI  FD  P  
Sbjct: 552 ----------------SSDLCAFALDDLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDG 595

Query: 155 RIAISVSEDHSIRLWNLMT------VKKAGVLKLKKYNQNGQFV 192
           R  +S S D +IR W+L T      VK   V    K++ NG  +
Sbjct: 596 RWLVSASLDSTIRTWDLPTGSCIDGVKIESVATNLKFSPNGDML 639

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 59/131 (45%), Gaps = 39/131 (29%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGR 109
           + ++++ G     + +Y +   K LG LL H  +IT L+F+K  K               
Sbjct: 310 TDKFVIPGPGGS-LLVYTIGNNKPLGRLLGHTSTITTLEFNKSNKS-------------- 354

Query: 110 GNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP---------SNRIAISV 160
                L+SASDD+ + +WR           G++S  NDF  H          ++ + IS 
Sbjct: 355 -----LLSASDDNTIKVWR----------GGNSSAANDFTDHTKTISSAHWINDDLIIST 399

Query: 161 SEDHSIRLWNL 171
           + D ++++W++
Sbjct: 400 AYDGTVKVWSI 410

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 69/146 (47%), Gaps = 32/146 (21%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLL-SHQGSITALKFSK--------------------- 91
           +++G+    +R+++  K+ +L  +L SH+  I A+K+++                     
Sbjct: 224 VLTGTTSGELRLWN--KQGKLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVILWSTLT 281

Query: 92  GTKIED--------KNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHAS 143
           GT+++         +NED  G+      +   +      +L+++ + + +  G L GH S
Sbjct: 282 GTQLQHFSFKEGDIENEDSLGIDLEWVETDKFVIPGPGGSLLVYTIGNNKPLGRLLGHTS 341

Query: 144 RINDFDIHPSNRIAISVSEDHSIRLW 169
            I   + + SN+  +S S+D++I++W
Sbjct: 342 TITTLEFNKSNKSLLSASDDNTIKVW 367

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 6/88 (6%)

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVK-DWENFG----TLKGHASRI 145
           +GT +E  N   T L T  G    L+SAS D  L+ W++  D + FG    + KGH+  +
Sbjct: 10  RGT-LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIV 68

Query: 146 NDFDIHPSNRIAISVSEDHSIRLWNLMT 173
            D  +  +   A+S S D ++RLW++ T
Sbjct: 69  QDCTLTENGAYALSGSWDKTLRLWDVAT 96

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 64/146 (43%), Gaps = 28/146 (19%)

Query: 33  PIFHFQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           P+  F+ HS  V+   +++   Y +SGS D+ +R++D+   +   T + H+G + ++   
Sbjct: 57  PVKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAID 116

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
           K   +                   +IS S D ++ +W +K  +   TL GH   ++   I
Sbjct: 117 KKASM-------------------IISGSRDKSIKVWSIKG-DCLATLIGHNDWVSQVRI 156

Query: 151 HPSNR-----IAISVSEDHSIR-LWN 170
             S+        IS   D  ++ LWN
Sbjct: 157 ANSSDDDDKVTVISAGNDKMVKVLWN 182

 Score = 35.8 bits (81), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%)

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           N  + +S S D  L +W V   E F T  GH   +    I     + IS S D SI++W+
Sbjct: 76  NGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWS 135

Query: 171 L 171
           +
Sbjct: 136 I 136

>Sklu_2384.3 YKL018W, Contig c2384 6547-7533
          Length = 328

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/288 (20%), Positives = 109/288 (37%), Gaps = 65/288 (22%)

Query: 46  CLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGL 105
           C D   +YL++ + ++++ +YD    + L T+ S +    + KF+               
Sbjct: 33  CFDDHGQYLLTATANDNMHLYDAVSCRFLNTIASKKYGCHSAKFT--------------- 77

Query: 106 TTGRGNSKWLISAS-DDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDH 164
                 S+ + S++    ++    ++  +      GH + ++D ++ P   + +S S D 
Sbjct: 78  ---HAQSECIYSSTMKSFDIRHLNLETNQYLRYFTGHGALVSDIEMSPLEDVFLSASYDE 134

Query: 165 SIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVH--- 221
           S+RLW+L T K   ++           V  C        +A     L++     + H   
Sbjct: 135 SVRLWDLRTSKAQAIVP--------SLVPTC--------IAYDPSGLVFAIGNPENHEIG 178

Query: 222 ----RELDTGKSSIM----------RMEIENIDGKDYIVLAFGNG---TVSMFPAKSLYD 264
               R+L  G   ++          +ME  N DGK Y++LA   G    +  F    L++
Sbjct: 179 LYNIRQLKAGPFLMIKVDPKFHQWNKMEFSN-DGK-YVLLASSAGKHLILDAFDGTQLFE 236

Query: 265 EEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWD 312
              +      EF   G      D        G Y +    +GKI VW+
Sbjct: 237 LGGTRPFPLREFIDAGSACFTPD--------GCYTLGTDYEGKIAVWN 276

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 58/133 (43%), Gaps = 22/133 (16%)

Query: 44  VKCLDISK---RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNE 100
           V+C+ I      + ++GSND  ++++DL   K   TL  H  ++      +   + D++ 
Sbjct: 142 VRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTV------RDVAVSDRH- 194

Query: 101 DDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISV 160
                        +L S S+D  +  W ++  +      GH S +    IHP+  +  + 
Sbjct: 195 ------------PYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATA 242

Query: 161 SEDHSIRLWNLMT 173
             D  I+LW++ T
Sbjct: 243 GRDSVIKLWDMRT 255

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 60/146 (41%), Gaps = 21/146 (14%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
              H ++V+ + +S R  YL S S D+ ++ +DL+K + +     H   +  +       
Sbjct: 178 LAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLD 237

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
           +                   + +A  D  + +W ++      TL GH   IN     P +
Sbjct: 238 L-------------------IATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVD 278

Query: 155 RIAISVSEDHSIRLWNLMTVKKAGVL 180
              +S S D ++RLW+++  K   VL
Sbjct: 279 PQVVSSSTDATVRLWDVVAGKTMKVL 304

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 54/140 (38%), Gaps = 21/140 (15%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           PI     H   V  +  S   RY+VS S D  I+++D +  K + T   H  S+  + +S
Sbjct: 392 PILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWS 451

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
              ++                   L+S S D  L +W VK  +    L GH   +   D 
Sbjct: 452 SDCRL-------------------LVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDW 492

Query: 151 HPSNRIAISVSEDHSIRLWN 170
               +   S  +D  +RLW 
Sbjct: 493 SVDGKRVCSGGKDKMVRLWT 512

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 112/300 (37%), Gaps = 49/300 (16%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK-GTKIEDKNEDDT--------G 104
           +V+G+ D   RI+D   +  L TL  H   +  + +S  G  I   + D T        G
Sbjct: 157 MVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKG 216

Query: 105 LTTG---RGNSKW-------------------LISASDDHNLVIWRVKDWENFGTLKGHA 142
            + G   RG++KW                   L SAS D  + IW         TL GH 
Sbjct: 217 QSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSGHT 276

Query: 143 SRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFF 202
           S ++       N +  S S D ++R W++     AG   +     +  +V     S ++ 
Sbjct: 277 SSVSCIKWGGRN-VLYSASHDRTVRCWDMA----AGGKCINILKSHAHWVNHLSLSTDY- 330

Query: 203 AVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSL 262
               L       T T     E    ++     ++   +G    ++  G+   +M+    L
Sbjct: 331 ---ALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMY----L 383

Query: 263 YDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVY 322
           ++     +P+     + GH   V    F  +  G Y+V+   D  I +WD  + + +A +
Sbjct: 384 WNPLKGSKPI---LRMTGHQKLVNHVAFSPD--GRYIVSASFDNSIKLWDGRDGKFIATF 438

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 68/145 (46%), Gaps = 22/145 (15%)

Query: 54  LVSGSNDEHIRIYD-LQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           +V+GS+D  + +++ L+  K +  +  HQ  +  + FS                    + 
Sbjct: 372 MVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSP-------------------DG 412

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
           ++++SAS D+++ +W  +D +   T +GH + +         R+ +S S+D ++++W++ 
Sbjct: 413 RYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVK 472

Query: 173 TVKKAGVLKLKKYNQNGQFVRWCGD 197
           T K    + L  +N     V W  D
Sbjct: 473 TRKL--TVDLPGHNDEVYTVDWSVD 495

>Kwal_55.22067
          Length = 451

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 25/138 (18%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLL--SHQGSITALKFSKG 92
            QAH  +V  +  S    +L+SG +D  I+I+  Q    +  +L  +H   I  + FS  
Sbjct: 121 MQAHDSAVAVMKYSHAGDWLISGDSDGTIKIW--QPNFNMVKVLDEAHTQCIRGISFS-- 176

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
                            G     ++ SDD+ L IW   + +   TL GH   +   D HP
Sbjct: 177 -----------------GTDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSCDWHP 219

Query: 153 SNRIAISVSEDHSIRLWN 170
           +  +  S S+D+ ++LW+
Sbjct: 220 TMGLIASGSKDNLVKLWD 237

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 81/206 (39%), Gaps = 31/206 (15%)

Query: 47  LDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLT 106
           LD   R +VS   D  +  YD  K   LG L      ITA+ + +               
Sbjct: 510 LDGMNRKMVSCGLDGIVGFYDFNKSTLLGKL-KLDAPITAMVYHR--------------- 553

Query: 107 TGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSI 166
               +S     A DD ++V+           L GH++RI  FD  P  R  +S S D +I
Sbjct: 554 ----SSDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTI 609

Query: 167 RLWNLMT------VKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKV 220
           R W+L T      +    V    K++ NG  +     +G    + + T    +KT +   
Sbjct: 610 RTWDLPTGGCIDGIIVDNVATNVKFSPNGDLLATTHVTGN--GICIWTNRAQFKTVST-- 665

Query: 221 HRELDTGKSSIMRMEIENIDGKDYIV 246
            R +D  + + M +   ++ G D ++
Sbjct: 666 -RTIDESEFARMALPSTSVRGNDSML 690

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 70/355 (19%), Positives = 129/355 (36%), Gaps = 86/355 (24%)

Query: 32  TPIFHFQAHSLSVKCL--DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           T + +F  H  ++  L  D +   L+SGS D +I ++DL     L  L SH+ SIT   +
Sbjct: 112 TVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-W 170

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
            +G   ED                WLIS S D  + +W +K  +   T   H      + 
Sbjct: 171 CQG---ED----------------WLISTSKDGMIKLWDLKTHQCIETHIAHTGEC--WG 209

Query: 150 IHPSNRIAISVSEDHSIRLWNL--------MTVKKAGVLKLKKYNQNG---QFVRWCGDS 198
           +   + + I+   D  +++W L          + + G+ + K+  Q G   +F+    D 
Sbjct: 210 LAVKDDLLITTGTDSQVKIWKLDIENDKMGGKLTEMGIFE-KQSKQRGLKIEFITNSSDK 268

Query: 199 GEFFAVALLTKVLIYKTSTAKVHRELDTGK---------------------------SSI 231
             FF +    K +     T ++ +E +  +                           SS 
Sbjct: 269 TSFFYIQNADKTI----ETFRIRKEEEIARGLKKREKRLKEKGLTEEEIAKSIKESYSSF 324

Query: 232 MRMEIENI---------------DGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPV-TPE 275
           +    + I                 K  +VL   + T+  +       +  S  P+ T  
Sbjct: 325 ILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSNTIEYYSIPYEKRDPTSPAPLKTHT 384

Query: 276 FNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERLNC 330
             LQG    V+      +   + L+   S+G + +W++   + +  ++CG  L C
Sbjct: 385 IELQGQRTDVRSIDISDD---NKLLATASNGSLKIWNIKTHKCIRTFECGYALTC 436

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 52/120 (43%), Gaps = 20/120 (16%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSK 113
           L  G  D  I+++DL  +  L     H+ +IT L+F           D TG         
Sbjct: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF-----------DGTGTR------- 135

Query: 114 WLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
            LIS S D N+++W +        L+ H   I  F     + + IS S+D  I+LW+L T
Sbjct: 136 -LISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWL-ISTSKDGMIKLWDLKT 193

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 54/133 (40%), Gaps = 21/133 (15%)

Query: 39  AHSLSVKCLDIS--KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
            H L V  +DIS   + +++ S D++I+I+ L       +L +HQ SI  +KF       
Sbjct: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP----- 625

Query: 97  DKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRI 156
                          S    S S D  +  W  + +E    L  H S +    +      
Sbjct: 626 --------------QSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGF 671

Query: 157 AISVSEDHSIRLW 169
            +S S DHSIR+W
Sbjct: 672 VVSSSHDHSIRIW 684

 Score = 36.2 bits (82), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 65/137 (47%), Gaps = 9/137 (6%)

Query: 39  AHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKEL--GTLLSHQGSITALKFSKGTK 94
           AH  ++  LD++   + LV+GS D+ ++ +D +    L  GT       +  LK    T 
Sbjct: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGT---KNKFLPVLKLHHDTT 527

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
           +E    DD        + ++L  +  D+ + ++ +   + + +L GH   +   DI   +
Sbjct: 528 LE--LTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585

Query: 155 RIAISVSEDHSIRLWNL 171
           ++ I+ S D +I++W L
Sbjct: 586 KMIITSSADKNIKIWGL 602

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 53/129 (41%), Gaps = 21/129 (16%)

Query: 44  VKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNED 101
           + C+ +S   RYL     D  ++++ L   K   +L  H+  + ++  S           
Sbjct: 534 ILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDIS----------- 582

Query: 102 DTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVS 161
                    +SK +I++S D N+ IW +   +   +L  H   I +    P +    S S
Sbjct: 583 --------FDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCS 634

Query: 162 EDHSIRLWN 170
           +D  ++ W+
Sbjct: 635 KDAVVKYWD 643

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 59/140 (42%), Gaps = 36/140 (25%)

Query: 44  VKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDT 103
           V  LD+   Y+ SGS D  +R Y+L  + E      H G I A+ +   T+         
Sbjct: 106 VSSLDVGSNYIYSGSYDGIVRTYNLSGKVE-KQYSGHSGPIRAVHYISSTR--------- 155

Query: 104 GLTTGRGNSKWLISASDDHNLVIWRVK-------------DWENFGTLKGHASRINDFDI 150
                      L+SA +D  L +W+ K             D +    L+GH + +   D+
Sbjct: 156 -----------LVSAGNDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDV 204

Query: 151 HPSNRIAISVSEDHSIRLWN 170
              +RI +S S D+++ LW+
Sbjct: 205 S-KDRI-LSASCDNTVSLWS 222

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 70/172 (40%), Gaps = 26/172 (15%)

Query: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93
           ++     +++   +D   R +VS   D  +  YD  K   LG L      IT++ + +  
Sbjct: 499 VYRLHKKAVTGIAMDGMNRKMVSCGLDGIVGFYDFSKSTFLGKL-KLDSPITSMVYHR-- 555

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153
                            +S     A DD ++V+      +    L GH++RI+ FD  P 
Sbjct: 556 -----------------SSDLFALALDDLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPD 598

Query: 154 NRIAISVSEDHSIRLWNLMT------VKKAGVLKLKKYNQNGQFVRWCGDSG 199
            R  +S S D +IR W+L T      +K   V+   K++ NG  +     SG
Sbjct: 599 GRWIVSSSLDSTIRTWDLPTGGCIDGMKVENVITNIKFSPNGDLLATTSVSG 650

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 278 LQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
           L GH+NR+  F F  +  G ++V+   D  I  WD+
Sbjct: 583 LWGHSNRISSFDFSPD--GRWIVSSSLDSTIRTWDL 616

>Scas_718.6*
          Length = 546

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 62/135 (45%), Gaps = 21/135 (15%)

Query: 39  AHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDK 98
             SL V    + K  LV    +  I +Y +   K +G LL HQG+I+ ++F+        
Sbjct: 327 TESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNV------- 379

Query: 99  NEDDTGLTTGRGNSKWLISASD-DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIA 157
                       NS+ L+++SD D+++ IW  +         GH+  I       ++ + 
Sbjct: 380 ------------NSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS-WINDDLV 426

Query: 158 ISVSEDHSIRLWNLM 172
           IS S D S+R+W+++
Sbjct: 427 ISASMDGSVRIWSVV 441

>Kwal_27.11585
          Length = 823

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 91/232 (39%), Gaps = 32/232 (13%)

Query: 111 NSKWLISASDDHNLVIWRV----KDWENFGTLKGHASRINDFDIHPSNR-----IAISVS 161
           N +WL + S DH +++W++    + ++ +    GHA  +    +    R       I+ S
Sbjct: 411 NGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGLPNVMRNTWPEFIITAS 470

Query: 162 EDHSIRLWNLMTVKKAGV----LKLKKYNQNGQ----FVRWCGDSGEFFAVALLTKVL-I 212
            D +I+ W++       V    +K+  Y +              +   FA A   K   I
Sbjct: 471 NDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKI 530

Query: 213 YKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPV 272
           +   + ++   L   K  +  +     D    +    G+ T+ ++          S E +
Sbjct: 531 WNVDSGELEGTLANHKRGLWDVTFCQYD--KLLATCSGDKTIKVW----------SLESM 578

Query: 273 TPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDC 324
           +    L+GHTN V+   F        +V+ G+DG I VWD+S  E +   D 
Sbjct: 579 SVVKTLEGHTNAVQRCSFINR--NKQIVSTGADGLIKVWDLSTGECIRTLDA 628

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 93/230 (40%), Gaps = 34/230 (14%)

Query: 31  FTPIFHFQAHSLSVKCLDIS-------KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGS 83
           F P   F  H+  V  + +          ++++ SND  I+ + + K        S+   
Sbjct: 436 FKPYARFTGHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPT------SNDVD 489

Query: 84  ITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHAS 143
           +  +K S  T+    +E D    +   N     +AS D    IW V   E  GTL  H  
Sbjct: 490 MHNIKVSDYTR--RAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKR 547

Query: 144 RINDFDIHPSNRIAISVSEDHSIRLWNL--MTVKKA------GVLKLKKYNQNGQFVRWC 195
            + D      +++  + S D +I++W+L  M+V K        V +    N+N Q V   
Sbjct: 548 GLWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTG 607

Query: 196 GDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYI 245
            D         L KV  +  ST +  R LD   + I  + + + DGK+++
Sbjct: 608 ADG--------LIKV--WDLSTGECIRTLDAHSNRIWALSVLS-DGKEFV 646

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 69/191 (36%), Gaps = 28/191 (14%)

Query: 139 KGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDS 198
           +GH   +N  D   +     + S+DH++ LW L     A   K K Y       R+ G +
Sbjct: 397 EGHTDLLNSLDSSENGEWLATCSKDHTVILWKL----NADSEKFKPY------ARFTGHA 446

Query: 199 GEFFAVALLTKV------LIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGN- 251
           G   AV L   +       I   S     ++    K +   +++ NI   DY   A    
Sbjct: 447 GPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKD 506

Query: 252 -GTVSMFPAKSLYDEEASEEPVTP--------EFNLQGHTNRVKDFKFYKNEFGHYLVTI 302
              +S+ P  S++   + ++            E  L  H   + D  F   ++   L T 
Sbjct: 507 INALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFC--QYDKLLATC 564

Query: 303 GSDGKIVVWDM 313
             D  I VW +
Sbjct: 565 SGDKTIKVWSL 575

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 76/181 (41%), Gaps = 32/181 (17%)

Query: 63  IRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDH 122
           I ++ + + K +G L+ H  ++T L ++   K+                   L+SASDD 
Sbjct: 318 ILVFSIGESKPIGKLVGHTKTLTVLCYNSDNKL-------------------LLSASDDK 358

Query: 123 NLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKL 182
            L  WR  +  +     GH   I   D    +R+ IS S D S+R+W   +VK+  ++ L
Sbjct: 359 TLRTWRGGNANSSNCFYGHTQSITYADWLDDDRL-ISTSMDGSVRVW---SVKQNALVGL 414

Query: 183 KKYNQNGQFVRWCG----DSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIEN 238
              +    F   CG    D  +F    L  +V +Y  +  K+   LD  +  I  + I  
Sbjct: 415 SVVDGVPIF---CGTLSSDKQKFATGTLDGEVSVY--NVKKLLEVLDADEKPIGPVRIPT 469

Query: 239 I 239
           I
Sbjct: 470 I 470

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 57/121 (47%), Gaps = 21/121 (17%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGR 109
           + ++++ G    ++ +Y +   + +G L+ H+G+I+ L+F+  TK+              
Sbjct: 329 TDKFVIPGPGG-NLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKL-------------- 373

Query: 110 GNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
                L SA+DD+ + +W   +  +     GH   I       +N + IS S D S++LW
Sbjct: 374 -----LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLK-WVNNDMLISASMDGSVKLW 427

Query: 170 N 170
           +
Sbjct: 428 D 428

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 54/140 (38%), Gaps = 21/140 (15%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           PI     H   V  +  S   RY+VS S D  I+++D +  K L T   H  S+  + +S
Sbjct: 394 PITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWS 453

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
              ++                   L+S S D  L +W VK  +    L GH   +   D 
Sbjct: 454 SDCRL-------------------LVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDW 494

Query: 151 HPSNRIAISVSEDHSIRLWN 170
               +   S  +D  +R+W 
Sbjct: 495 SVDGKRVCSGGKDKMVRIWT 514

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 60/123 (48%), Gaps = 20/123 (16%)

Query: 54  LVSGSNDEHIRIYD-LQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           +V+ S+D  + +++ L+  K +  +  HQ  +  + FS                    + 
Sbjct: 374 MVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP-------------------DG 414

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
           ++++SAS D+++ +W  +D +   T +GH + +         R+ +S S+D ++++W++ 
Sbjct: 415 RYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVK 474

Query: 173 TVK 175
           T K
Sbjct: 475 TRK 477

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 53/274 (19%), Positives = 100/274 (36%), Gaps = 60/274 (21%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSK 113
           +V+G+ D    I+D   +  + TL  H   +    +S   ++                  
Sbjct: 159 MVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGEL------------------ 200

Query: 114 WLISASDDHNLVIWRVKDWENFG-TLKGHASRINDFDIHP--------SNRIAISVSEDH 164
            + + S D+ + +W     + +G  L+GH+  I      P          R+A + S+D 
Sbjct: 201 -IATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLA-TASKDG 258

Query: 165 SIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHREL 224
           +I++W+  T ++  +L L  +  +   V+W G            K ++Y  S  K  R  
Sbjct: 259 TIKIWD--TTRRVCLLTLCGHTSSVSCVKWGG------------KNVLYSGSHDKTIRCW 304

Query: 225 DTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYD------EEASEEPVTPEFNL 278
           D            N++GK   +L      V+     + Y       +   E P +PE   
Sbjct: 305 DM-----------NLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQ 353

Query: 279 QGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWD 312
           Q      +     K +F   +VT   D  + +W+
Sbjct: 354 QKALKNYEKVAKRKGDFEELMVTASDDFTMYLWN 387

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 81/205 (39%), Gaps = 60/205 (29%)

Query: 36  HFQAHSLSVKCLDISK--RYLVSGSNDEHIRIY---------------DLQKRKELGTLL 78
           H ++    +  +D+S   + + +G  D  IRI+               D    + L ++ 
Sbjct: 12  HEESRDYEIYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMS 71

Query: 79  SHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFG-- 136
            H GS+T +KFS                    +  +L S SDD  L+IW + D EN G  
Sbjct: 72  RHTGSVTCVKFSP-------------------DGNYLASGSDDRILLIWAM-DEENHGGS 111

Query: 137 --------------TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKL 182
                          L  H + I D    P + I ++V  D S+ +WN +  +     +L
Sbjct: 112 FGSEGEKEHWTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGLNFE-----RL 166

Query: 183 KKYNQNGQFVRWC--GDSGEFFAVA 205
           K+++ +   V+      + ++FA A
Sbjct: 167 KRFDVHQSLVKGVIFDPANKYFATA 191

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 60/139 (43%), Gaps = 6/139 (4%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           P+     H+ SV C+  S    YL SGS+D  + I+ + +    G+  S +G        
Sbjct: 66  PLASMSRHTGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGS-EGEKEHWTVR 124

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
           K     D +  D        +S  L++   D ++++W   ++E       H S +     
Sbjct: 125 KRLVAHDNDIQDICWAP---DSSILVTVGLDRSVIVWNGLNFERLKRFDVHQSLVKGVIF 181

Query: 151 HPSNRIAISVSEDHSIRLW 169
            P+N+   + S+D ++R++
Sbjct: 182 DPANKYFATASDDRTMRVF 200

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 263 YDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVY 322
           +  E  +E  T    L  H N ++D  +  +     LVT+G D  ++VW+  N E++  +
Sbjct: 112 FGSEGEKEHWTVRKRLVAHDNDIQDICWAPD--SSILVTVGLDRSVIVWNGLNFERLKRF 169

Query: 323 DCGERL 328
           D  + L
Sbjct: 170 DVHQSL 175

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 108/287 (37%), Gaps = 39/287 (13%)

Query: 32  TPIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELG-TLLSHQGSITALK 88
           TP      H   V C+  S     + +GS D  IR++D +  K LG  L  H   IT+L 
Sbjct: 179 TPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLT 238

Query: 89  FSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDF 148
           +     +E             G+   L SAS D  + IW         TL GH + ++  
Sbjct: 239 WEPIHLVEP------------GSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCV 286

Query: 149 DIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLT 208
                  I  S S D ++R W++   K+ G    K  N       W          AL  
Sbjct: 287 KWG-GEGILYSGSHDKTVRAWDM---KQNG----KCINILKSHAHWVNHLSLSTDYALRV 338

Query: 209 KVLIY---KTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDE 265
               Y   K + AK  R+    K+     ++   +GK   ++   +   +MF    L++ 
Sbjct: 339 GAFDYTGVKPANAKEARD----KALQNYEKVARKNGKHEELMVTASDDFTMF----LWNP 390

Query: 266 EASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWD 312
               +P++    + GH   V    F  +  G Y+V+   D  I +WD
Sbjct: 391 LKGTKPIS---RMTGHQKLVNHVAFSPD--GKYIVSASFDNSIKLWD 432

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 54/139 (38%), Gaps = 21/139 (15%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           PI     H   V  +  S   +Y+VS S D  I+++D ++   L T   H  S+  + +S
Sbjct: 396 PISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAWS 455

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
              ++                   L+S S D  L +W VK  +    L GH   +   D 
Sbjct: 456 SDCRL-------------------LVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDW 496

Query: 151 HPSNRIAISVSEDHSIRLW 169
               +   S  +D  +RLW
Sbjct: 497 SVDGKRVCSGGKDKMMRLW 515

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 59/123 (47%), Gaps = 20/123 (16%)

Query: 54  LVSGSNDEHIRIYD-LQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           +V+ S+D  + +++ L+  K +  +  HQ  +  + FS                    + 
Sbjct: 376 MVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSP-------------------DG 416

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
           K+++SAS D+++ +W  K+     T +GH + +         R+ +S S+D ++++W++ 
Sbjct: 417 KYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVK 476

Query: 173 TVK 175
           T K
Sbjct: 477 TRK 479

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 40/94 (42%), Gaps = 19/94 (20%)

Query: 76  TLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENF 135
           +L  H G IT+L +    K+                   L+SAS D  L IW   D  N 
Sbjct: 141 SLDGHSGHITSLHYFPSGKV-------------------LLSASIDMQLKIWSAADGTNP 181

Query: 136 GTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
            TL GH + I    +    R  +S S+D S+RLW
Sbjct: 182 RTLFGHTAPITGCGLIERGRNVLSSSKDGSVRLW 215

>Kwal_27.12053
          Length = 755

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 60/146 (41%), Gaps = 25/146 (17%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           Y+ +GS+D+  R++D+     +   L H   +T+   S                    + 
Sbjct: 580 YVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSP-------------------DG 620

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHA-SRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           +WL + S+D  + +W +   +    ++GH  + +          + IS   DHS+R+W+ 
Sbjct: 621 RWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWD- 679

Query: 172 MTVKKAGVLKLKKYNQNGQFVRWCGD 197
             VKK+      +  Q   F  + GD
Sbjct: 680 --VKKSTAEPGSEPEQ--PFTGYSGD 701

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/293 (21%), Positives = 105/293 (35%), Gaps = 83/293 (28%)

Query: 52  RYLVSGSNDEHIRIYDLQ-------------KRKELGTLLSHQGSITALKFSKGTKIEDK 98
           R   +G  D  I+I+ L              +R    TL+ H G++ +  FS        
Sbjct: 440 RLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFSP------- 492

Query: 99  NEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAI 158
                       ++++L+SAS+D  + +W    + +    KGH   I D    P      
Sbjct: 493 ------------DNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFA 540

Query: 159 SVSEDHSIRLWNLMTVKK----AGVLK---LKKYNQNGQFV----------RWCGDSGEF 201
           + S D + RLW+   +      AG L       ++ NG +V           W   SG+ 
Sbjct: 541 TASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDS 600

Query: 202 FAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKS 261
             + L     +  T+ +   R L TG              +D ++  +  GT      K 
Sbjct: 601 VRLFLGHTAPVTSTAVSPDGRWLSTG-------------SEDGVINVWDIGT-----GKR 642

Query: 262 LYDEEASEEPVTPEFNLQGH-TNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
           L               ++GH  N V    + K   GH L++ G+D  + VWD+
Sbjct: 643 LK-------------QMRGHGKNAVYSLSYSKE--GHVLISGGADHSVRVWDV 680

 Score = 36.2 bits (82), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 49/114 (42%), Gaps = 9/114 (7%)

Query: 63  IRIYDLQKRKE---LGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISAS 119
           IR+ +LQ       + T  +    +T+L+FS   ++      D+ +        W +   
Sbjct: 406 IRLENLQSSAPSVCMYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKI------WSLDGE 459

Query: 120 DDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
              N +  +  +  N  TL GH+  +      P NR  +S SED ++RLW+  T
Sbjct: 460 PLKNKLPSKQGERTNNETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDT 513

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 22/97 (22%)

Query: 37  FQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSH-QGSITALKFSKGT 93
           F  H+  V    +S   R+L +GS D  I ++D+   K L  +  H + ++ +L +SK  
Sbjct: 604 FLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEG 663

Query: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVK 130
            +                   LIS   DH++ +W VK
Sbjct: 664 HV-------------------LISGGADHSVRVWDVK 681

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 9/76 (11%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSK 113
           + SGS D  I+ +D+  R+++ +  +H G+IT L  +    I+         +   GN  
Sbjct: 83  IASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNID---------SASSGNQN 133

Query: 114 WLISASDDHNLVIWRV 129
           +++S+SDD  + +W V
Sbjct: 134 FVLSSSDDKTVKLWSV 149

>Kwal_33.15475
          Length = 783

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 92/227 (40%), Gaps = 29/227 (12%)

Query: 124 LVIWRVKDWENFG---TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVL 180
           + +W+  D  + G   TLKGH + +      P   + +S SED  +RLW      +  + 
Sbjct: 35  IALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALK 94

Query: 181 KLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMR------- 233
            ++  + +   +          ++++++ +L    +   V   L     +I+        
Sbjct: 95  CVQVIDHHKHTIT---------SLSVISNILSVGCADGSVSLWLTENNQAILLHSFNLQT 145

Query: 234 ------MEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKD 287
                 M ++ ++G  Y++   G        + +L D   +   +  E  L+GH + VK 
Sbjct: 146 NVYPLCMALKLVEGDKYLLAIGGTNPRVFIYSFTLQDGTLNNFQLAAE--LEGHEDWVKA 203

Query: 288 FKFYKNEFGHYLVTIGS-DGKIVVWDMSNKEQVAVYDCGE-RLNCLA 332
             FY+   G+ L+  GS D  I +W +   E +   D  E +LN L 
Sbjct: 204 MDFYEESPGNMLLATGSQDRYIRLWRIRTNELIDNSDEDEFKLNLLG 250

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 19/42 (45%)

Query: 277 NLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQ 318
           N + HT  + D  +   EFGH  VT   D  I  W +S   Q
Sbjct: 640 NEKAHTRIIWDCDWAPTEFGHVFVTASRDKHIKAWKLSEDGQ 681

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 71/165 (43%), Gaps = 27/165 (16%)

Query: 32  TPIFHFQAHSLSVKCLDIS--KRYLVS---GSNDEHIRIYDLQKRKELGTLLSHQGSITA 86
           +PI  F  H  +VK +  S  KR +++   G+ D  ++I+++    ++  + S    I  
Sbjct: 418 SPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDS-GSQICN 476

Query: 87  LKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIN 146
           + +SK T     NE    L T  G SK+        NL +W     +    LKGH+ R+ 
Sbjct: 477 MVWSKNT-----NE----LVTSHGYSKY--------NLTLWDCNSMDPIAILKGHSFRVL 519

Query: 147 DFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGV----LKLKKYNQ 187
              +       +S + D ++R W L    KA V    L    +NQ
Sbjct: 520 HLTLSNDGTTVVSGAGDETLRYWKLFDKPKAKVQPNSLIFDAFNQ 564

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 66/154 (42%), Gaps = 28/154 (18%)

Query: 63  IRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDH 122
           I ++++   K +G L  H  ++T + +++  K+                   L+SASDD+
Sbjct: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKL-------------------LLSASDDN 345

Query: 123 NLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM---TVKKAGV 179
            L +WR  +        GH+  I        + I IS S D SIR+W+L    TV  A V
Sbjct: 346 TLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTI-ISTSMDGSIRVWSLASNSTVASATV 404

Query: 180 LKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIY 213
             +  +   G       D G+F    L  +V++Y
Sbjct: 405 DGVPNF--TGAL---SPDQGKFATGTLDGEVMVY 433

>Scas_680.11
          Length = 347

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 5/102 (4%)

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTV 174
           L S S D+   +W   + E  GTL GHA  I   D+       ++ S D+SI++W + T 
Sbjct: 25  LFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVETG 84

Query: 175 KKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTS 216
           +           +N  F   CG+    +  A+L  V+ Y  S
Sbjct: 85  ENVYSWDSPVPVKNVSFSP-CGN----YVAAVLDNVMKYPGS 121

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 66/151 (43%), Gaps = 44/151 (29%)

Query: 44  VKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNED 101
           V  LD+S   R++ SGS D  +R +++  + E      H G++ A+K+   T+I      
Sbjct: 106 VSALDVSDDFRHIYSGSYDGVVRTWNMSGKVE-KQYSGHTGAVKAVKYISNTRI------ 158

Query: 102 DTGLTTGRGNSKWLISASDDHNLVIWRVK--------------------DWENFGTLKGH 141
                         +SA +D +L +W+ K                    D +    L+GH
Sbjct: 159 --------------VSAGNDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGH 204

Query: 142 ASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
            + +   D+  ++RI +S S D+++ LW+ +
Sbjct: 205 KAPVVSLDVASNSRI-LSASYDNTVALWSTI 234

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 72/181 (39%), Gaps = 42/181 (23%)

Query: 36  HFQAHSLSVKCLD-ISKRYLVSGSNDEHIRIY--------------------DLQKRKEL 74
            +  H+ +VK +  IS   +VS  ND  +R++                    +++  K L
Sbjct: 139 QYSGHTGAVKAVKYISNTRIVSAGNDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTL 198

Query: 75  GTLLSHQGSITALKFSKGTKIEDKNEDDT---------GLTT-------GRGNSKWLISA 118
             L  H+  + +L  +  ++I   + D+T          +T           N+K   +A
Sbjct: 199 AILEGHKAPVVSLDVASNSRILSASYDNTVALWSTIYKEMTAIDHLEEIQNPNNKISTAA 258

Query: 119 SDDHNLVI--WRVKDWENFGTLKGHASRIND--FDIHPSNRIAISVSEDHSIRLWNLMTV 174
                L +    ++       L+ H   +    FD H  N +  SVS+DH+I+ W+L+T 
Sbjct: 259 KKRRKLTLKDGTIRRRAPLSLLESHTGPVEQVIFD-HGDNTVGYSVSQDHTIKTWDLVTA 317

Query: 175 K 175
           +
Sbjct: 318 R 318

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 61/153 (39%), Gaps = 26/153 (16%)

Query: 46  CLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGL 105
            +D   R +VS   D  I  YD  K   LG L      +T++ + +              
Sbjct: 515 AIDGMNRKMVSCGLDGLIGFYDFTKSAFLGKL-QLDAPVTSMVYHR-------------- 559

Query: 106 TTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHS 165
                +S     A DD ++V+      +    L GH++R+  FD  P  R  +S S D +
Sbjct: 560 -----SSDLFAVALDDLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWIVSASLDST 614

Query: 166 IRLWNLMT------VKKAGVLKLKKYNQNGQFV 192
           IR W+L T      V+   V    K++ NG  +
Sbjct: 615 IRTWDLPTGGCIDGVRLDSVATNLKFSPNGDLL 647

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 59/158 (37%), Gaps = 43/158 (27%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK--------GTKIEDK------- 98
           L SG ND  + +YD   R    ++  H+ ++ A+ +S         G    D+       
Sbjct: 474 LASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLKMWNV 533

Query: 99  ------NEDDTG--------------LTTGRGNSKWLISASDDHNLVIWRVKDWENFGTL 138
                 N+ DTG              + T  G SK+        NL IW   + E    L
Sbjct: 534 NTSVKLNDVDTGSQVCNMVWSTNTDEIVTSHGYSKY--------NLTIWEASNLEPLAIL 585

Query: 139 KGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK 176
           KGH+ R+    +       +S + D ++R W L   +K
Sbjct: 586 KGHSFRVLHLTLSADGTTIVSGAGDETLRYWKLFEKQK 623

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           L S S D +  +W   + E  GTL GH   I   D+    +  ++ S D+SI+LW++
Sbjct: 25  LFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDV 81

>Kwal_23.4118
          Length = 939

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 65/164 (39%), Gaps = 26/164 (15%)

Query: 35  FHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
           +     ++S   +D   R +VS   D  +  YD  K   LG L      +T++ + +   
Sbjct: 499 YRLHKKAVSGIAVDGMNRKMVSCGLDGIVGFYDFSKSSYLGKL-QLDAPVTSMVYHR--- 554

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
                           +S     A DD ++V+      +    L GH++RI+ FD  P  
Sbjct: 555 ----------------SSDLFALALDDFSIVVVDAVTQKVVRQLWGHSNRISSFDFSPDG 598

Query: 155 RIAISVSEDHSIRLWNLMT------VKKAGVLKLKKYNQNGQFV 192
           R  IS S D + R W+L T      ++   V    +++ N  FV
Sbjct: 599 RWIISTSLDGTARTWDLPTGCCIDGIRLDSVATNIRFSPNADFV 642

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 278 LQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
           L GH+NR+  F F  +  G ++++   DG    WD+
Sbjct: 582 LWGHSNRISSFDFSPD--GRWIISTSLDGTARTWDL 615

>KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomyces
           cerevisiae YDR128w, start by similarity
          Length = 1133

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 87/244 (35%), Gaps = 68/244 (27%)

Query: 107 TGRGNSKW------LISASDDHNLVIWRV-KDWENFGTLKGHASRINDFDIHPSNRIAI- 158
           +G    KW      +++ S  + + +W V K       L+GH+  +N  D +P N   I 
Sbjct: 159 SGAAQVKWNHKNSNVLATSHSNIVYVWDVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIM 218

Query: 159 SVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTA 218
           S   D +++ W+   V+    + +       +F  W G    F                 
Sbjct: 219 SSGNDGTVKFWDYNKVEDELQMTITT-----EFPVWRGRYLPF----------------- 256

Query: 219 KVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVT---PE 275
                                 G  Y ++    G  S++ A S +D   SE   T   P 
Sbjct: 257 ----------------------GDGYCIMPMIGGNNSVYLANSFHDSGNSESRTTKLQPT 294

Query: 276 FNLQGHTNRVKDFKFYK----------NEFGHYLVTIGSDGKIVVWDMSNKEQVAV-YDC 324
           +  +GHT+RV DF +             EF   LVT   D  + +W + +     V Y+C
Sbjct: 295 YVFKGHTDRVTDFLWRSRHSQNTIIDDREFQ--LVTWSKDCDLRLWPVPDMVYDKVHYEC 352

Query: 325 GERL 328
           G+ L
Sbjct: 353 GKEL 356

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 90/214 (42%), Gaps = 21/214 (9%)

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           + K+L + ++D  + IW ++  +    LKGH   I   D  PS    +S S D ++R+W+
Sbjct: 566 DGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 625

Query: 171 LMTVKKAGVLKLKKYNQNG-QFVRWCGDSGEFFAVALLTK-VLIYKTSTA------KVHR 222
           L    K G   L    ++G   V      G+F A   L + V ++ + T           
Sbjct: 626 L----KTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSEN 681

Query: 223 ELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPV--TPEFNLQG 280
           EL TG    +   +   DG + +V    + +V ++  +++    A  +P   T E    G
Sbjct: 682 ELGTGHKDSVYSVVFTRDG-NGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTG 740

Query: 281 HTNRVKDF--KFYKNEFGHYLVTIGSDGKIVVWD 312
           H    KDF       E   Y+++   D  ++ WD
Sbjct: 741 H----KDFVLSVATTEDDEYILSGSKDRGVLFWD 770

 Score = 36.2 bits (82), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 58/152 (38%), Gaps = 32/152 (21%)

Query: 34  IFHFQAHSLSVKCLD--ISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
           +   + H   +  LD   S   LVSGS D  +RI+DL K  +    LS +  +T +  S 
Sbjct: 590 VMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL-KTGQCTLTLSIEDGVTTVAVSP 648

Query: 92  GTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIW---------RVKDWENFGTLKGHA 142
                             G+ K++ + S D  + +W         R+      GT  GH 
Sbjct: 649 ------------------GDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGT--GHK 688

Query: 143 SRINDFDIHPSNRIAISVSEDHSIRLWNLMTV 174
             +            +S S D S++LWNL  V
Sbjct: 689 DSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNV 720

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/237 (19%), Positives = 95/237 (40%), Gaps = 43/237 (18%)

Query: 111 NSKWLISASDDHNLVIWRVKDWEN-------FGTLKGHASRINDFDI-------HPSNRI 156
           + +WL +AS D   ++W    W N       + T  GHA+ ++   +       +P  + 
Sbjct: 401 DGQWLATASKDKTAILWH---WNNTSKRFYIYATFVGHAASVSAVCLPNVMEKNYP--KY 455

Query: 157 AISVSEDHSIRLWNLMTVK----------KAGVLKLKKYNQNGQFVRWCGDSGEFFAVAL 206
            I+ S D +++ W +  +K          K+ +     + ++   +    +   F   + 
Sbjct: 456 IITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFATASY 515

Query: 207 LTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEE 266
                ++   T +    L   K  +   ++   + + +I    G+ TV ++         
Sbjct: 516 DKTCKLWNVDTGEPVATLANHKRGLW--DVSFCESEKWIATCSGDKTVKIW--------- 564

Query: 267 ASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYD 323
            S E  T    L+GHTN V+   F   +    LV+ G+DG I VWD+++ + +   D
Sbjct: 565 -SLESFTVLKTLEGHTNAVQRCSFMNKQ--KQLVSAGADGLIKVWDIASGDCIKNLD 618

 Score = 36.6 bits (83), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/120 (20%), Positives = 47/120 (39%), Gaps = 19/120 (15%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGR 109
           S++++ + S D+ ++I+ L+    L TL  H  ++    F                    
Sbjct: 548 SEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSF-------------------M 588

Query: 110 GNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
              K L+SA  D  + +W +   +    L GH++RI    +     + IS   D   + W
Sbjct: 589 NKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFW 648

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 23/142 (16%), Positives = 59/142 (41%), Gaps = 21/142 (14%)

Query: 34  IFHFQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
           I+   AH   +  + ++       + S D+  +++++   + + TL +H+  +  + F +
Sbjct: 488 IYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCE 547

Query: 92  GTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIH 151
                              + KW+ + S D  + IW ++ +    TL+GH + +      
Sbjct: 548 -------------------SEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFM 588

Query: 152 PSNRIAISVSEDHSIRLWNLMT 173
              +  +S   D  I++W++ +
Sbjct: 589 NKQKQLVSAGADGLIKVWDIAS 610

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 67/327 (20%), Positives = 127/327 (38%), Gaps = 53/327 (16%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSK 113
           L SG  +   +++DL  RK   T+  H  +I  + F+       KN+D   L        
Sbjct: 164 LGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFT-------KNDDKDVLN------- 209

Query: 114 WLISASDDHNLVIWRV----KDWENFGTLKGHAS-RINDFDIHPSNRIAISVSEDHSIRL 168
            LI+   D+ L +WR     K  +   T+  H       F  H     A +   D    +
Sbjct: 210 -LITGGRDNVLNLWRFNIKGKSSKLVKTIPAHLQIEACGFITHNDETFAYTAGGD---AV 265

Query: 169 WNLMTVKKAGVLKLKKYNQNGQFVRWC---GDSGEFFAVALLTKVLIYKTSTAKVHRELD 225
           + ++ + ++ V+K  K      F+          +F+AV     + + + ++     E+ 
Sbjct: 266 FQIIDLNESSVVKCTKKPIEELFITGVIPINQGNQFYAVLSDQTIQLLQPNS-----EIF 320

Query: 226 TGKSSIMRMEIENIDG--------------KDYIVLAFGNGTVSMFPAKSLYDEEASEEP 271
           + KS  ++++ E I G              KD I LA  + ++ + P   + D +  +  
Sbjct: 321 SSKSEFIQIQ-EYIAGNHGTVADLCLVTKNKDCIALATNSPSLRIIPLPKI-DADTQDTD 378

Query: 272 VTPEFNL-QGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQ---VAVYDCGER 327
           +  E NL +GH++ +        E G +L T   D   ++W  +N  +   +     G  
Sbjct: 379 LPIEVNLYEGHSDLLNSLAC--TEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHA 436

Query: 328 LNCLALCDESVEKYEMMKKRVAEEADL 354
            +  A+C  +V +    K  +    DL
Sbjct: 437 ASVSAVCLPNVMEKNYPKYIITASNDL 463

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 61/173 (35%), Gaps = 47/173 (27%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS---------------KGTKIEDK 98
           L SG ND  + +YD   RK    L  H  ++ A+ +S               K  KI + 
Sbjct: 389 LASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWSPHKRGILATGGGTADKKMKIWNV 448

Query: 99  NED------DTG--------------LTTGRGNSKWLISASDDHNLVIWRVKDWENFGTL 138
           N        DTG              L T  G S++        NL +W     E    L
Sbjct: 449 NTSTKLRDIDTGSQVCNMIWSKNTNELVTSHGYSRY--------NLTLWDYPSMEPVAIL 500

Query: 139 KGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK----AGVLKLKKYNQ 187
           KGH+ R+    +       +S + D ++R W L    K     G   L  +NQ
Sbjct: 501 KGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFDRPKPKAQPGSALLNAFNQ 553

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 108/301 (35%), Gaps = 56/301 (18%)

Query: 37  FQAHSLSVKCLDIS--KRYLVSGSNDEHIRIY--DLQKRKELGTLLSHQGSITALKFSKG 92
            QAH  +V  +  S    +++SG  D  I+I+  +    KE+    +H  SI  + FS  
Sbjct: 131 MQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKEIDA--AHTESIRDMAFS-- 186

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
                             N    ++ SDD+ L IW   + +    L GH   +   D HP
Sbjct: 187 -----------------SNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHP 229

Query: 153 SNRIAISVSEDHSIRLWNLMTVKK-AGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVL 211
              +  S S+D+ ++LW+  +    + +LK K      +F    G+             L
Sbjct: 230 EMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGN-------------L 276

Query: 212 IYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYD------- 264
           +   S  K  R  D   S    M +   D  DY+ L +     SMF   + YD       
Sbjct: 277 LMAISKDKSCRVFDIRYSMKELMCVR--DETDYMTLEWHPINESMF-TLACYDGSLKHFD 333

Query: 265 --EEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVY 322
             +  +E  +T  +    H   +    +  N  GH   T   D  I  W  +       Y
Sbjct: 334 LLQNLNEPILTIPY---AHDKCITSLSY--NPVGHIFATAAKDRTIRFWTRARPIDPNAY 388

Query: 323 D 323
           D
Sbjct: 389 D 389

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 93/237 (39%), Gaps = 34/237 (14%)

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTV 174
           L + S D +  +W   + E  GTL GH   I   D   ++   ++ S D++I++W LM  
Sbjct: 25  LFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNG 84

Query: 175 KKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTA--KVHRELDTGK-SSI 231
           +           +  +F   CG     + +A+L  V+    S    +V R  +T + +  
Sbjct: 85  QCVQTWNCPVPVKRVEFSP-CGK----YILAILDNVMKKPGSIEIYEVKRNPETNEITEF 139

Query: 232 MRMEIENI---DGKD------------YIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEF 276
           +   I +I   +G D            YI+    +G +S +  +  Y    S+       
Sbjct: 140 VEEPIHSIVTHEGLDAASVAGWSGEGKYIIAGHKDGKISKYDTQDGYKLVESQ------- 192

Query: 277 NLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERLNCLAL 333
             Q H + V D +F  +    Y +T   D    + D+   + +  Y+    LN  A+
Sbjct: 193 --QVHKDSVSDLQFSPDRT--YFITCSRDSNAHIIDIETFKVLKTYETDSPLNSAAI 245

>Scas_629.12
          Length = 671

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 89/197 (45%), Gaps = 10/197 (5%)

Query: 34  IFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
           + H   HS  V C+  S   ++L +G N +  +IY +   + +  L     S+T+   S 
Sbjct: 321 LHHSLNHSSVVCCVKFSNDGQFLATGCN-KTTQIYRVSDGELIAKL--SDDSVTSPDTSS 377

Query: 92  GTKIEDKNEDDTGLTTG-RGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
            T     + D    +     + ++L + ++D  + IW +++ +    LKGH   +   D 
Sbjct: 378 ATSGSTPSTDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDY 437

Query: 151 HPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTK- 209
            P+    +S S D ++R+W+L T + +  L ++        V    + G+F A   L + 
Sbjct: 438 FPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIE---YGVTTVAVSPNDGKFIAAGSLDRA 494

Query: 210 VLIYKTSTAKVHRELDT 226
           V ++ ++T  +   LD+
Sbjct: 495 VRVWDSTTGFLVERLDS 511

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 111/301 (36%), Gaps = 56/301 (18%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIY--DLQKRKELGTLLSHQGSITALKFSKG 92
            QAH  SV  +  S    +++SG  D  I+I+  +    KEL  +  H   I  + FS  
Sbjct: 120 MQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPNFNMVKELDRI--HTEGIRDVAFS-- 175

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
                             N    ++ SDD+ L IW   + +    L GH   +   D HP
Sbjct: 176 -----------------NNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHP 218

Query: 153 SNRIAISVSEDHSIRLWNLMTVKKAG--VLKLKKYNQNGQFVRWCGDSGEFFAVALLTKV 210
              + +S S+D+ ++LW+     ++G  V  L K+       R+    G   A       
Sbjct: 219 ELGLIVSGSKDNLVKLWD----PRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAA------ 268

Query: 211 LIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYD------ 264
            I K  + +V  +L    + +M +     D  D++ L +     SMF     YD      
Sbjct: 269 -ISKDKSCRVF-DLRASMNELMCVR----DEVDFMELEWSTINESMF-TVGCYDGSLKHF 321

Query: 265 --EEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVY 322
              + +E+P+        H   +    +  N  GH L T   D  I  W  +       +
Sbjct: 322 DLGQDTEKPI--HIIPFAHEKCISAIAY--NPVGHILATAAKDRTIRFWTRARPVDPNAF 377

Query: 323 D 323
           D
Sbjct: 378 D 378

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 61/144 (42%), Gaps = 25/144 (17%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDD----------- 102
           +V+ + D  I+I+D+     L T   H  S+T+++F+K  +I   +  D           
Sbjct: 371 IVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRF 430

Query: 103 ----TGLTTGRGNSKWLIS----------ASDDHNLVIWRVKDWENFGTLKGHASRINDF 148
               T   T R     L +          + D++++ +W V+  +   TL GH   ++  
Sbjct: 431 RNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCL 490

Query: 149 DIHPSNRIAISVSEDHSIRLWNLM 172
                N I  S S D +IR+W++ 
Sbjct: 491 SFSRENSILASASWDKTIRVWSIF 514

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 9/77 (11%)

Query: 247 LAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDG 306
           LAFG+ T+       L  E  SE  +  +   QGH + +    +  +  G  +VT   DG
Sbjct: 328 LAFGSSTLGQL----LVYEWQSESYILKQ---QGHFDALNALAYSPD--GARIVTAAEDG 378

Query: 307 KIVVWDMSNKEQVAVYD 323
           KI +WD+ +   +A ++
Sbjct: 379 KIKIWDIVSGFCLATFE 395

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 66/154 (42%), Gaps = 38/154 (24%)

Query: 38  QAHSLSVKCLDISKRY---LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
           +AH   + CLD    +     +GS D  ++++DL K+K++ TL  H  SI+ ++  + + 
Sbjct: 394 KAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYS- 452

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIND-----FD 149
                   T +T GR           D  L +W +   +       ++S  ND     FD
Sbjct: 453 --------TLITGGR-----------DAVLKLWDID--KAMADEASNSSEDNDACLYTFD 491

Query: 150 IHPSNRIAISV--------SEDHSIRLWNLMTVK 175
            H     AIS         S+D ++R W+L + K
Sbjct: 492 SHVDEITAISFDGDNLVSGSQDRTVRQWDLNSGK 525

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 59/150 (39%), Gaps = 20/150 (13%)

Query: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93
           ++ F +H   +  +      LVSGS D  +R +DL   K   T+         + F+ G 
Sbjct: 487 LYTFDSHVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQTI--------DISFATGP 538

Query: 94  KIEDKN----------EDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHAS 143
               +N          ++   +   +     L + + D  + +W ++  +    L+GH  
Sbjct: 539 MRSQRNIPLRNSVLLTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKVVRMLEGHTD 598

Query: 144 RINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
            I        N +  ++  D SIR+W+L T
Sbjct: 599 AITSLQFDSVNLVTGAM--DRSIRIWDLRT 626

>Scas_720.95
          Length = 515

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 60/123 (48%), Gaps = 20/123 (16%)

Query: 54  LVSGSNDEHIRIYD-LQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           +V+ S+D  + +++ L+  K +  +  HQ  +  + FS                    + 
Sbjct: 374 MVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSP-------------------DG 414

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
           ++++SAS D+++ +W  +D +   T +GH + +         R+ +S S+D ++++W++ 
Sbjct: 415 RYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVR 474

Query: 173 TVK 175
           T K
Sbjct: 475 TRK 477

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 118/296 (39%), Gaps = 37/296 (12%)

Query: 32  TPIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELG-TLLSHQGSITALK 88
           TP      H   V C+        + +GS D  IR++D +  K LG  L  H   IT+L 
Sbjct: 177 TPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLA 236

Query: 89  FSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDF 148
           +     ++             G S  L SAS D  + IW +       T+ GH + ++  
Sbjct: 237 WEPIHLVKP------------GESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCI 284

Query: 149 DIHPSNRIAISVSEDHSIRLWNLMTVKKA-GVLKLKKYNQNGQFVRWCGDSGEFFAVALL 207
                  I  S S D ++R+W++    K   +LK      +  +V     S ++   AL 
Sbjct: 285 KWS-GQGIIYSGSHDKTVRVWDMNADGKCINILK-----SHAHWVNHLSLSTDY---AL- 334

Query: 208 TKVLIYKTSTAKVHRELDTGKSSIMRME-IENIDGKDYIVLAFGNGTVSMFPAKSLYDEE 266
            +V  +  + A+     D    ++   E +   +GK   ++   +   +MF    L++  
Sbjct: 335 -RVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMF----LWNPL 389

Query: 267 ASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVY 322
            S +P+     + GH   V    F  +  G Y+V+   D  I +WD  + + ++ +
Sbjct: 390 KSNKPIA---RMTGHQKLVNHVAFSPD--GRYIVSASFDNSIKLWDGRDGKFISTF 440

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 54/140 (38%), Gaps = 21/140 (15%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           PI     H   V  +  S   RY+VS S D  I+++D +  K + T   H  S+  + +S
Sbjct: 394 PIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWS 453

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
              ++                   L+S S D  L +W V+  +    L GH   +   D 
Sbjct: 454 ADCRL-------------------LVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDW 494

Query: 151 HPSNRIAISVSEDHSIRLWN 170
               +   S  +D  +R+W 
Sbjct: 495 SVDGKRVCSGGKDKMVRIWT 514

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 62/152 (40%), Gaps = 31/152 (20%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSK 113
           +V+G+ D   RI+D   +    TL  H   +  + +                     N +
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCP-------------------NGE 199

Query: 114 WLISASDDHNLVIWRVKDWENFG-TLKGHASRINDFDIHP--------SNRIAISVSEDH 164
            + + S D+ + +W  KD +  G  L+GH   I      P        S R+A S S+D 
Sbjct: 200 VIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLA-SASKDG 258

Query: 165 SIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG 196
           +IR+W++   ++  +  +  +  +   ++W G
Sbjct: 259 TIRIWDI--TRRVCLYTMSGHTNSVSCIKWSG 288

>Scas_397.2
          Length = 410

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 50/117 (42%), Gaps = 20/117 (17%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           Y+V G+ +  I +YD Q   E     +H   IT LKF    ++                 
Sbjct: 112 YIV-GNEEGSISLYDSQFSHEWTQEDAHCSEITTLKFFPSGEV----------------- 153

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
             ++S S D  L +W +KD       +GH S+I D  +    R  +S S D +++LW
Sbjct: 154 --VLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLW 208

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 61/138 (44%), Gaps = 25/138 (18%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLL--SHQGSITALKFSKG 92
            QAH  +V  ++ S    +L+SG +D  I+I+  Q    +  +L  +H   +  + FS  
Sbjct: 119 MQAHDSAVTTMEYSHAGDWLISGDSDGIIKIW--QPNFNMVKVLDQAHMECVRDVSFS-- 174

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
                            G     ++ SDD+ L IW   + +    L GH   +   D HP
Sbjct: 175 -----------------GTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHP 217

Query: 153 SNRIAISVSEDHSIRLWN 170
           +  + +S S+D+ I+LW+
Sbjct: 218 TMGLIVSGSKDNLIKLWD 235

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 62/167 (37%), Gaps = 36/167 (21%)

Query: 37  FQAHSLSVKCLD--ISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS---- 90
              H   VK  D   +   +VSGS D  I+++D +  + + T+L  + +I   KF     
Sbjct: 203 LSGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKFQPTKG 262

Query: 91  ---------KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLK-- 139
                    K  KI D  ++   L + R  S ++       N  I+ V  ++  G+LK  
Sbjct: 263 NLLAVVAKDKSCKIFDIRQNMKELKSFRDESDYMSLTWHPINESIFTVGCYD--GSLKHF 320

Query: 140 -----------------GHASRINDFDIHPSNRIAISVSEDHSIRLW 169
                             H   I     +P   I  S S+D +IR W
Sbjct: 321 DLLQDTGSSNSFHDIPYAHDKCITSLSYNPVGHILASASKDRTIRFW 367

 Score = 29.3 bits (64), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 8/71 (11%)

Query: 114 WLISASDDHNLVIWRVKDWENFGTLK----GHASRINDFDIHPSNRIAISVSEDHSIRLW 169
           WLIS   D  + IW+     NF  +K     H   + D     ++   ++ S+D+ +++W
Sbjct: 137 WLISGDSDGIIKIWQ----PNFNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIW 192

Query: 170 NLMTVKKAGVL 180
           N    ++  VL
Sbjct: 193 NFSNGQQERVL 203

>Scas_603.5
          Length = 589

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 13/78 (16%)

Query: 43  SVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDD 102
           +V+ L      L +GS D  IR++DL+  K + TLL HQG IT+L+F           D 
Sbjct: 443 TVEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQF-----------DS 491

Query: 103 TGLTTGRGNSKWLISASD 120
           T + TG  ++   IS SD
Sbjct: 492 TKIITGSTDAN--ISVSD 507

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 59/144 (40%), Gaps = 32/144 (22%)

Query: 43  SVKCLDI---SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKN 99
           +V CLD    +K    +G  +  I+++DL+   ++  L  H  S+T ++           
Sbjct: 296 TVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQL---------- 345

Query: 100 EDDTGLTTGRGNSKWLISASDDHNLVIWR--VKDWENFGTLKGHASRINDFDIHPS---- 153
                      +SK LI+ S D  L +W   +    +  +     S IN F+ H +    
Sbjct: 346 ---------HPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITS 396

Query: 154 ----NRIAISVSEDHSIRLWNLMT 173
               N   +S S D SIR W+L T
Sbjct: 397 VSYDNEYLLSASRDKSIRQWDLTT 420

 Score = 35.4 bits (80), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 50/106 (47%), Gaps = 19/106 (17%)

Query: 67  DLQKRKELGTLLS-HQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLV 125
           DL+    LGTL S +  ++T L F   TK+          T G+ N+          ++ 
Sbjct: 279 DLKSGSHLGTLDSVYTDTVTCLDFDLSTKML--------YTAGKYNT----------SIK 320

Query: 126 IWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           +W ++  +    L  H + +    +HP ++  I+ S+D +++LW+L
Sbjct: 321 VWDLETNDQVMDLDDHIASVTCMQLHPDSKTLITGSKDATLKLWDL 366

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 60/137 (43%), Gaps = 13/137 (9%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
           F+AH+  +  +     YL+S S D+ IR +DL     + TL +       L  + GT I+
Sbjct: 387 FEAHTAEITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEA------TLSHNSGTNIK 440

Query: 97  DKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRI 156
                D+ +   +     L + S D  + +W ++  +   TL  H   I       S +I
Sbjct: 441 -----DSTVEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQF-DSTKI 494

Query: 157 AISVSEDHSIRLWNLMT 173
            I+ S D +I + +L T
Sbjct: 495 -ITGSTDANISVSDLRT 510

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 49/117 (41%), Gaps = 19/117 (16%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           Y+ +G+    + +++L     +  L  H+GSI     S          DD  L       
Sbjct: 153 YVCAGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVS----------DDGRLVA----- 197

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
               S SDD ++ +W ++  E  G   GH +RI D          +SVSED + R+W
Sbjct: 198 ----SCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVW 250

 Score = 36.2 bits (82), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 65/159 (40%), Gaps = 40/159 (25%)

Query: 37  FQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
            + H  S+ C  +S   R + S S+D  IR++ L+  +++G    H   I  L+F    +
Sbjct: 177 LEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRF---LR 233

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIND---FDIH 151
           + DK                L+S S+D    +W V            A R+ +   +D+H
Sbjct: 234 VADK----------------LVSVSEDCTCRVWAVG-----------AERMQEEAVYDVH 266

Query: 152 PSNRI-AISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNG 189
            +  + A+ V ED  +     +T    G L+L    + G
Sbjct: 267 QTKSVWAVDVQEDDMVA----VTAGNDGRLRLVDLTRPG 301

 Score = 36.2 bits (82), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 36/70 (51%)

Query: 110 GNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
           G++ ++ + +    +V+W +        L+GH   I    +    R+  S S+D SIR+W
Sbjct: 149 GDAVYVCAGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVW 208

Query: 170 NLMTVKKAGV 179
           +L T ++ G+
Sbjct: 209 SLETGEQVGI 218

 Score = 29.6 bits (65), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 298 YLVTIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDESVEKYEMMKK 346
           YL+   +DG +VVWDM+     AV D  ++L   A+ +  + +  ++ K
Sbjct: 798 YLLVSATDGHLVVWDMAPVMPFAVEDQLQQLEGAAMAETKLPEPSVLLK 846

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 19/133 (14%)

Query: 40  HSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKN 99
           +S S+K +  S+  + +G+      ++DL K + +  L  H+GSI  ++ S+  K+    
Sbjct: 138 YSGSIKVISESEVQINAGTVMGGAIVWDLYKEELIHNLTGHEGSIFYIQSSEHNKL---- 193

Query: 100 EDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAIS 159
                          + S SDD ++ +W  +  +       H +RI +     ++   +S
Sbjct: 194 ---------------IASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDENLVS 238

Query: 160 VSEDHSIRLWNLM 172
           VSED + R+WN++
Sbjct: 239 VSEDCTCRVWNII 251

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 8/76 (10%)

Query: 125 VIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK-------- 176
           ++W +   E    L GH   I        N++  S S+D SIRLW+  T K+        
Sbjct: 162 IVWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKELSIGWSHT 221

Query: 177 AGVLKLKKYNQNGQFV 192
           A +  LK +N +   V
Sbjct: 222 ARIWNLKFFNNDENLV 237

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 60/166 (36%), Gaps = 43/166 (25%)

Query: 48  DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK--------GTKIEDK- 98
           ++ +  L SG ND  + +YD   +K +     H  ++ A+ +S         G    D+ 
Sbjct: 379 NVDENRLASGGNDNVVYVYDGPSKKPVLKFTEHNAAVKAMAWSPHRRATLATGGGTADRR 438

Query: 99  ------------NEDDTG--------------LTTGRGNSKWLISASDDHNLVIWRVKDW 132
                       N+ DTG              + T  G SK+        NL +W     
Sbjct: 439 LKIWNVNSGVRLNDVDTGSQVCNMVWSKNTDEIVTSHGYSKF--------NLTLWDCPTL 490

Query: 133 ENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAG 178
           E    LKGH+ R+    +       +S + D ++R W L    K G
Sbjct: 491 EPLAVLKGHSFRVLHLTLSTDGTTIVSGAGDETLRYWKLFGKSKFG 536

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 62/143 (43%), Gaps = 42/143 (29%)

Query: 67  DLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVI 126
           DLQ    L ++  H GSIT +KFS                    + K+L S SDD  L+I
Sbjct: 67  DLQM--PLCSMSRHTGSITCVKFSP-------------------DGKYLASGSDDRILLI 105

Query: 127 WRVKDWEN----FGT------------LKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           W + + ++    FG+            L  H + I D    P + I ++V  D S+ +WN
Sbjct: 106 WALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWN 165

Query: 171 LMTVKKAGVLKLKKYNQNGQFVR 193
             T +     KLK+++ +   V+
Sbjct: 166 GSTFE-----KLKRFDVHQSLVK 183

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 27/139 (19%), Positives = 57/139 (41%), Gaps = 5/139 (3%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           P+     H+ S+ C+  S   +YL SGS+D  + I+ L + +        +         
Sbjct: 71  PLCSMSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVR 130

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
           K     D +  D        +S  L++   D ++++W    +E       H S +     
Sbjct: 131 KRLVAHDNDIQDICWAP---DSSILVTVGLDRSVIVWNGSTFEKLKRFDVHQSLVKGVVF 187

Query: 151 HPSNRIAISVSEDHSIRLW 169
            P+N+   + S+D +++++
Sbjct: 188 DPANKYFATTSDDRTMKIF 206

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 12/75 (16%)

Query: 264 DEEASEEPV----------TPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
           DEE S +P           T    L  H N ++D  +  +     LVT+G D  ++VW+ 
Sbjct: 109 DEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQDICWAPD--SSILVTVGLDRSVIVWNG 166

Query: 314 SNKEQVAVYDCGERL 328
           S  E++  +D  + L
Sbjct: 167 STFEKLKRFDVHQSL 181

>Kwal_34.15818
          Length = 349

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 87/238 (36%), Gaps = 39/238 (16%)

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTV 174
           + + + D+   +W   + E  GT +GH   I   D+    + A++ S D SI+LW +   
Sbjct: 25  IFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQYAVTGSADFSIKLWKVQDG 84

Query: 175 KKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRM 234
                 K K   +  QF    GD      +A+L  V+ Y  S        D     I+ +
Sbjct: 85  TNVFTWKTKTPVRRVQFSP-SGDK----ILAVLDGVMGYPGSVTVYTVRRDPETKDIVDI 139

Query: 235 EIE---NIDGKD---------------YIVLAFGNGTVSMFPAKS-LYDEEASEEPVTPE 275
             E   NI  ++               YIV    +G VS +   S  Y + A+       
Sbjct: 140 SEEPTFNILTREGFEIAAVAAWSFNDTYIVAGHKDGRVSKYEGHSGEYIDSAAL------ 193

Query: 276 FNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVY--DCGERLNCL 331
                HT  V D +F  +  G Y +T   D    + D    E +  Y  DC     C+
Sbjct: 194 -----HTQNVSDIQFSPD--GTYFITSSRDSAAKLVDTETLEVLKTYETDCPLNSACI 244

>CAGL0L09757g complement(1046898..1047878) highly similar to
           sp|P36104 Saccharomyces cerevisiae YKL018w, start by
           similarity
          Length = 326

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/277 (20%), Positives = 109/277 (39%), Gaps = 43/277 (15%)

Query: 46  CLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGL 105
           C D   ++L++ S  + + +YD    + L T+ S +    A KF+               
Sbjct: 33  CFDDHGQHLLASSASDTMHLYDSVGCRFLNTIASKKYGCHAAKFT--------------- 77

Query: 106 TTGRGNSKWLISAS-DDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDH 164
                 S+ + S++    ++    ++  +      GH + ++D  + P N   +S S D 
Sbjct: 78  ---HAQSECIYSSTMKTFDIRHLNLETNQYLRYFVGHGALVSDIQMSPINDSFLSASYDE 134

Query: 165 SIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALL--TKVLIYKTSTAK--- 219
           S+R+W+L T K   ++     N           SG  FA+      ++ +Y     K   
Sbjct: 135 SVRVWDLRTSKAQAIIPTVVPNCIAY-----DPSGLVFALGNPESNEIGLYNVRQLKNGP 189

Query: 220 -VHRELDTGKSSIMRMEIENIDGKDYIVLAFGNG---TVSMFPAKSLYDEEASEEPVTPE 275
            +  +++ G     ++E  N DGK YI+LA   G    +  F  + L++   ++     E
Sbjct: 190 FLVIKVEQGFKQWNKLEFSN-DGK-YILLASSYGKQLILDAFTGEQLFELVGTKPFPLRE 247

Query: 276 FNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWD 312
           F   G      D        G + +    DGKI +W+
Sbjct: 248 FMDSGSACFTPD--------GQFTLATDYDGKIAIWN 276

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 93/209 (44%), Gaps = 15/209 (7%)

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
           K+L + ++D  + IW +++ +    L+GH   I   D  PS    +S S D ++R+W+L 
Sbjct: 456 KFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 515

Query: 173 TVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTK-VLIYKTSTAKVHRELD------ 225
           T + +  L ++        V      G++ A   L + V ++ + T  +   LD      
Sbjct: 516 TGQCSLTLSIE---DGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESG 572

Query: 226 TGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPV--TPEFNLQGHTN 283
           TG    +   +   DG+  +V    + +V ++  ++  ++  S+ P   T E    GH +
Sbjct: 573 TGHKDSVYSVVFTRDGQS-VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKD 631

Query: 284 RVKDFKFYKNEFGHYLVTIGSDGKIVVWD 312
            V      +N+   Y+++   D  ++ WD
Sbjct: 632 FVLSVATTQND--EYILSGSKDRGVLFWD 658

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 62/152 (40%), Gaps = 38/152 (25%)

Query: 34  IFHFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
           +   Q H   +  LD   S   LVSGS D  +RI+DL+         + Q S+T      
Sbjct: 478 VMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR---------TGQCSLT------ 522

Query: 92  GTKIEDKNEDDTGLTT---GRGNSKWLISASDDHNLVIW---------RVKDWENFGTLK 139
              IED      G+TT     G+ K++ + S D  + +W         R+      GT  
Sbjct: 523 -LSIED------GVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGT-- 573

Query: 140 GHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           GH   +         +  +S S D S++LWNL
Sbjct: 574 GHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNL 605

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 111/298 (37%), Gaps = 48/298 (16%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
            QAH  +V  +  S    ++VSGS D  ++I+              Q +   +K      
Sbjct: 119 MQAHDSAVTVMTYSHTGDWMVSGSADGELKIW--------------QPNFNMVKVMDQAH 164

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
           +E   E     T  +      +S SDD+ L IW   + +    L GH   +   D HP  
Sbjct: 165 MECVREISFSPTDQK-----FVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKM 219

Query: 155 RIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYK 214
            + +S S+D+ I+ W+  +   + V  +  +       ++    G   +V       I K
Sbjct: 220 GLIVSGSKDNLIKFWDPRS--GSCVSTMLGFKHTIISTKFQPKQGNLLSV-------ISK 270

Query: 215 TSTAKVH------RELDTGKSSI--MRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEE 266
             T KV+      +EL + +  +  M ++   ID   + V  + +G++  F      D  
Sbjct: 271 DKTCKVYDIRQQAKELFSVRDDVDYMTLQWHPIDETVFTVGCY-DGSIKHF------DLS 323

Query: 267 ASEEPVTPEFNLQ-GHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYD 323
              +P  P  N+   H   V    +  +  GH + +   D  I  W  S       +D
Sbjct: 324 QENQPNKPTHNIPYAHEKCVTSLAY--SPIGHIMASASKDRTIRFWTRSRAVDPNAFD 379

>ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH]
           complement(165316..166389) [1074 bp, 357 aa]
          Length = 357

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/277 (22%), Positives = 106/277 (38%), Gaps = 41/277 (14%)

Query: 47  LDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLT 106
            D   +YL+S +  +++ +YD    + L T+ S +    A KF             T   
Sbjct: 64  FDDHGQYLLSATACDNMHLYDAAGCRFLNTVASKKYGCHAAKF-------------THAQ 110

Query: 107 TGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSI 166
           +    S  +IS    H      ++  +     +GH + ++D  + P +   +S S D S+
Sbjct: 111 SECVYSSTMISFDIRH----LNLETNQYLRYFQGHEALVSDLAMSPLDDTFLSASYDESV 166

Query: 167 RLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALL--TKVLIYKTSTAKVHR-- 222
           RLW+L T K   ++     N           SG  FA+      ++ +Y     K     
Sbjct: 167 RLWDLRTSKAQAIVPSVVPNSVAY-----DPSGLVFALGNPESQEIGLYNVRQLKAGPFM 221

Query: 223 --ELDTGKSSIMRMEIENIDGKDYIVLAFGNG---TVSMFPAKSLYDEEASEEPVTPEFN 277
             ++D   S   +ME  N DG+ Y++LA   G    +  F    L++   ++     EF 
Sbjct: 222 VVKVDPRFSQWTKMEFSN-DGR-YLLLASSAGRQLILDAFDGAQLFELTGTKPFPLREFM 279

Query: 278 LQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMS 314
             G      D        G Y +    DG+I  W+ S
Sbjct: 280 DAGSACFTPD--------GRYTLGTDYDGRIAFWNHS 308

>Scas_692.29
          Length = 456

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 64/150 (42%), Gaps = 43/150 (28%)

Query: 44  VKCLDIS--KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNED 101
           +  +D+S  K+ +++ S D  IR ++L  + +      H G I A+KF   T+       
Sbjct: 106 ISSIDVSQDKKAIITASYDGVIRTWNLSGKVQ-KQYSGHSGPIRAVKFISDTR------- 157

Query: 102 DTGLTTGRGNSKWLISASDDHNLVIWRVK-------------------DWENFGTLKGHA 142
                        L+SA +D  L +W+ K                   D +    L+GH 
Sbjct: 158 -------------LVSAGNDRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAILEGHK 204

Query: 143 SRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
           + +   D+  ++RI +S S D+SI LW+ +
Sbjct: 205 APVVSLDVSNTSRI-LSSSYDNSIGLWSTI 233

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 74/180 (41%), Gaps = 41/180 (22%)

Query: 36  HFQAHSLSVKCLD-ISKRYLVSGSNDEHIRIY-------------------DLQKRKELG 75
            +  HS  ++ +  IS   LVS  ND  +R++                   +++  K L 
Sbjct: 139 QYSGHSGPIRAVKFISDTRLVSAGNDRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLA 198

Query: 76  TLLSHQGSITALKFSKGTKIEDKNEDDT-GLTT---------------GRGNSKWLISAS 119
            L  H+  + +L  S  ++I   + D++ GL +                  ++K   +A 
Sbjct: 199 ILEGHKAPVVSLDVSNTSRILSSSYDNSIGLWSTIYKEMTVVDPMEEINNADNKISTAAR 258

Query: 120 DDHNLVI--WRVKDWENFGTLKGHASRIND--FDIHPSNRIAISVSEDHSIRLWNLMTVK 175
               L +    ++       L+ H + +    FDI+  + +  SVS+DH+I+ W+L+T +
Sbjct: 259 KRRKLTLKDGTIRRRAPLSLLESHTAPVEQASFDIN-DDTVGYSVSQDHTIKTWDLVTAR 317

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 114/295 (38%), Gaps = 41/295 (13%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLL--SHQGSITALKFSKG 92
            QAH  +V  +  S    +L+SG  D  I+I+  Q    +  +L  +H   +  + FS  
Sbjct: 117 MQAHDSAVTVMQYSHAGDWLISGDADGTIKIW--QPNFNMVKVLDRAHTECMRDISFSYS 174

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
            +                     ++ SDD+ L IW   + +    L GH   +   D HP
Sbjct: 175 DQK-------------------FVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHP 215

Query: 153 SNRIAISVSEDHSIRLWNLMTVKKAG-VLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVL 211
              + +S S+D+ I+LW+  T +    +L LK      +F    G+      +A+++K  
Sbjct: 216 KMGLIVSGSKDNLIKLWDPRTGRNVSTILGLKHTVIKTKFQPTQGN-----LLAVVSKDK 270

Query: 212 IYKTSTAKVH-RELDTGKSSI--MRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEAS 268
             K    + H REL T +  +  M +    I+   + V  + NG +  F    L+D   S
Sbjct: 271 SIKIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCY-NGAIKHF--DLLHDNSNS 327

Query: 269 EEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYD 323
               TP  +   + +         +  GH L +   D  I  W  S       +D
Sbjct: 328 ----TPACHTIPYAHEKSVTSLAYSPVGHILASAAKDRTIRFWARSRPVDPNAFD 378

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/274 (21%), Positives = 114/274 (41%), Gaps = 44/274 (16%)

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWEN---FGTLKGHASRIN 146
           +K T++ D  E    +  G G +           + +W+  D  +   F TLKGH + + 
Sbjct: 12  NKQTQVSDLEETTKVVAYGAGKT-----------IALWKSMDTSHHGVFKTLKGHTAEVT 60

Query: 147 DFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVAL 206
                    + +S SED  +R+WN   +++  + +++      Q ++    +   FAV  
Sbjct: 61  CVRFVKGTDMMVSASEDFEVRVWNFPKLREGHMDEVECI----QVIKHHKHTITVFAV-- 114

Query: 207 LTKVLIYKTSTAKV------------HRELDTGKSSI-MRMEIENIDGKDYIVLAFGNGT 253
           L  +L+   +   +              E    K    + + +  I+   +I LA G   
Sbjct: 115 LKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPLCLSMHEIEKTQFI-LAIGGTN 173

Query: 254 VSMFPAKSLYDEEASEEPVTP-EF--NLQGHTNRVKDFKFYKNEFGHYLVTIGS-DGKIV 309
           V++F    +Y   ++ E V+  EF   L+GH + +K   F +   G YL+  GS D  I 
Sbjct: 174 VNVF----IYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETVPGDYLLASGSQDRYIR 229

Query: 310 VWDMSNKEQVAVYDCGERLNCLALCDESVEKYEM 343
           +W +   E++   +  E+   L L    + K+++
Sbjct: 230 LWRIRTNEKIDTSEEDEKK--LTLLSNKIYKFDI 261

>Kwal_14.906
          Length = 328

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 57/130 (43%), Gaps = 17/130 (13%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGN 111
           RYL++ S ++++ +YD    + L T+ S +    + KF+       +NE     T    +
Sbjct: 39  RYLLTASANDNMHLYDAMNCRFLNTVASKKYGCHSAKFTHA-----QNECVYSSTMKSFD 93

Query: 112 SKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
            + L             ++  +      GH + ++D ++ P N   +S S D S+RLW++
Sbjct: 94  IRHL------------NLETNQYLRYFTGHGALVSDIEMSPLNDTFLSASYDESVRLWDM 141

Query: 172 MTVKKAGVLK 181
              K   ++ 
Sbjct: 142 RASKAQAIVP 151

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 19/95 (20%)

Query: 77  LLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFG 136
           L+ H+ S+T +K+++        E D   T+G+           D+   +W   + E  G
Sbjct: 6   LMGHERSLTQVKYNR--------EGDLIFTSGK-----------DNVASVWYAMNGERLG 46

Query: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           TL+GH   I   D+      A++ S D S+++W +
Sbjct: 47  TLEGHNGSIWSIDVDQHTEYAVTGSADFSVKVWRV 81

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 58/141 (41%), Gaps = 37/141 (26%)

Query: 44  VKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDT 103
           V  LD+    +VSGS D  +R ++L  + E      H G++ A+KF   T+         
Sbjct: 106 VSALDVGAERIVSGSYDGVVRTWNLSGKIE-KQYSGHTGAVRAVKFISSTR--------- 155

Query: 104 GLTTGRGNSKWLISASDDHNLVIWRVK--------------DWENFGTLKGHASRINDFD 149
                      L+S  +D  L +W+ K              +      L+GH + +   D
Sbjct: 156 -----------LVSGGNDRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVD 204

Query: 150 IHPSNRIAISVSEDHSIRLWN 170
           +   +RI +S S D+SI  W+
Sbjct: 205 VQ-GDRI-LSASYDNSIGFWS 223

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 60/125 (48%), Gaps = 20/125 (16%)

Query: 54  LVSGSNDEHIRIYD-LQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
           +V+ S+D  + +++ L+  K +  +  HQ  +  + FS                    + 
Sbjct: 374 MVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP-------------------DG 414

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
           + ++SAS D+++ +W  +D +   T +GH + +         R+ +S S+D ++++W++ 
Sbjct: 415 RHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVK 474

Query: 173 TVKKA 177
           T K A
Sbjct: 475 TKKLA 479

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 54/140 (38%), Gaps = 21/140 (15%)

Query: 33  PIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFS 90
           PI     H   V  +  S   R++VS S D  I++++ +  K + T   H  S+  + +S
Sbjct: 394 PITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWS 453

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDI 150
              ++                   L+S S D  L +W VK  +    L GH   +   D 
Sbjct: 454 SDCRL-------------------LVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDW 494

Query: 151 HPSNRIAISVSEDHSIRLWN 170
               +   S  +D  +RLW 
Sbjct: 495 SVDGKRVCSGGKDKMVRLWT 514

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 58/143 (40%), Gaps = 16/143 (11%)

Query: 32  TPIFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGS-ITALK 88
           TP+   + H   V C+  S     + +GS D  IR+++  K + +G  L   G  IT+L 
Sbjct: 177 TPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLS 236

Query: 89  FSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDF 148
           +     ++             G    L SAS D  + IW         TL GH S ++  
Sbjct: 237 WEPIHLVKP------------GQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSSVSCI 284

Query: 149 DIHPSNRIAISVSEDHSIRLWNL 171
                  +  S S D +IR W++
Sbjct: 285 KWG-GQGVLYSGSHDKTIRAWDM 306

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%)

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
           +I+ + D+   IW         TLKGH + +      P   +  + S D++IRLW
Sbjct: 159 MITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLW 213

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 65/151 (43%), Gaps = 9/151 (5%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF--SKGTK 94
           F  H  SV  L  +   +VSGSND+ +R +DL      G  +       ALK      +K
Sbjct: 371 FDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGS----GKCIQSIDLTIALKMVPQSVSK 426

Query: 95  IEDKNEDDTGLTTGRGN-SKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153
           ++     +T L  G       L++ + D  + +W ++     G+L+GH   I       S
Sbjct: 427 LDITPSFNTPLIGGADCIDNALVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGS 486

Query: 154 NRIAISVSEDHSIRLWNLMTVKKAGVLKLKK 184
             I  S+  D S R+W+L     A +L  +K
Sbjct: 487 ELITGSM--DKSTRIWDLRMGSVAELLSFEK 515

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 84/200 (42%), Gaps = 38/200 (19%)

Query: 117 SASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKK 176
           +A+ D+ + +W +   +  G L GH + +N        R+  S  +D S+++W++  +  
Sbjct: 298 TANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDVDNI-- 355

Query: 177 AGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKV-HRELDTGKSSIMRME 235
             V K    N N     + G      A+A     ++  ++   + H +L +GK       
Sbjct: 356 --VDKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKC------ 407

Query: 236 IENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFN--LQGHTNRVKDFKFYKN 293
           I++ID    + +A     + M P      +  S+  +TP FN  L G  + +        
Sbjct: 408 IQSID----LTIA-----LKMVP------QSVSKLDITPSFNTPLIGGADCID------- 445

Query: 294 EFGHYLVTIGSDGKIVVWDM 313
              + LVT   DG + +WD+
Sbjct: 446 ---NALVTGTKDGIVYLWDL 462

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%)

Query: 138 LKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQF 191
           L GH++RI  FD  P  R  +S S D ++R W+L T      ++L+    N QF
Sbjct: 669 LWGHSNRITAFDFSPDGRWIVSASLDSTLRTWDLPTGTCIDGVRLESVATNVQF 722

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 63/162 (38%), Gaps = 27/162 (16%)

Query: 38  QAH--SLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK-GTK 94
           Q H  +L+  C       +V+ S++  I+I+D+     L T   H G ++A++F+K G  
Sbjct: 338 QGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQV 397

Query: 95  IEDKNEDDT------------------------GLTTGRGNSKWLISASDDHNLVIWRVK 130
           +   + D T                         L            + D  ++ +W V+
Sbjct: 398 LFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQ 457

Query: 131 DWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
             +   TL GH   I+       N +  S S D +IR+W+L 
Sbjct: 458 TGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVWSLF 499

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 65/172 (37%), Gaps = 36/172 (20%)

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW- 169
           N    +S+S D  L IW         T  GH   +NDF +    R  +S S D S++LW 
Sbjct: 169 NGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWE 228

Query: 170 --------------------------NLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFA 203
                                     N  T     +    +YN  G+ V    DSG    
Sbjct: 229 CSTSACVFTLNSNDGINCISLANYQGNPATTSYNALDHSNEYNTEGKAVFAGHDSG---- 284

Query: 204 VALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKD-YIVLAFGNGTV 254
             ++T   IY  +  K+   L   KS+ + +  ++I G D Y+   + +GT+
Sbjct: 285 --IITFHDIY--NRKKILDILPASKSACVTLTSQHIAGDDHYLFAGYSDGTI 332

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 280 GHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCD 335
           GHT  V DF     + G   V+  SDG + +W+ S    V   +  + +NC++L +
Sbjct: 198 GHTRSVNDFAMV--DRGRNFVSASSDGSLKLWECSTSACVFTLNSNDGINCISLAN 251

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 92/240 (38%), Gaps = 29/240 (12%)

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW----- 169
           + S + D    +W   + E  GT +GH   I   D+      A++ S D S++LW     
Sbjct: 25  IFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDG 84

Query: 170 -NLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAK--------V 220
            N+ T K    ++  +++  G  +    D    +A ++    ++  T T +        V
Sbjct: 85  SNVYTWKTKTPVRRVEFSPAGDKILAVLDGVMGYAGSVTVYDVVRNTETNEIVNINEEPV 144

Query: 221 HRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQG 280
              L      I  +     +GK YIV    +G VS       YD E  E   +    L+ 
Sbjct: 145 FEILTHDDFGIASVASWGFEGK-YIVAGHKDGKVSK------YDGENGEYLDS----LEL 193

Query: 281 HTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVY--DCGERLNCLALCDESV 338
           H   V D +F  +    Y +T   D    + D+++ + +  Y  DC     C+    E V
Sbjct: 194 HEQSVSDIQFSPDR--TYFITSSRDSASKLVDVTSFDVLKTYEADCPLNSACITPLKEFV 251

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%)

Query: 29  PIFTPIFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALK 88
           P+F  + H      SV       +Y+V+G  D  +  YD +  + L +L  H+ S++ ++
Sbjct: 143 PVFEILTHDDFGIASVASWGFEGKYIVAGHKDGKVSKYDGENGEYLDSLELHEQSVSDIQ 202

Query: 89  FS 90
           FS
Sbjct: 203 FS 204

>Kwal_47.17465
          Length = 800

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 62/153 (40%), Gaps = 43/153 (28%)

Query: 71  RKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVK 130
           ++ L ++  H GS+T ++FS                    +  +L S SDD  L+IW  K
Sbjct: 12  KRPLASMSRHTGSVTVVRFSP-------------------DGNFLASGSDDRILLIWE-K 51

Query: 131 D----------------WENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTV 174
           D                W     L  H + I D    P + I ++V  D S+ +WN  T 
Sbjct: 52  DEDQKQPIFGAENDKEHWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTF 111

Query: 175 KKAGVLKLKKYNQNGQFVRWC--GDSGEFFAVA 205
           +     K+K+++ +   V+      + ++FA A
Sbjct: 112 E-----KIKRFDVHQSLVKGVIFDPANKYFATA 139

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 278 LQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERL 328
           L  H N ++D  +  +     LVT+G D  ++VW+ S  E++  +D  + L
Sbjct: 75  LVAHDNDIQDICWAPD--SSILVTVGLDRSVIVWNGSTFEKIKRFDVHQSL 123

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 62/154 (40%), Gaps = 47/154 (30%)

Query: 44  VKCLDIS--KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNED 101
           V  LD+    ++++SGS D  +R +DL    +      H G I A+K+   T+       
Sbjct: 106 VSSLDVGDGSKHIISGSYDGIVRTWDLSGNVQ-KQYSGHSGPIRAVKYISNTR------- 157

Query: 102 DTGLTTGRGNSKWLISASDDHNLVIWRVK-----------------------DWENFGTL 138
                        L+SA +D  L +W+ K                       D +    L
Sbjct: 158 -------------LVSAGNDRTLRLWKTKNDDLKLTSQQQAQEDDDDEVNIEDGKTLAIL 204

Query: 139 KGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
           +GH + +   D+  ++RI +S S D+SI  W+ +
Sbjct: 205 EGHKAPVVSIDVSDNSRI-LSASYDNSIGFWSTI 237

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 17/22 (77%)

Query: 154 NRIAISVSEDHSIRLWNLMTVK 175
           N +  SVS+DH+I+ W+L+T +
Sbjct: 300 NTVGYSVSQDHTIKTWDLVTAR 321

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 67/162 (41%), Gaps = 27/162 (16%)

Query: 36  HFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK---- 91
           HF A +      D S+  +V+ + D  I+++D+     L T   H  ++TA++F+K    
Sbjct: 340 HFDATNSLTYSPDGSR--VVTAAEDGKIKVWDVASGFCLATFEEHTSAVTAVQFAKKGQV 397

Query: 92  -------GT------------KIEDKNEDDTGLTTGRGNSKWLISA--SDDHNLVIWRVK 130
                  GT            ++    E           S  ++SA  +D  ++ +W V+
Sbjct: 398 LFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFVWSVQ 457

Query: 131 DWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
             +   TL GH   ++       N +  S S D +IR+W++ 
Sbjct: 458 TGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSIF 499

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 4/55 (7%)

Query: 281 HTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERL--NCLAL 333
           HT+ V   +F K   G  L +   DG +  WD+       V+   ER+   CLA+
Sbjct: 382 HTSAVTAVQFAKK--GQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAV 434

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 54/122 (44%), Gaps = 21/122 (17%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSK 113
           +V+ S D  I+++D+     L T   H  S+TA++F+K  ++                  
Sbjct: 360 VVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQV------------------ 401

Query: 114 WLISASDDHNLVIWRVKDWENFGTLKGHAS-RINDFDIHPSNRIAISVSEDH-SIRLWNL 171
            + S+S D  +  W +  + NF T  G    + N   + PS  +  + S D+  I +W++
Sbjct: 402 -MFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV 460

Query: 172 MT 173
            T
Sbjct: 461 QT 462

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 54/142 (38%), Gaps = 26/142 (18%)

Query: 37  FQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
           F A+   VKC+    + R L  G      R+YDL     +  L   Q  +  +  ++   
Sbjct: 256 FYANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTVSVNQ--- 312

Query: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTL---KGHASRINDFDIH 151
                       TG    +WL   S     ++  V +W++   +   +GH    N     
Sbjct: 313 ------------TG----EWLAFGSSKLGQLL--VYEWQSESYILKQQGHFDSTNSLAYS 354

Query: 152 PSNRIAISVSEDHSIRLWNLMT 173
           P     ++ SED  I++W++ +
Sbjct: 355 PDGSRVVTASEDGKIKVWDITS 376

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 72/172 (41%), Gaps = 43/172 (25%)

Query: 31  FTPIFHFQAHSLSVKCLDISKRYLVSGSNDEH-IRIYDLQKRKELGTLLSHQGSITALKF 89
           FT     Q + L+V   D S   + +GS D   I ++ +Q  + L  L  H+G ++ L F
Sbjct: 425 FTGTERIQFNCLAV---DPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSF 481

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
           S+   +                   L SAS D  + IW         ++ G + ++   +
Sbjct: 482 SQENSV-------------------LASASWDKTIRIW---------SIFGRSQQVEPIE 513

Query: 150 IHPSNRIAISVSED----------HSIRLWNLMTVKKAGVLKLKKYNQNGQF 191
           ++ S+ +A+S+  D            I ++N+   K+ G +  +K   +G+F
Sbjct: 514 VY-SDVLALSMRPDGKEVAVSTLKGQISIFNIEDAKQVGNIDCRKDIISGRF 564

>Scas_720.83d
          Length = 915

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 59/140 (42%), Gaps = 23/140 (16%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTK 94
           FQ H+ SV  +  +KR   L S S D  +R +DL + +   T            F+   +
Sbjct: 381 FQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRT------------FTAAER 428

Query: 95  IEDK--NEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
           I+      D +G     G       + D+ ++ +W V+  +   TL GH   ++      
Sbjct: 429 IQFNCLAVDPSGEVVCAG-------SLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQ 481

Query: 153 SNRIAISVSEDHSIRLWNLM 172
            N +  S S D ++R+W++ 
Sbjct: 482 ENSVLASASWDKTVRVWSIF 501

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 61/141 (43%), Gaps = 25/141 (17%)

Query: 36  HFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKI 95
           HF A +      D S+  +V+ + D  I+++D+     L T   H  S+T ++F+K  ++
Sbjct: 342 HFDATNSLTYSPDGSR--VVTAAEDGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQV 399

Query: 96  EDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRI--NDFDIHPS 153
                              L S+S D  +  W +  + NF T    A RI  N   + PS
Sbjct: 400 -------------------LFSSSLDGTVRAWDLIRYRNFRTFTA-AERIQFNCLAVDPS 439

Query: 154 NRIAISVSEDH-SIRLWNLMT 173
             +  + S D+  I +W++ T
Sbjct: 440 GEVVCAGSLDNFDIHVWSVQT 460

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 11/75 (14%)

Query: 278 LQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERL--NCLA--- 332
            Q HT+ V   +F K   G  L +   DG +  WD+        +   ER+  NCLA   
Sbjct: 381 FQEHTSSVTQVQFAKR--GQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDP 438

Query: 333 ----LCDESVEKYEM 343
               +C  S++ +++
Sbjct: 439 SGEVVCAGSLDNFDI 453

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 71/182 (39%), Gaps = 18/182 (9%)

Query: 141 HASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGE 200
           H   I   D++    + ISV ED    L N    K   VL    + +    V++  D G+
Sbjct: 54  HRKNIATIDLNKQGTLLISVDEDGRAILTNF---KAKTVLHHFNFKEKCYQVKFSPD-GK 109

Query: 201 FFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAK 260
            FA+A    + I+KT  A   R+     +  +R  +     +D + L +     S F   
Sbjct: 110 LFALATGRFLQIWKTPDATEDRQF----APFVRYRVHAGHFQDILSLTWSLD--SRFIIS 163

Query: 261 SLYDEEA------SEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMS 314
           +  D  A      SEE         GH + V    F  ++    + T+  DG + VW+ +
Sbjct: 164 TSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFFSADQ--EKIYTVSKDGALFVWEFT 221

Query: 315 NK 316
            K
Sbjct: 222 KK 223

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 92/241 (38%), Gaps = 51/241 (21%)

Query: 136 GTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWC 195
           G LKGH ++I DF     +++ +S S+D  + +W+ +T  K   + L     + Q+V  C
Sbjct: 79  GILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKRSAIPL-----DSQWVLTC 133

Query: 196 G--DSGEFFAVALL-TKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDY-----IVL 247
               SG   A A L     IY+       ++     +SI +     I G ++     +V 
Sbjct: 134 ALSPSGALAASAGLNNNCTIYRMPRGSAVQQ---NVTSIFKGHTGYISGVEFVSESRVVT 190

Query: 248 AFGNGTVSMFP----------AKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGH 297
           + G+ T +++           +  L D  A   PVT                  KN   +
Sbjct: 191 SSGDMTCALWDIPKAKRVREYSDHLGDVLAISIPVT---------------NLSKN---N 232

Query: 298 YLVTIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDESVEKYEMMKKRVAEEADLGEQ 357
              + GSDG   +WD+ +   V  +  G        CD +  K+      VA   D G  
Sbjct: 233 MFASCGSDGYTFIWDVRSPSAVQQFSIGS-------CDSNCLKFFPDGNSVAVGNDDGTI 285

Query: 358 S 358
           S
Sbjct: 286 S 286

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 92/240 (38%), Gaps = 66/240 (27%)

Query: 31  FTPIFHFQAHSLSVKCLDISKRY--LVSGSNDEHIRIY-DLQKRKELGTLLS-HQGSITA 86
           +  I   Q HS  VK +    ++  L S S D+ +RI+ D     E   +L+ H+G+I  
Sbjct: 147 YECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWC 206

Query: 87  LKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRV--------KDWENFGTL 138
             FSK        ED   L +G          SDD  + +W+         ++W    TL
Sbjct: 207 SDFSK-------EEDPIRLCSG----------SDDSTVRVWKYIGDDEDDQQEWVCESTL 249

Query: 139 -KGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGD 197
              H S+I      PS RIA               +V   GVL + K  QN   V     
Sbjct: 250 PNAHRSQIYGVAWSPSGRIA---------------SVGADGVLAVYKEKQNDSEVSEWEI 294

Query: 198 SGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMF 257
           S  + A        +Y+ +T K                  NIDGK+ ++ A  +G V+++
Sbjct: 295 SATYKAAHT-----VYEINTVK----------------WVNIDGKEMLITAGDDGRVNLW 333

>KLLA0D00814g complement(76687..77913) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2 subunit of the
           major yeast histone acetyltransferase, start by
           similarity
          Length = 408

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 70/141 (49%), Gaps = 23/141 (16%)

Query: 41  SLSVKCLDISKR---YLVSGSNDEHIRIYDLQK-RKELGTLLSHQGSITALKFSKGTKIE 96
           S +   L  SKR    L +   D ++ +YDL++ +K L ++  H+ S+T+L+FS      
Sbjct: 257 SSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFS------ 310

Query: 97  DKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKD------WENFGTLKGHASRINDFDI 150
             ++D  GL T  G+ + +I   D  N+   +  D       E F    GH S +N+F  
Sbjct: 311 -PHQD--GLLTSSGSDRRII-MWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFS- 365

Query: 151 HPSNR--IAISVSEDHSIRLW 169
           H SN   +  SV E++ +++W
Sbjct: 366 HNSNVPWLMCSVEEENVLQIW 386

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 74/168 (44%), Gaps = 30/168 (17%)

Query: 158 ISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG----DSGEFFAVALLTKVLIY 213
           +S S+D ++ LW++ +   A     + ++ +   V  C      S  F  V+    ++I+
Sbjct: 186 LSASDDGTVALWDVTST--ANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIH 243

Query: 214 KTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKS------LYDEEA 267
            T++ +  ++L    +              +  LAF   + ++  A        LYD   
Sbjct: 244 DTNSDRAIQKLSVSSA--------------FNTLAFSKRSENLLAAAGTDSNVYLYDLRR 289

Query: 268 SEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSN 315
            ++P+    ++ GH + V   +F  ++ G  L + GSD +I++WD+ N
Sbjct: 290 LQKPL---HSMAGHEDSVTSLEFSPHQDG-LLTSSGSDRRIIMWDLFN 333

>Scas_512.3
          Length = 534

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 77/185 (41%), Gaps = 33/185 (17%)

Query: 39  AHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKE---------LGTLLSHQGSITALKF 89
            +SL  +    +K+ L++   D  IR ++L   K+         L +L  H+ +I  +KF
Sbjct: 16  VYSLCFQPNSPNKKKLLTAGGDNKIRSWNLNLVKDTNKIDTIDFLSSLTQHEQAINVVKF 75

Query: 90  -SKGT--------------KIEDKNEDD--TGLTTGRGNSKWLISASDD---HNLVIWRV 129
            S GT              K +D NE +  T         K   S  +D   +N   W V
Sbjct: 76  NSPGTILASAGDDGQILLWKQQDVNEQNGETAAPVDSSVPKPFGSTFEDDEENNKESWFV 135

Query: 130 KDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNG 189
             W+       ++S I D D  P +R  +S S D+SIR++++ + K  G      +N   
Sbjct: 136 --WKRLRAPGSNSSEIYDLDWSPCDRYVVSGSMDNSIRVFDIESGKLLGT--YADHNHYV 191

Query: 190 QFVRW 194
           Q V W
Sbjct: 192 QGVTW 196

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 66/161 (40%), Gaps = 29/161 (18%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSI---TALKFSKG- 92
           F  HS  VK +D+   Y++SGS D  +R+        L     H+  I     + FS   
Sbjct: 261 FSPHSEWVKSIDVLDEYILSGSLDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDSK 320

Query: 93  ---TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVK-----------------DW 132
              +   D+NE  +     R   K+  SA+ D+ + IW V                   +
Sbjct: 321 ICTSPYRDQNE-HSAFAPLRF--KYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTF 377

Query: 133 ENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
           +   TL+GH S + D  +   +    S S+D +I+ W+L T
Sbjct: 378 KCVMTLRGHTSWVKDLKLRGDH--LFSCSDDETIKCWDLNT 416

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 75/344 (21%), Positives = 130/344 (37%), Gaps = 79/344 (22%)

Query: 33  PIFHFQAHSLSVKCLDI-----------SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQ 81
           P+    AHS ++  +++           S   + + S D  I +YD            H 
Sbjct: 158 PLAVTTAHSKAITSIEVIEAHNFEEFIDSTTLVSTTSKDAQINVYD------------HS 205

Query: 82  GSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGH 141
            +   LK  +     D     +  T  + N   L S+S D  + +WRV D     +   H
Sbjct: 206 SNTGELKLIRSFNAHDSTVS-SQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPH 264

Query: 142 ASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEF 201
           +  +   D+   +   +S S D ++RL    T   +G         NG  V   G   EF
Sbjct: 265 SEWVKSIDVL--DEYILSGSLDSTLRL----THWPSG---------NGLSV---GTGHEF 306

Query: 202 FAVALLTKVLIYKTSTAKV----HRELDTGKS-SIMRMEIENIDGKDYIVLAFGNGTVSM 256
                + +VLI   S +K+    +R+ +   + + +R +        Y   A  + T+ +
Sbjct: 307 ----PIERVLIIPFSDSKICTSPYRDQNEHSAFAPLRFK--------YCASAARDNTIKI 354

Query: 257 F--PAKSLYDEEASEEPVTPEFN--------LQGHTNRVKDFKFYKNEFGHYLVTIGSDG 306
           +  P   L    A   PV    N        L+GHT+ VKD K      G +L +   D 
Sbjct: 355 WEVPLPQLKPNSA---PVPSTTNTTFKCVMTLRGHTSWVKDLKLR----GDHLFSCSDDE 407

Query: 307 KIVVWDMSNKEQVAVYDC--GERLNCLALCDE-SVEKYEMMKKR 347
            I  WD++    V  +       +NC+ +  E ++E++    +R
Sbjct: 408 TIKCWDLNTGNCVKTWSSIHNNFINCIDIDREATIEQFSPSLQR 451

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 81/197 (41%), Gaps = 35/197 (17%)

Query: 135 FGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLK-LKKYNQNGQFVR 193
           + TLKGH + +      P +   +S SEDH +++W          ++ ++ Y++      
Sbjct: 52  YATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQCIQTIQHYSKT----- 106

Query: 194 WCGDSGEFFAVALLTKVLIYKTS--TAKVHRE--------------LDTGKSSIMRMEIE 237
                    A++ L  ++    +  T  + R+              +  G    + + + 
Sbjct: 107 -------IVALSALPSLISVGCADGTISIWRQNIQNDEFGLAHEFTIKKGFFYPLCLSLS 159

Query: 238 NIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEP-VTPEFNLQGHTNRVKDFKFYKNEF- 295
            ++ K Y+ LA G   V++F A  +  +   E+  V  E  L+GH + VK   F   E  
Sbjct: 160 KVEEKKYL-LAIGGTNVNVFIASFILSDSGIEKCRVVAE--LEGHEDWVKSLAFRHQETP 216

Query: 296 GHYLVTIGS-DGKIVVW 311
           G YL+  GS D  I +W
Sbjct: 217 GDYLLCSGSQDRYIRLW 233

>Scas_719.30
          Length = 940

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 61/155 (39%), Gaps = 30/155 (19%)

Query: 46  CLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGL 105
            LD   R +VS   D  +  YD  K   LG L      IT + + + + +     DD  +
Sbjct: 510 ALDGMNRKMVSCGLDGIVGFYDFNKSTFLGKL-QLDAPITKMVYHRSSDLFALILDDLSI 568

Query: 106 TTGRGNSKWLISASDDHNLVIWRV--KDWENFGTLKGHASRINDFDIHPSNRIAISVSED 163
                    LI A      V  RV  + W       GH++RI   D  P  R  +S S D
Sbjct: 569 V--------LIDA------VTQRVVRQFW-------GHSNRITALDFSPDGRWIVSASLD 607

Query: 164 HSIRLWNLMT------VKKAGVLKLKKYNQNGQFV 192
            +IR W+L T      +K   V    K++ NG  +
Sbjct: 608 STIRTWDLPTGGCIDGIKLESVATDVKFSPNGDML 642

>KLLA0E18139g 1608371..1609351 highly similar to sp|P36104
           Saccharomyces cerevisiae YKL018w singleton, start by
           similarity
          Length = 326

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 78/192 (40%), Gaps = 34/192 (17%)

Query: 138 LKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWC-- 195
            +GH + ++D  + P +   +S S D S+RLW+L + K   ++           V  C  
Sbjct: 108 FQGHGALVSDIQMSPLDDTFLSASYDESVRLWDLRSSKAQALIP--------SLVPTCIA 159

Query: 196 -GDSGEFFAVALLT--KVLIYKTSTAKVHREL----DTGKSSIMRMEIENIDGKDYIVLA 248
              SG  FA+      +V +Y     K    L    D       ++E  N DGK Y++LA
Sbjct: 160 YDPSGLVFAIGNPENHEVGLYNVKHLKAGPFLVINVDPSFDQWNKLEFSN-DGK-YLLLA 217

Query: 249 FGNG---TVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSD 305
              G    +  F    L++   ++     EF   G      D +          +T+G+D
Sbjct: 218 SSAGKHLIMDSFDGTQLFELSGTKPFPLREFMDSGSATFTPDGR----------ITLGTD 267

Query: 306 --GKIVVWDMSN 315
             GKI +W+ ++
Sbjct: 268 YTGKIAIWNHAD 279

>Scas_705.46
          Length = 490

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 274 PEFNLQGHTNRVKDFKFY---KNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCG 325
           P++ L+ HT+ +     Y   ++    YL++  + GKIV+WD+  +  V  +  G
Sbjct: 8   PKYTLRNHTDPISALALYYPARDTVVPYLISADASGKIVIWDLITRRPVHTFASG 62

>YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein
           containing four WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of retinoblastoma binding
           protein 4 (human RBBP4), which associates with histone
           acetylation proteins [1572 bp, 523 aa]
          Length = 523

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 71/177 (40%), Gaps = 29/177 (16%)

Query: 156 IAISVSEDHSIRLWNL---------MTVKKAGVLKLKKYNQNGQFVRWCGDSGE---FFA 203
           + IS S D +  +W+L         +    + V  ++   ++ Q    CG  G    F  
Sbjct: 258 LIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL 317

Query: 204 VALLTKVLIYKT-------STAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSM 256
            +L    +IY+        +TA        G  +++R+E    D       A  +  + +
Sbjct: 318 RSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIII 377

Query: 257 FPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
              ++         P +P  NLQGH + V   K++  +  + L++ G D +++ WD+
Sbjct: 378 LDMRN---------PESPILNLQGHGSSVNGIKWHPTKR-NVLLSCGDDCQVLYWDL 424

 Score = 35.4 bits (80), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 66/152 (43%), Gaps = 26/152 (17%)

Query: 44  VKCLDISKRYLVSGSNDEHIRIYDLQK-------RKELGTLLSHQGSITALKFSKGT--- 93
           V+ L  S +   S   D  +R++DL+         +   + +S   + T    SKG+   
Sbjct: 293 VRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDAL 352

Query: 94  -KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWEN-FGTLKGHASRINDFDIH 151
            ++E    D   L T          A+D + ++I  +++ E+    L+GH S +N    H
Sbjct: 353 LRLEPSPYDPNVLAT---------FAADSNKIIILDMRNPESPILNLQGHGSSVNGIKWH 403

Query: 152 PSNR-IAISVSEDHSIRLWNL----MTVKKAG 178
           P+ R + +S  +D  +  W+L    M +  AG
Sbjct: 404 PTKRNVLLSCGDDCQVLYWDLNSSFMEINAAG 435

>Kwal_47.19083
          Length = 324

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 288 FKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYD 323
           F    N  G YL T G DGKI VWD+  KE+V+  +
Sbjct: 222 FNVSFNSTGEYLATCGYDGKIRVWDVKQKERVSTLN 257

>Scas_605.18
          Length = 424

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 60/136 (44%), Gaps = 19/136 (13%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQG----------SITALKFSKG-------TKIE 96
           +V+G +D  I ++DL+    + +    QG            + +++S+G       T I 
Sbjct: 285 IVTGGDDGVINMFDLRSDCAIASYSLQQGIQKEIRDPTYMSSNMEYSRGSPQSPISTAIS 344

Query: 97  DKNEDDTGLTT--GRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN 154
               D+ G+ +     + + + +   D   +IW V   E  G L+GH++R++     P  
Sbjct: 345 SSYLDNQGVVSLDFSNSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRTSPDG 404

Query: 155 RIAISVSEDHSIRLWN 170
               + S D ++R+W+
Sbjct: 405 LGVCTGSWDSTMRIWS 420

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 68/188 (36%), Gaps = 58/188 (30%)

Query: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG 196
           TLKGH ++I+DF     ++  +S S+D  + +W+  +  K   + L     + Q+V  C 
Sbjct: 86  TLKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTASGLKRNAIPL-----DSQWVLSCA 140

Query: 197 --DSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTV 254
              SG   A A L                      +I R+  EN               V
Sbjct: 141 LSPSGNLAASAGLNN------------------NCTIYRVSKEN---------RVQQNVV 173

Query: 255 SMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMS 314
           S+F                     +GHT  + D +F  N    +++T   D    +WD+ 
Sbjct: 174 SIF---------------------KGHTCYISDIEFLDNS---HIITSSGDMTCALWDIP 209

Query: 315 NKEQVAVY 322
             ++V  Y
Sbjct: 210 KAKRVREY 217

>YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 and
           COMPASS complex and pre-mRNA cleavage factor II complex
           [990 bp, 329 aa]
          Length = 329

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 59/135 (43%), Gaps = 17/135 (12%)

Query: 47  LDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLT 106
            D + ++L++ S+++ +++Y     K L T+ S +    +  F+       +NE     T
Sbjct: 35  FDDNGQFLLTSSSNDTMQLYSATNCKFLDTIASKKYGCHSAIFTHA-----QNECIYSST 89

Query: 107 TGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSI 166
               + K+L   ++ +                 GH + +ND  ++P N   +S S D S+
Sbjct: 90  MKNFDIKYLNLETNQY------------LRYFSGHGALVNDLKMNPVNDTFLSSSYDESV 137

Query: 167 RLWNLMTVKKAGVLK 181
           RLW+L   K   ++ 
Sbjct: 138 RLWDLKISKPQVIIP 152

>Kwal_23.6240
          Length = 913

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 60/141 (42%), Gaps = 25/141 (17%)

Query: 36  HFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKI 95
           HF A +      D S+  +V+ S D  I+I+D+     L T   H  +++AL F+K  ++
Sbjct: 340 HFDATNAVTYSPDGSR--VVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQV 397

Query: 96  EDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRI--NDFDIHPS 153
                              L SAS D  +  W +  + NF T    A RI  N     PS
Sbjct: 398 -------------------LFSASLDGTVRAWDLVRYRNFRTFTA-AERIQFNCLAADPS 437

Query: 154 NRIAISVSED-HSIRLWNLMT 173
             +  + S D  ++ +W++ T
Sbjct: 438 GEVVCAGSVDSFAVHVWSVQT 458

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 64/163 (39%), Gaps = 26/163 (15%)

Query: 36  HFQAHSLSVKCLDI--SKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL------ 87
           +F A    VKC+    +   LV G N+   R+Y+L +   +  L   Q ++  +      
Sbjct: 251 YFYASQARVKCVTFHANSNTLVVGFNNGEFRLYELPEFTLIQQLSMGQNAVNTVCVNDSG 310

Query: 88  --------KFSKGTKIEDKNE----------DDTGLTTGRGNSKWLISASDDHNLVIWRV 129
                   K  +    E ++E          D T   T   +   +++AS+D  + IW V
Sbjct: 311 EWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDV 370

Query: 130 KDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM 172
                  T + H + ++        ++  S S D ++R W+L+
Sbjct: 371 VSGFCLVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLV 413

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 30/75 (40%), Gaps = 11/75 (14%)

Query: 278 LQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERL--NCLA--- 332
            Q HT  V    F K   G  L +   DG +  WD+        +   ER+  NCLA   
Sbjct: 379 FQEHTAAVSALAFAKR--GQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADP 436

Query: 333 ----LCDESVEKYEM 343
               +C  SV+ + +
Sbjct: 437 SGEVVCAGSVDSFAV 451

>ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH]
           (1126443..1128008) [1566 bp, 521 aa]
          Length = 521

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 64/154 (41%), Gaps = 38/154 (24%)

Query: 60  DEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISAS 119
           D H+RI+D++ +K       H+ +++        K+ D    D  + +      +L++  
Sbjct: 354 DGHVRIWDIRSKK-------HKPALSV-------KVSDT---DVNVMSWNQKISYLLATG 396

Query: 120 DDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAIS-----------VSEDHSIRL 168
           DD+    W V D   F   +G  S +  +D H     +IS            SED+++ L
Sbjct: 397 DDNG--TWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTL 454

Query: 169 WNL--------MTVKKAGVLKLKKYNQNGQFVRW 194
           W+L        +  + A V +L++      FV W
Sbjct: 455 WDLSVEADDEEIKQQAAEVKELQQIPPQLLFVHW 488

 Score = 32.7 bits (73), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 23/186 (12%)

Query: 145 INDFDIHPS-NRIAISVSEDHSIRLWNLMTVKKAGVLKLK---------KYNQNGQFVRW 194
           I D    PS N +  +   D  +R+W++ + K    L +K          +NQ   ++  
Sbjct: 335 IEDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLA 394

Query: 195 CGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTV 254
            GD    + V  L +    +   + V  + D  K +I  +    +D +  I +A  + TV
Sbjct: 395 TGDDNGTWGVWDLRQFSNQQGGVSPV-AQYDFHKGAITSISFNPLD-ESIIAVASEDNTV 452

Query: 255 SMFPAKSLYDEE-----ASE----EPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSD 305
           +++      D+E     A+E    + + P+         VKD K++K   G  LV+ G+D
Sbjct: 453 TLWDLSVEADDEEIKQQAAEVKELQQIPPQLLFVHWQKEVKDVKWHKQIPG-CLVSTGTD 511

Query: 306 GKIVVW 311
           G + VW
Sbjct: 512 G-LNVW 516

>Kwal_26.8975
          Length = 445

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 59/143 (41%), Gaps = 39/143 (27%)

Query: 44  VKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDT 103
           V  LD+    +VSGS D  +R ++L  + E      H G++ A+K+   T+         
Sbjct: 105 VSALDVGGDKIVSGSYDGIVRTWNLSGKVE-KQYAGHSGAVRAVKYISSTR--------- 154

Query: 104 GLTTGRGNSKWLISASDDHNLVIWRVKDWE----------------NFGTLKGHASRIND 147
                      L+S ++D  L +W+ K+ E                    L+ H + +  
Sbjct: 155 -----------LVSGANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAHKAPVVT 203

Query: 148 FDIHPSNRIAISVSEDHSIRLWN 170
            D+   +RI IS S D+SI  W+
Sbjct: 204 VDVS-GDRI-ISGSYDNSIGFWS 224

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 70/173 (40%), Gaps = 34/173 (19%)

Query: 36  HFQAHSLSVKCLD-ISKRYLVSGSNDEHIRIY----------------DLQKRKELGTLL 78
            +  HS +V+ +  IS   LVSG+ND  +R++                D+++ K L  L 
Sbjct: 136 QYAGHSGAVRAVKYISSTRLVSGANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILE 195

Query: 79  SHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLI-----------SASDDHNLVIW 127
           +H+  +  +  S    I    ++  G  +        +           SA+     +  
Sbjct: 196 AHKAPVVTVDVSGDRIISGSYDNSIGFWSTNHKEMTAVDPMDALGSNVSSAAKKRRRLAL 255

Query: 128 R---VKDWENFGTLKGHASRIND--FDIHPSNRIAISVSEDHSIRLWNLMTVK 175
           +   V+       L+ H + + +  FD      +  SVS+DH+I+ W+L+T +
Sbjct: 256 KDGSVRRRSPLALLESHTAPVEEVLFDF-ADKTVGYSVSQDHTIKTWDLVTAR 307

>Scas_657.13
          Length = 411

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 65/155 (41%), Gaps = 34/155 (21%)

Query: 31  FTPIFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQK-RKELGTLLSHQGSITALKF 89
           FT  F   A   ++     S+    +   D H+ ++D +   + L ++  H G++T ++F
Sbjct: 254 FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEF 313

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDW--------------ENF 135
           S          D  G+         L+++ +D   +IW + D               E  
Sbjct: 314 SP---------DQDGI---------LMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVL 355

Query: 136 GTLKGHASRINDFDIHPSNRIAISVSEDHS-IRLW 169
               GH S INDF ++P+    ++ SE+ + I++W
Sbjct: 356 MIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 78/192 (40%), Gaps = 36/192 (18%)

Query: 141 HASRINDFDIHPSNRIAISV-----------SEDHSIRLWNLMTVKKAGVLKLKKYNQNG 189
           H+  ++ F+ H  N   +S            S+D +I LWN+     + +      + + 
Sbjct: 161 HSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSD- 219

Query: 190 QFVRWCGDSGEFFAVALLTKVLIYKTSTAKVH--RELDTGKSSIMRMEIENIDGKDYIVL 247
             V  C  S   F + +   V   + ST ++H  RE DT  S         +D   +  L
Sbjct: 220 -IVNDCKWSN--FDLNVFGSV--SEDSTLQLHDQREKDTFTSQF------KVDAP-FNTL 267

Query: 248 AFGNGTVSMFPAKS------LYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVT 301
           AF   +  +F A        L+D      P+    ++ GH   V + +F  ++ G  L+T
Sbjct: 268 AFSKHSQYLFAAAGTDSHVYLFDRRDISRPL---HSMAGHDGAVTNMEFSPDQDG-ILMT 323

Query: 302 IGSDGKIVVWDM 313
            G D + ++WD+
Sbjct: 324 SGEDRRAIIWDI 335

>Kwal_26.8628
          Length = 422

 Score = 36.6 bits (83), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%)

Query: 110 GNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
           G+ + + +   D+  VIW     E  G L+GH+SRI+     P      + S D +++LW
Sbjct: 358 GSGRLMHACYTDYGCVIWDTLRAEIVGKLEGHSSRISGVKTSPDGMAVCTGSWDATLKLW 417

Query: 170 N 170
           +
Sbjct: 418 S 418

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 72/190 (37%), Gaps = 62/190 (32%)

Query: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG 196
           TL GH ++I+DF     +R  +S S+D  + +W+     K   + L     + Q+V  C 
Sbjct: 81  TLNGHNNKISDFAWSSDSRSILSASQDGFMIVWDASLGFKKNAIPL-----DSQWVLTCA 135

Query: 197 --DSGEFFAVALLT-KVLIYKTSTA-KVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNG 252
              SG   A A LT    IY+ S   +V +++                            
Sbjct: 136 INSSGNLVASAGLTNSCTIYRISQENRVQQQI---------------------------- 167

Query: 253 TVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWD 312
            VSMF                     +GHT  V   +F++N   + ++T   D    +WD
Sbjct: 168 -VSMF---------------------KGHTCYVSQVEFFEN---NSIITASGDMTCALWD 202

Query: 313 MSNKEQVAVY 322
           +   +++A +
Sbjct: 203 IPKAKRIAEF 212

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 272 VTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMS 314
           ++    L GH N++ DF +  +     +++   DG ++VWD S
Sbjct: 76  LSSHLTLNGHNNKISDFAWSSDS--RSILSASQDGFMIVWDAS 116

>Scas_679.28
          Length = 815

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 46/231 (19%), Positives = 92/231 (39%), Gaps = 37/231 (16%)

Query: 114 WLISASDDHNLVIWR----VKDWENFGTLKGHASRINDFDI-------HPSNRIAISVSE 162
           W+ +AS DH  ++W+    +  ++ +    GH++ +    +       +P     ++ S 
Sbjct: 400 WMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGYP--EFLLTASN 457

Query: 163 DHSIRLWNL----MTVKK-AGVLKLKKYNQNGQ----FVRWCGDSGEFFAVALLTKVL-I 212
           D +I+ W +     TV++   ++K+ +Y +              +   FA A   K   I
Sbjct: 458 DLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFATASYDKTCKI 517

Query: 213 YKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPV 272
           +     ++   L   K  +  +     D    I    G+ T+ ++          S +  
Sbjct: 518 WDLENGELTATLSNHKRGLWDVAFCQYD--KLIATCSGDKTIKIW----------SLDTF 565

Query: 273 TPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYD 323
           +    L+GHTN V+   F   +    LV+ G+DG I +WD S  + +   D
Sbjct: 566 SVMKTLEGHTNAVQRCMFINKQL--QLVSSGADGLIKIWDCSTGDCLKTLD 614

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 54/138 (39%), Gaps = 21/138 (15%)

Query: 38  QAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKI 95
           +AH   +  L IS       + S D+  +I+DL+  +   TL +H+  +  + F +  K+
Sbjct: 488 RAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKL 547

Query: 96  EDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNR 155
                              + + S D  + IW +  +    TL+GH + +          
Sbjct: 548 -------------------IATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQL 588

Query: 156 IAISVSEDHSIRLWNLMT 173
             +S   D  I++W+  T
Sbjct: 589 QLVSSGADGLIKIWDCST 606

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 12/75 (16%)

Query: 109 RGNSKWLISASDDHNLVIWRV--------KDWENFG----TLKGHASRINDFDIHPSNRI 156
           RG  ++L++AS+D  +  W++        +D +       T + H   IN   I P++ I
Sbjct: 446 RGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSI 505

Query: 157 AISVSEDHSIRLWNL 171
             + S D + ++W+L
Sbjct: 506 FATASYDKTCKIWDL 520

>Scas_659.9
          Length = 475

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 18/97 (18%)

Query: 49  ISKRY-----LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDT 103
           I+K Y     L +GS D  ++ +++  R+EL +  +H G IT L  +     + KNE+  
Sbjct: 73  IAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGLITGLCVTPEHLSKQKNEN-- 130

Query: 104 GLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKG 140
                     +++S SDD  + +W V   E++  LK 
Sbjct: 131 ----------FMLSCSDDKTVKLWSVNS-EDYANLKN 156

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 18/23 (78%)

Query: 111 NSKWLISASDDHNLVIWRVKDWE 133
           ++K+++S SDD N+ +WR K WE
Sbjct: 353 DAKYIVSGSDDGNVRLWRSKAWE 375

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 115 LISASDDHNLVIWRVKDWEN-FGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
            + A++DHN   + +++        K H S + D D  P+    ++ S D +IR++N
Sbjct: 271 FVVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFN 327

>Scas_542.5
          Length = 327

 Score = 36.2 bits (82), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 76/188 (40%), Gaps = 30/188 (15%)

Query: 140 GHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLK-----LKKYNQNGQFVRW 194
           GH + ++D ++ P N   +S S D S+RLW+L   K   ++         Y+ +G  V  
Sbjct: 110 GHDALVSDIEMSPLNDTFLSASYDESVRLWDLRVSKAQAIVPSVVPHCIAYDPSG-LVFA 168

Query: 195 CGDSGEFFAVALLTKVLIYKTSTAK----VHRELDTGKSSIMRMEIENIDGKDYIVLAFG 250
            G+   F       ++ +Y     K    +  ++D   S   ++E  N DGK Y++LA  
Sbjct: 169 LGNPENF-------EIGLYNVRQLKNGPFLTMKVDPKFSQWNKLEFSN-DGK-YLLLASS 219

Query: 251 NG---TVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGK 307
            G    +  F    L++   +      EF   G      D        G +++    +G 
Sbjct: 220 VGKHLILDAFDGSQLFELTGTRAFPLREFMDSGSACFTPD--------GQFVLGTDYEGS 271

Query: 308 IVVWDMSN 315
           + +W  S+
Sbjct: 272 VAIWSHSD 279

>Kwal_27.12070
          Length = 418

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 57/129 (44%), Gaps = 23/129 (17%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK--GTKIEDKNEDDTGLTTGRGN 111
           L S  +   I ++D++        L H GS++AL+++    T +    +DD GL      
Sbjct: 306 LCSADSAGRINLWDIRDFSSPIRSLDHHGSVSALQWNPHHPTILATAGQDD-GLV----- 359

Query: 112 SKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNR-IAISVSEDHSIRLW- 169
             W +S   D  L            T  GH   +ND    P++  +  SVS D+SI+LW 
Sbjct: 360 KIWDLSQPVDQELKF----------THGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWK 409

Query: 170 ---NLMTVK 175
              NLMT K
Sbjct: 410 PSQNLMTPK 418

>Scas_711.11
          Length = 695

 Score = 36.6 bits (83), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 43  SVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           +++C D +   L +G+ D  +R++DL+  K +  L  H GSIT LKF
Sbjct: 544 ALQCFDAA---LATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKF 587

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSK 91
            + HS S+ CL    + +V+GS D+ +RI+DL +   L  +L+ +  + ++ F K
Sbjct: 575 LEGHSGSITCLKFDNKNIVTGSIDKTVRIWDL-RSGILSDMLTFEKPVLSVDFDK 628

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL 171
           DH + IW +   +  G + GH + +N   I  +N + +S  +D  ++LWNL
Sbjct: 394 DHVIKIWDLSRSKQIGRMTGHVATVNCMQI--TNNMLVSGGKDALLKLWNL 442

>Scas_442.2*
          Length = 795

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 66/158 (41%), Gaps = 36/158 (22%)

Query: 30  IFTPIFHFQAHSLSVKCLDISK--RYLVSG---SNDEH--IRIYDLQKRKELGTLLS-HQ 81
           ++  I     H   + CLD+S   +++ S    +  +H  +RI++     E+   L+ H 
Sbjct: 557 LWPEIEKLYGHGYEITCLDVSPDGKFIASACRSNTPQHAVVRIFNTDNWLEVKPPLAFHT 616

Query: 82  GSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWEN------F 135
            ++T L+FS                    +SK+L+S   D   V+W  +D E       +
Sbjct: 617 LTVTKLRFSP-------------------DSKYLLSVCRDRQWVVWE-RDPETDKFTLKY 656

Query: 136 GTLKGHASRINDFDIHPS--NRIAISVSEDHSIRLWNL 171
            T K H   I D D  P     + ++ S D +I+LW  
Sbjct: 657 KTAKPHTRIIWDGDWAPLEFGNVFVTGSRDRTIKLWKF 694

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 76/196 (38%), Gaps = 27/196 (13%)

Query: 135 FGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRW 194
           F TLKGH + +            +S SEDH +++W     +  GV +      +G     
Sbjct: 52  FATLKGHEAEVTCVKFITDTPYMVSCSEDHHVKIWK----QNPGVAR----EVDGWTCVQ 103

Query: 195 CGD--SGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRM--EIENIDG--------- 241
             D  S    A+A+L  ++    +  KV   +   K  +  +  E E   G         
Sbjct: 104 TLDHYSHTVVALAVLPGLIAVGCADGKVSLWVQKMKEDVFILGEEFEVQKGVLPLALAFS 163

Query: 242 ---KDYIVLAFGNGTVSMFPAKSLYDEEASE-EPVTPEFNLQGHTNRVKDFKFYKNEF-G 296
               D  +LA G   V++F    + +  A   E +     L+GH + +K   F   E  G
Sbjct: 164 KVIDDKYLLAVGGTNVNVFVFSFVLNATAETIETLQLAAKLEGHEDWIKSLAFRHQETPG 223

Query: 297 HYLVTIGS-DGKIVVW 311
            YL+  GS D  I +W
Sbjct: 224 DYLLCSGSQDRYIRLW 239

>Kwal_33.14971
          Length = 818

 Score = 36.2 bits (82), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 40/86 (46%), Gaps = 10/86 (11%)

Query: 130 KDWENFGT-----LKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT---VKKAGVLK 181
           KD   F T      +GH  RI    I PS     + S+D S+R+W ++T   V K  ++ 
Sbjct: 435 KDLRPFPTRCSTVYRGHEGRIRTLSIDPSGLWLATGSDDGSVRIWEILTGREVYKVQLVD 494

Query: 182 LK-KYNQNGQFVRWCGD-SGEFFAVA 205
           L+ K   N + V W  D S    AVA
Sbjct: 495 LEAKTGDNIEVVEWNPDKSTGILAVA 520

>Kwal_55.21450
          Length = 503

 Score = 35.8 bits (81), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 57/309 (18%), Positives = 127/309 (41%), Gaps = 39/309 (12%)

Query: 43  SVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDD 102
           S+  L  S    +S  ND  ++I+DL + +EL  L  ++G   A++              
Sbjct: 215 SILLLPKSGHLCLSAGNDNQVKIWDLYRDREL--LRDYRGHSKAVR-------------- 258

Query: 103 TGLTTGRGNSKWLISASDDHNLVIW-----RVKDWENFGTLKGHASRINDFDIHPSNRIA 157
            G++     S++L S S D  + IW     +V+   ++  +   A    +F    SN   
Sbjct: 259 -GISFNSEGSEFL-SVSFDQQIKIWDTETGKVRHQYSYSCIPNCA----EFRPSNSNEFI 312

Query: 158 ISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQF-VRWCGDSGEFFAVALLTKVLIYKTS 216
           + +S +  IR ++L T  K G++++  ++ +    +++  D  +F + +    + I++  
Sbjct: 313 VGLS-NSEIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWENQ 371

Query: 217 TAKVHREL-DTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPE 275
                +++ DT + S+  + I     ++Y      +  +  F  K  Y          P+
Sbjct: 372 INIPIKQISDTSQYSMPYIGIH--PEQNYFAAQSMDNAIYAFSMKPKYKRH-------PK 422

Query: 276 FNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCD 335
            +  GH        F  +  G Y+ +  + G++ +WD      +  +D  ++   + +  
Sbjct: 423 KHFSGHKCAGFGIGFGFSPDGQYIASGDTRGRVYIWDWKTTHLLKHFDVPDKKTIVTVAW 482

Query: 336 ESVEKYEMM 344
              E  +M+
Sbjct: 483 SPQETSKML 491

>Scas_658.1
          Length = 442

 Score = 35.8 bits (81), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 49/114 (42%), Gaps = 3/114 (2%)

Query: 103 TGLTTGRGNSKWLISASDDHNLVIWRVKDWENF-GTLKGHASRINDFDIHPSNRIAISVS 161
           T LT    +   L+S  +D+ + +W      N     KGH+  IN  D +      IS S
Sbjct: 153 TSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGTNFISSS 212

Query: 162 EDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKT 215
            DH+I++W+    K    L  K    + +F  +  +S EF      +K+  Y T
Sbjct: 213 FDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPF--NSSEFIVGFANSKIYHYDT 264

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 20/88 (22%)

Query: 41  SLSVKCLDISKRYLVSGSNDEHIRIYDL-QKRKELGTLLSHQGSITALKFSKGTKIEDKN 99
           + S+  L  S   L+SG ND  ++++D   KR  L     H  +I +L F         N
Sbjct: 152 TTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDF---------N 202

Query: 100 EDDTGLTTGRGNSKWLISASDDHNLVIW 127
           +D T            IS+S DH + IW
Sbjct: 203 DDGTN----------FISSSFDHTIKIW 220

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 271 PVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQV 319
           P   ++ + GHTN      F  N  G+ L++ G+D  + VWD  +K  +
Sbjct: 138 PKKIKYAMDGHTNGTTSLTFLPNS-GNLLLSGGNDNIVKVWDFYHKRNL 185

>Kwal_55.21559
          Length = 351

 Score = 35.4 bits (80), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 115 LISASDDHNLVIWR--VKDWENFGTLKGHASRI--NDFDIHPSNRIAISVSEDHSIRLWN 170
           L S+S D  + +W+    DWE    L GH   +  +DF+   S+    S S+D ++R+WN
Sbjct: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

Query: 171 LMTVKKAG 178
            +  ++ G
Sbjct: 250 YVEEEENG 257

>Kwal_27.12586
          Length = 509

 Score = 35.4 bits (80), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 50/123 (40%), Gaps = 23/123 (18%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGN 111
           ++++ G     I I  + + + LG L  H  +ITA  F+    +                
Sbjct: 307 KFVIPGPQGS-IYICGMGESRPLGKLNGHSATITAFDFNSENNM---------------- 349

Query: 112 SKWLISASDDHNLVIWRVKDWENFGTLKGHASRIND-FDIHPSNRIAISVSEDHSIRLWN 170
              L+S SDD  L +WR     +     G+   I   F I     IA S+  D S+RLW+
Sbjct: 350 ---LLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFWIDDDKVIATSL--DGSVRLWS 404

Query: 171 LMT 173
            +T
Sbjct: 405 HLT 407

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 35.4 bits (80), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 80/195 (41%), Gaps = 35/195 (17%)

Query: 48  DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTT 107
           D +   L  G  D  I + D++      +   H G+I++LKF                  
Sbjct: 111 DSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKF-----------------Y 153

Query: 108 GRGNSK-WLISASDDHNLV-IWRVKDWENFGTLKGHASRINDFDI-------HPSNRIAI 158
           G+ NSK WL+++ D + +V +W +   +   TL+ H S +   DI        PS  + +
Sbjct: 154 GQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNL-L 212

Query: 159 SVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTA 218
           S   D  I LW+    KK  +LK    NQ    V  CG     F      K +IY     
Sbjct: 213 SGGRDDIINLWDFNMKKKCKLLKTLPVNQQ---VESCG-----FLKDGDGKRIIYTAGGD 264

Query: 219 KVHRELDTGKSSIMR 233
            + + +D+   S+++
Sbjct: 265 AIFQLIDSESGSVLK 279

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 278 LQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYD 323
           L+GHTN V+   F   +    L++ G+DG I +WD S+ E +   D
Sbjct: 571 LEGHTNAVQRCSFINKQ--KQLISCGADGLIKIWDCSSGECLKTLD 614

 Score = 32.0 bits (71), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 27/135 (20%), Positives = 54/135 (40%), Gaps = 21/135 (15%)

Query: 38  QAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKI 95
            AH   +  L +S       + S D+  +I++L+  +   TL +H+  +  + F +  K+
Sbjct: 488 HAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKL 547

Query: 96  EDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNR 155
                              L ++S D  + IW +  +    TL+GH + +         +
Sbjct: 548 -------------------LATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQK 588

Query: 156 IAISVSEDHSIRLWN 170
             IS   D  I++W+
Sbjct: 589 QLISCGADGLIKIWD 603

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 40/118 (33%), Gaps = 19/118 (16%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGN 111
           + L + S D+ ++I+ L     + TL  H  ++    F                      
Sbjct: 546 KLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFIN-------------------K 586

Query: 112 SKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
            K LIS   D  + IW     E   TL GH +R+          + +S   D   + W
Sbjct: 587 QKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFW 644

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 35.4 bits (80), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 16/75 (21%)

Query: 115 LISASDDHNLVIW---------------RVKDWENFGTLKGHASRINDFDIHPSNR-IAI 158
           + S+SDD  + IW                +KD E    L GH+ ++     HP+ + +  
Sbjct: 97  VASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDVLA 156

Query: 159 SVSEDHSIRLWNLMT 173
           S S D+++R+WN+ T
Sbjct: 157 SSSLDYTVRIWNVET 171

>YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransferase
           subunit 2, contains seven WD (WD-40) repeats [1206 bp,
           401 aa]
          Length = 401

 Score = 35.0 bits (79), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 63/136 (46%), Gaps = 34/136 (25%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKE-LGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTG 108
           S   L +   D ++ +YDL+  KE L  +  H+ ++  L+FS  T ++       G+   
Sbjct: 263 SSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFS--THVD-------GV--- 310

Query: 109 RGNSKWLISASDDHNLVIWRVK---------DWEN-----FGTLKGHASRINDFDIHPS- 153
                 ++S+  D+ L++W +K         D E+          GH S +NDFD++P  
Sbjct: 311 ------VVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQI 364

Query: 154 NRIAISVSEDHSIRLW 169
             +  S  E++ +++W
Sbjct: 365 PWLVASAEEENILQVW 380

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 10/78 (12%)

Query: 242 KDYIVLAFGNGTVSMFPAKS------LYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEF 295
           + +  LAF + + ++  A        LYD    +EP+    ++ GH + V + +F  +  
Sbjct: 252 QPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPL---HHMSGHEDAVNNLEFSTHVD 308

Query: 296 GHYLVTIGSDGKIVVWDM 313
           G  +V+ GSD ++++WD+
Sbjct: 309 G-VVVSSGSDNRLMMWDL 325

>Scas_670.21
          Length = 595

 Score = 35.0 bits (79), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 70/197 (35%), Gaps = 50/197 (25%)

Query: 33  PIF-HFQAHSLSVKCL--DISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           P F     HS  V  L  +  +  L SG ND  + +YD   R  +   + H+ ++ AL +
Sbjct: 405 PFFERLNTHSQEVCGLQWNTEENKLASGGNDNVVCVYDGTSRNPMIKFIEHKAAVKALAW 464

Query: 90  SK----------GT-----KIEDKNED------DTG--------------LTTGRGNSKW 114
           S           GT     KI + N        DTG              + T  G SK+
Sbjct: 465 SPHKRGILATGGGTVDRRLKIWNVNTSMKLSDVDTGSQVCNMIWSKNTDEIVTSHGYSKY 524

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM-- 172
                   +L +W          LKGH+ R+    +       +S + D ++R W L   
Sbjct: 525 --------HLTLWDYPTMNPVAILKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFEK 576

Query: 173 --TVKKAGVLKLKKYNQ 187
                K   + L  +NQ
Sbjct: 577 SKPRAKPDSIILNAFNQ 593

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 35.0 bits (79), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 52/107 (48%), Gaps = 18/107 (16%)

Query: 46  CLDISKRY-----LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNE 100
           C  ++K Y     L SGS D  ++ +++  R+EL +  +H G +T L  +          
Sbjct: 70  CYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTP--------- 120

Query: 101 DDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIND 147
             T L+  + +S +++S  DD  + +W V   ++F ++K     ++D
Sbjct: 121 --THLSPTKKDS-FMLSCGDDKTIKLWSVNS-DDFNSIKDDTKIVSD 163

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 24/101 (23%)

Query: 37  FQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQK--RKELGTLLSHQGSITALKFSKG 92
           F+ H  +V  +D S     +V+GS D+ IRI++L+    +E+      Q  +  +KF+  
Sbjct: 298 FKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQ-HVFQVKFTM- 355

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWE 133
                             +SK+++S SDD N+ +WR K WE
Sbjct: 356 ------------------DSKYIVSGSDDGNVRLWRAKAWE 378

 Score = 32.3 bits (72), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 58/141 (41%), Gaps = 39/141 (27%)

Query: 63  IRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLIS----- 117
           I+++D+ ++K L  L     +++ ++F       ++NE+D   +TG  NS  L       
Sbjct: 198 IQLWDVNRKKPLSNLSWGVDNVSFVRF-------NQNEEDILASTGSDNSIVLYDLRTNS 250

Query: 118 --------------------------ASDDHNLVIWRVKDWEN-FGTLKGHASRINDFDI 150
                                     A++DHN   + +++        K H S + D D 
Sbjct: 251 PTQKVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDF 310

Query: 151 HPSNRIAISVSEDHSIRLWNL 171
            P+    ++ S D +IR++NL
Sbjct: 311 SPTGEEIVTGSYDKTIRIFNL 331

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 69/166 (41%), Gaps = 28/166 (16%)

Query: 158 ISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQF---VRWCGDSGEFFAVALLTKVLIYK 214
           +S S+D +I LW++   +K     +   + +      V+W       F         + +
Sbjct: 196 LSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGS-------VSE 248

Query: 215 TSTAKVHRELDTGKSSIMRMEIENIDGK-DYIVLAFGNGTVSMFPAKS------LYDEEA 267
            ST K+    D   S I    I NI+ K  Y  LAF   + ++F A        LYD   
Sbjct: 249 DSTMKL---FDKRSSQI----IHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRD 301

Query: 268 SEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
              P+   + + GH + V   +F  N  G  L + GSD + +VWD+
Sbjct: 302 VSNPL---YAMTGHEDAVTAIEFDPNNDG-ILYSSGSDRRTIVWDL 343

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 56/136 (41%), Gaps = 34/136 (25%)

Query: 50  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTG 108
           S     +   D  + +YD++     L  +  H+ ++TA++F       D N D  G+   
Sbjct: 281 SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEF-------DPNND--GI--- 328

Query: 109 RGNSKWLISASDDHNLVIWRVKDW--------------ENFGTLKGHASRINDFDIHPS- 153
                 L S+  D   ++W +++               E      GH + IND  ++P+ 
Sbjct: 329 ------LYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNI 382

Query: 154 NRIAISVSEDHSIRLW 169
           N +  S  ED+ +++W
Sbjct: 383 NWLVASAEEDNIVQIW 398

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 98/259 (37%), Gaps = 50/259 (19%)

Query: 48  DISKRYLVSGSNDEHIRIYDLQKRK---ELG-TLLSHQGSITALKFSKGTKIEDKNEDDT 103
           D   R++ + S+D+HI+++ L K     EL  +  +H  SI A+ ++             
Sbjct: 18  DFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASP----------- 66

Query: 104 GLTTGRGNSKWLISASDDHNLVIWRV---------KDWENFGTL---KGHASRINDFDIH 151
               GR     + SAS D  + +W           + W    TL   KG    +     H
Sbjct: 67  --EYGRI----IASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAH 120

Query: 152 PSNRIAI----------SVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGD--SG 199
              ++A              E   +R W L +  K   +    + Q+   + WC    S 
Sbjct: 121 LGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSP 180

Query: 200 EFFAVALLTKVLIY---KTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFG--NGTV 254
           E  AV+ L + +IY   K     V  +L   KS I  +      G+ Y ++A G  +G +
Sbjct: 181 EKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRI 240

Query: 255 SMFPAKSLYDEEASEEPVT 273
            +F         ASEE +T
Sbjct: 241 RIFKITEKLSPLASEESLT 259

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 69/189 (36%), Gaps = 60/189 (31%)

Query: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG 196
           TLKGH ++I+DF     ++  +S S+D  + +W+ M+  K   + L     + Q+V  C 
Sbjct: 83  TLKGHNNKISDFRWSRDSKSILSASQDGFMLIWDPMSGLKKNAIPL-----DSQWVLACA 137

Query: 197 DSGEFFAVA---LLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGT 253
            S     VA   L     IY+ S                                     
Sbjct: 138 ISPSRNLVASGGLSNNCTIYRIS------------------------------------- 160

Query: 254 VSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
                      E  +++ +   F  +GHT  V D +F  NE    ++T   D    +WD+
Sbjct: 161 ----------QENRTQQKIVSIF--KGHTCYVSDLEFINNE---SILTASGDMTCALWDI 205

Query: 314 SNKEQVAVY 322
              ++V+ Y
Sbjct: 206 PKSKRVSEY 214

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 57/142 (40%), Gaps = 26/142 (18%)

Query: 54  LVSGSNDEHIRIYDLQKRKELG-----------------------TLLSHQGSITALKFS 90
           +++GS+D   R++DL+   EL                        T+     S  A  +S
Sbjct: 280 IITGSDDGIARLFDLRSDCELSSYSLSQKVQQQQMKLKNRSYLSSTMEYSNSSAAATPYS 339

Query: 91  KGTK-IEDKNEDDTGLTT--GRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIND 147
              + I     D+ G+ +     + + L +   ++  ++W     E  G L+GH+SRI+ 
Sbjct: 340 PAAETIRSSYLDNQGIVSLDFSISGRLLYACYTEYGCIVWDTLRGEIVGRLEGHSSRISG 399

Query: 148 FDIHPSNRIAISVSEDHSIRLW 169
               P      + S D +++LW
Sbjct: 400 VRTSPDGMCVCTGSWDSTMKLW 421

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 275 EFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWD-MSNKEQVAV 321
              L+GH N++ DF++ ++     +++   DG +++WD MS  ++ A+
Sbjct: 81  SMTLKGHNNKISDFRWSRDS--KSILSASQDGFMLIWDPMSGLKKNAI 126

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 82/186 (44%), Gaps = 27/186 (14%)

Query: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCG 196
           TLKGH ++++ F     +R  +S S+D  + LW+  T  K+  + L     + Q+V  C 
Sbjct: 122 TLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPL-----HSQWVLSCA 176

Query: 197 --DSGEFFAVALL-TKVLIYKTSTA-KVHRELDT---GKSSIMRMEIENIDGKDYIVLAF 249
              +G   A A L     IY+ S   ++ + + +   G +  +  EIE +D  + I+ A 
Sbjct: 177 ICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYIS-EIEFLD-DNSILTAS 234

Query: 250 GNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEF---GHYLVTIGSDG 306
           G+ T       +L+D   S+     EF    H   V        E    G+   + GSDG
Sbjct: 235 GDMTC------ALWDITKSKR--INEF--ADHLGDVLSLSAAPTETEGNGNVFASGGSDG 284

Query: 307 KIVVWD 312
            + +WD
Sbjct: 285 YLYIWD 290

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 17/78 (21%)

Query: 111 NSKWLISASDDHNLVIWRVKDWENFGT----------------LKGHASRINDFDIHPSN 154
           + + L+S SDD  + +W +    +F                  L GH  ++     HP+ 
Sbjct: 93  DERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPVKFLTGHQRKVGHVLYHPTA 152

Query: 155 R-IAISVSEDHSIRLWNL 171
           + +  S S DH++RLWN+
Sbjct: 153 QGVLASSSLDHTVRLWNV 170

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 68/171 (39%), Gaps = 19/171 (11%)

Query: 37  FQAHSLSVKCLDIS---KRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGS---ITALKFS 90
           F+ H+  V   D     +R LVSGS+D  I ++++             G+   +  +KF 
Sbjct: 77  FRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPVKFL 136

Query: 91  KGTKIEDKNEDDTGLTTGRGNSKWLISASD-DHNLVIWRVKDWENFGTLKGHASRINDFD 149
            G      ++   G       ++ ++++S  DH + +W V+   N   L  H   +    
Sbjct: 137 TG------HQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVEQGTNPIVLT-HPDMVTSMS 189

Query: 150 IHPSNRIAISVSEDHSIRLWNLMTVKKAGVLK--LKKYNQNGQFVRWCGDS 198
                    +V  D  +R+W+   ++K  V+   +       Q V W G+S
Sbjct: 190 FSYGGTYLATVCRDKMLRVWD---IRKGEVVSEGMGHSGPKNQRVVWLGNS 237

>Kwal_47.17567
          Length = 590

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 67/150 (44%), Gaps = 23/150 (15%)

Query: 33  PIFHFQAHSLSVKCLDIS--KRYLVS---GSNDEHIRIYDLQKRKELGTLLSHQGSITAL 87
           P    + H+ +VK +  S  +R +++   G+ D+ ++I++++   +L  + +    +  +
Sbjct: 443 PFLKLEEHTAAVKAMAWSPHRRGILATGGGTADKRLKIWNVKTSVKLHDVDT-ASQVCNM 501

Query: 88  KFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIND 147
            +SK T     NE    + T  G SK+        NL +W     E    LKGH+ R+  
Sbjct: 502 IWSKNT-----NE----IITSHGYSKY--------NLTLWDGNTLEPMAILKGHSFRVLH 544

Query: 148 FDIHPSNRIAISVSEDHSIRLWNLMTVKKA 177
             +       +S + D ++R W L    K+
Sbjct: 545 MTLSTDGTTVVSGAGDETLRYWKLFEKSKS 574

>CAGL0B02013g 184252..187614 highly similar to tr|Q03897
           Saccharomyces cerevisiae YDR128w, start by similarity
          Length = 1120

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 241 GKDYIVLAF--GNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYK-----N 293
           G+ + V+    GN TV M    +   E++ +  + P +  +GHT+RV DF +       N
Sbjct: 257 GRGFCVMPMVGGNNTVYMMNLDTEESEDSHKSKLQPIYTFKGHTDRVTDFLWRSRYTEDN 316

Query: 294 EFGHYLVTIGSDGKIVVWDMSN 315
              + LVT   D  + +W +++
Sbjct: 317 GMEYQLVTWSIDRDLRLWTVND 338

>Scas_700.27*
          Length = 433

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%)

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTV 174
           + +A  D  + +W ++      TL GH + IN     P +   +S S D +IRLW+++  
Sbjct: 221 IATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDATIRLWDIVAG 280

Query: 175 KKAGVL 180
           K   V+
Sbjct: 281 KSMKVI 286

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/136 (19%), Positives = 55/136 (40%), Gaps = 25/136 (18%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSK 113
           + +   D  +R++D++ R  + TL+ H+  I         K+     D            
Sbjct: 221 IATAGRDSVVRLWDIRARVAVMTLIGHKNPIN--------KVHCLPVDPQ---------- 262

Query: 114 WLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
            ++S S D  + +W +   ++   +  H   + +   HP+   ++S    + IR W L  
Sbjct: 263 -IVSCSTDATIRLWDIVAGKSMKVITHHKKSVRNIAFHPT-EFSMSSCSANDIRSWKL-- 318

Query: 174 VKKAGVLKLKKYNQNG 189
             + G+  L  +N +G
Sbjct: 319 -PEGGL--LTNFNSDG 331

>KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces
           cerevisiae YMR131c RSA2, start by similarity
          Length = 523

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 69/167 (41%), Gaps = 21/167 (12%)

Query: 163 DHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRW---------CGDSGEFFAVALLTKVLIY 213
           D  IR+W+  + K    + +K  N +   + W          GD    + V  L +    
Sbjct: 355 DGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQFTPQ 414

Query: 214 KTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEE-----AS 268
             STA    +    K +I  +    +D +  I +A  + TV+++      D+E     A+
Sbjct: 415 NASTASPVAQYQFHKGAITSISFNPLD-ESIIAVASEDNTVTLWDLSVEADDEEIKQQAA 473

Query: 269 E----EPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVW 311
           E    + + P+         VKD K++K   G  LV+ G+DG + VW
Sbjct: 474 ETKELQQIPPQLLFVHWQKEVKDVKWHKQIPG-CLVSTGTDG-LNVW 518

>Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement
          Length = 411

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%)

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
           D  L IW   D  N  T+ GH S I   +I    R  +S S+D +++LW
Sbjct: 162 DMRLKIWSALDGSNPRTIMGHKSIITGTEIIERGRNILSCSKDGTVKLW 210

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
           D+   +W +   E  G + GH +RIN     P     +S S D ++++W
Sbjct: 383 DYGCAVWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSSWDMTLKVW 431

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 76/185 (41%), Gaps = 23/185 (12%)

Query: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT-VKKAGVLKLKKYNQNGQFVRWC 195
           TLKGH ++I+D      +   +S S+D  I +W+  T +KK+ +  L ++  +       
Sbjct: 81  TLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSAI---- 136

Query: 196 GDSGEFFAVALLTKVLIYKTSTAKVHRE--LDTGKSSIMRMEIENIDGKDY-----IVLA 248
             SG   A A L        S  +V R+  +     SI +     I   ++     I+ A
Sbjct: 137 SPSGNLVASAGLDN----HCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDERTILTA 192

Query: 249 FGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKI 308
            G+ T +M+       +    + VT   +  G    +         +GH  +T GSDG  
Sbjct: 193 SGDMTCAMW-------DIPKSKRVTEFIDHLGDVLTMDLPPANTGRYGHNFITGGSDGYA 245

Query: 309 VVWDM 313
            +WD+
Sbjct: 246 YLWDV 250

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 272 VTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWD 312
           + P   L+GH N++ D K+ ++     +++   DG I++WD
Sbjct: 76  LQPVRTLKGHNNKISDVKWSQDSAS--VLSSSQDGFIIIWD 114

>Kwal_26.7655
          Length = 743

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 49/109 (44%), Gaps = 26/109 (23%)

Query: 30  IFTPIFH------FQAHSLSVKCLDISKR-YLVSGSNDEHIRIYDLQKRKELGTLLSHQG 82
           ++ P+FH      +Q H+  +  LD SK  ++++ S D+  R++   + K L  + +H  
Sbjct: 255 LYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKAL-KVFTHPD 313

Query: 83  SITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKD 131
            +T  KF         N+D           ++ IS   DH L +W + D
Sbjct: 314 FVTCAKF-------HPNDD-----------RFFISGCLDHTLRLWSILD 344

>KLLA0A01650g complement(146030..147235) similar to sp|Q02793
           Saccharomyces cerevisiae YGL213c SKI8 antiviral protein
           of the beta-transducin (WD-40) repeat family singleton,
           start by similarity
          Length = 401

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 11/69 (15%)

Query: 261 SLYDEEASEEPVTPEFNLQGHTNRVKD---------FKFYKNEFGHYLVTIGSDGKIVVW 311
           SLY+ E  E      F +  H N+            F    N  G YL + G DGKI +W
Sbjct: 265 SLYETEFGER--IGNFTVPTHGNQTTIASYAHNGWVFSVSFNSTGEYLASAGYDGKIRIW 322

Query: 312 DMSNKEQVA 320
           D  ++E+V+
Sbjct: 323 DTKSRERVS 331

>Scas_689.6
          Length = 2139

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 98   KNEDDTGLTTGRGNSKWLISASDDHNLV-IWRVKDWEN------FGTLKGHASRINDFDI 150
            +N     +T+    SK++    D++ L+ IW++++  N       G+L  H   I D  +
Sbjct: 1901 RNLHTCAITSFLSISKYIFLTGDENGLIKIWKLQNLANGNILVQLGSLYCHICEIKDMQL 1960

Query: 151  HPSNRIAISVSEDHSIRLWNLM 172
            +P     +++     + LW++M
Sbjct: 1961 YPDLNSLLTLDSSGKVMLWDMM 1982

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 278  LQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQV 319
            L  H   +KD + Y +   + L+T+ S GK+++WDM N + +
Sbjct: 1948 LYCHICEIKDMQLYPD--LNSLLTLDSSGKVMLWDMMNYQPI 1987

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 46/91 (50%), Gaps = 20/91 (21%)

Query: 47  LDISKRYLVSGSNDEHIRIYDLQKRKELGTLLS-HQGSITALKFSKGTKIEDKNEDDTGL 105
           LD S R +V+ SND  IRI+DL++RK L  L   H GS               ++    L
Sbjct: 438 LDNSFRLVVT-SNDSRIRIFDLEQRKLLEVLKGFHSGS---------------SQHKAQL 481

Query: 106 TTGRGNSKWLISASDDHNLVIWRVK--DWEN 134
           +   G    ++++SDDH +  WR+K  D EN
Sbjct: 482 SIWHGQ-PIVVNSSDDHWVYGWRLKSSDREN 511

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 85/212 (40%), Gaps = 40/212 (18%)

Query: 114 WLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN-RIAISVSEDHSIRLWNLM 172
           +++SAS D  + +W      +  T   H   +   + HP++ R  IS   DH  RLW+++
Sbjct: 291 FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSIL 349

Query: 173 TVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIM 232
                        +    F   C D        L+T V +            + GK +I 
Sbjct: 350 -------------DDEVSFEYDCQD--------LITSVTLSP----------EEGKYTI- 377

Query: 233 RMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQ-GHTNRVKDFKFY 291
              I   +G  +I++  G   VS F       +E +   +  E + +  H  RV   + +
Sbjct: 378 ---IGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAF 434

Query: 292 KNEFGH--YLVTIGSDGKIVVWDMSNKEQVAV 321
           +++  +   LV   +D +I ++D+  ++ + V
Sbjct: 435 RSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEV 466

>YER082C (UTP7) [1514] chr5 complement(324268..325932) Component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, has one WD (WD-40)
           domain [1665 bp, 554 aa]
          Length = 554

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 14/107 (13%)

Query: 213 YKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPV 272
           +  ST ++  EL T     M M     +    + L   NGTVS++         +  EP+
Sbjct: 217 HDVSTGQLVSELRTKAGPTMAMAQNPWNA--VMHLGHSNGTVSLW-------SPSMPEPL 267

Query: 273 TPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQV 319
               + +G  N +       +  G+Y+ T G+D  + +WD+ N +Q+
Sbjct: 268 VKLLSARGPVNSIA-----IDRSGYYMATTGADRSMKIWDIRNFKQL 309

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 48/101 (47%), Gaps = 24/101 (23%)

Query: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQK--RKELGTLLSHQGSITALKFSKG 92
           F+ H  +V  +D S     +V+GS D+ IRIY ++    +E+      Q  I  +K++  
Sbjct: 294 FKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGHSREIYHTKRMQ-HIFQVKYTM- 351

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWE 133
                             +SK+++S SDD N+ +WR K WE
Sbjct: 352 ------------------DSKYIVSGSDDGNVRLWRAKAWE 374

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 45/96 (46%), Gaps = 19/96 (19%)

Query: 49  ISKRY-----LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDT 103
           I+K Y     L + S D  I+ +++  R+EL +  +H G +T L  +            +
Sbjct: 73  IAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTP-----------S 121

Query: 104 GLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLK 139
            L+  R N  +++S  DD  + +W V   ++F  +K
Sbjct: 122 YLSPQREN--FMLSCGDDKTVKLWSVNS-DDFSNVK 154

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 68/319 (21%), Positives = 126/319 (39%), Gaps = 44/319 (13%)

Query: 34  IFHFQAH---SLSVKCLDISKRYLVSGSNDEHIRIYDL-QKRKELGTLLSHQGSITALKF 89
           I+ F+ H   +  +K L  +    +SG ND  I I+D+  +R  L     H+ ++  + F
Sbjct: 171 IYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINF 230

Query: 90  SKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFD 149
                    N D T            +S S D  L +W  +  +    LK H S  N   
Sbjct: 231 ---------NSDGTEF----------LSVSFDQTLKVWDTETGKVKSRLKWH-SVPNCAT 270

Query: 150 IHPSNR----IAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQF-VRWCGDSGEFFAV 204
            HP+N     + +S SE   IR ++     K G+++   ++ +    +++  D  +F + 
Sbjct: 271 YHPTNNNEYIVGLSNSE---IRHYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFISS 327

Query: 205 ALLTKVLIYKTSTAKVHREL-DTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLY 263
           +    V I++       +++ DT + S+  +EI     + Y      +  +  F  K  Y
Sbjct: 328 SEDKTVRIWENQVNIPIKQISDTSQYSMPYLEIH--PEQHYFSAQSMDNAIYSFSMKPKY 385

Query: 264 DEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYD 323
            +   +         +GH        F  +  G Y+V+  S G +VVWD      +  ++
Sbjct: 386 KKNLKKV-------FRGHLCAGFGINFGFSPDGQYIVSGDSRGSVVVWDWKTTRTLKRFE 438

Query: 324 C--GERLNCLALCDESVEK 340
              G+ +  LA   +   K
Sbjct: 439 VPDGKPVTTLAWHPQETSK 457

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 115 LISASDDHNLVIWRV--KDWENFGTLKGHASRI--NDFDIHPSNRIAISVSEDHSIRLWN 170
           L S+S D  + IW+    DWE    L GH   +  +DF+   SN    S S+D ++R+W 
Sbjct: 170 LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229

Query: 171 L 171
           L
Sbjct: 230 L 230

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 18/23 (78%)

Query: 111 NSKWLISASDDHNLVIWRVKDWE 133
           +SK++IS SDD N+ +WR K WE
Sbjct: 359 DSKYIISGSDDGNVRLWRSKAWE 381

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 57/139 (41%), Gaps = 39/139 (28%)

Query: 63  IRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWL------- 115
           I ++D+ + K +  L     +IT+LKF       ++NE D   +TG  NS  L       
Sbjct: 201 IHLWDVNRLKPVSDLSWGADNITSLKF-------NQNETDILASTGSDNSIVLYDLRTNS 253

Query: 116 ------------------------ISASDDHNLVIWRVKDW-ENFGTLKGHASRINDFDI 150
                                   ++A++DHN   + +++   +    K H S + D D 
Sbjct: 254 PTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDF 313

Query: 151 HPSNRIAISVSEDHSIRLW 169
            P+    ++ S D SIR++
Sbjct: 314 SPTGDEIVTGSYDKSIRIY 332

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 10/83 (12%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSK 113
           L +GS D  I+ +++  R+E  +  +H G +T L  ++  +  DK  D         +  
Sbjct: 83  LATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQ-PRFHDKKPD-------LKSQN 134

Query: 114 WLISASDDHNLVIW--RVKDWEN 134
           +++S SDD  + +W   V D+ N
Sbjct: 135 FMLSCSDDKTVKLWSINVDDYSN 157

>KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces
           cerevisiae YMR146c TIF34 translation initiation factor
           eIF3, p39 subunit singleton, start by similarity
          Length = 347

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 26/59 (44%)

Query: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
           + + S D    IW   + E  GTL  H+  I   D+  S   A++   D   ++W + T
Sbjct: 25  VFACSKDSVASIWYAINGERLGTLDDHSGTIWSIDVDESTTYALTGGADFCFKIWKVAT 83

>Scas_719.52
          Length = 628

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 17/88 (19%)

Query: 111 NSKWLISASDDHNLVIWRV----------------KDWENFGTLKGHASRINDFDIHP-S 153
           N   + S+SDD  + IW++                K+ +    L GH+ ++     HP +
Sbjct: 93  NDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFHPVA 152

Query: 154 NRIAISVSEDHSIRLWNLMTVKKAGVLK 181
             +  S S D++++LWN+ T +    LK
Sbjct: 153 ENVLASSSLDYTVKLWNIETGEAVITLK 180

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 98/247 (39%), Gaps = 55/247 (22%)

Query: 117 SASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN-RIAISVSEDHSIRLWNLMTVK 175
           S+  D  + +W +      G L GH + +N   I   N  + I+ S+D +++LW+L   +
Sbjct: 353 SSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSR 412

Query: 176 KAGVLKLKKYNQNGQFVRWCGDS-----GEFFAVALLTKVLIYKTSTAKV-HRELDTGKS 229
           +  +       +  + V  C  +      E  A++  ++ L+  +   K+ H +L TGK 
Sbjct: 413 EIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKC 472

Query: 230 SIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEE---ASEEPVT------------- 273
                 I+ +D    ++    +  + M PA+SL +      +E P+              
Sbjct: 473 ------IQQLD----LIFTPTHSDIKM-PARSLNNGACLLGTEAPMIGALQCYNSALATG 521

Query: 274 ---------------PEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM--SNK 316
                          P   L+GHT+ +   KF   +    LVT   D  + +WD+  S+ 
Sbjct: 522 TKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEK----LVTGSMDNSVRIWDLRTSSI 577

Query: 317 EQVAVYD 323
             V  YD
Sbjct: 578 LDVIAYD 584

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 62/151 (41%), Gaps = 11/151 (7%)

Query: 30  IFTPIFH-FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRK---ELGTLLSHQGS-- 83
           I TP  H F+ H   +  L      LVSGS D+ I  +DL   K   +L  + +   S  
Sbjct: 428 IVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDI 487

Query: 84  -ITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHA 142
            + A   + G  +        G      ++  L + + D  + +W ++  +    L+GH 
Sbjct: 488 KMPARSLNNGACLLGTEAPMIGALQCYNSA--LATGTKDGIVRLWDLRVGKPVRLLEGHT 545

Query: 143 SRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173
             I          +  S+  D+S+R+W+L T
Sbjct: 546 DGITSLKFDSEKLVTGSM--DNSVRIWDLRT 574

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 121/309 (39%), Gaps = 55/309 (17%)

Query: 37  FQAHSLSVKCLDISKR---YLVSGSNDEHIRIYDLQKRKELGTLLS-------------- 79
              H  +V C+ I K+    L++GS D  ++++DL   +E+    S              
Sbjct: 374 LPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCI 433

Query: 80  -----HQGSITALKFSKGTKI---EDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKD 131
                H+  ITAL F     +    DK      LTTG+   +  +  +  H+ +    + 
Sbjct: 434 HNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARS 493

Query: 132 WENFGTLKG-HASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQ 190
             N   L G  A  I     +  N    + ++D  +RLW+L   K   +L+         
Sbjct: 494 LNNGACLLGTEAPMIGALQCY--NSALATGTKDGIVRLWDLRVGKPVRLLE----GHTDG 547

Query: 191 FVRWCGDSGEFFAVALLTKVLIYKTSTAKVHREL--DTGKSSIMRMEIENIDGKDYIVLA 248
                 DS +    ++   V I+   T+ +   +  D   SS+      + DGK  I + 
Sbjct: 548 ITSLKFDSEKLVTGSMDNSVRIWDLRTSSILDVIAYDLPVSSL------DFDGK-LITVG 600

Query: 249 FGNGTVSMFPAKSLYDEEASEEPVTPE--FNLQGH--TNRVKDFKFYKNEFGHYLVTIGS 304
              G V++F      + E  E  +TPE   +L G   + R+   K YK+ F   L+   +
Sbjct: 601 ANEGGVNVF------NMERDEHWMTPEPPHSLDGDELSRRIAIVK-YKDGF---LINGHN 650

Query: 305 DGKIVVWDM 313
           DG I VW +
Sbjct: 651 DGDINVWTL 659

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 33  PIFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKF 89
           P+   + H+  +  L      LV+GS D  +RI+DL+    L  ++++   +++L F
Sbjct: 537 PVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILD-VIAYDLPVSSLDF 592

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 57/142 (40%), Gaps = 22/142 (15%)

Query: 194 WCGDSGEFFAVALLTKV--LIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGN 251
           WC      F + L   +  L    S   +   LD+GK  ++R +I N++      +A  +
Sbjct: 95  WCPRDTPSFQITLDASITALCLHPSLPIIFIGLDSGK--LLRYDILNVELPLQSTMAHMD 152

Query: 252 GTVSM---FP---AKSLYDEEASEEPVTPEFNLQ------------GHTNRVKDFKFYKN 293
           G  S+    P    +  Y    S++  T  + L+            GH + V D +F++ 
Sbjct: 153 GITSISISLPNENGRPAYLATTSKDLNTKIWELELDSTLSHIKTLAGHEHTVSDCQFFER 212

Query: 294 EFGHYLVTIGSDGKIVVWDMSN 315
                L T   D  + +WD+SN
Sbjct: 213 GADLLLATCSRDLYLKIWDISN 234

>CAGL0J07854g complement(765463..766761) similar to sp|P53851
           Saccharomyces cerevisiae YNL253w, hypothetical start
          Length = 432

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 7/83 (8%)

Query: 34  IFHFQAHSLSVKCLDISK--RYLVSGSNDEHIRIYDLQKR---KELGTLLSHQGSITALK 88
           +    AH  SV CL I    RYL SGS D    I++L+     KE+  L S+  S+    
Sbjct: 248 VLEVTAHRFSVTCLKIDPLGRYLFSGSKDGSCSIWELRTLICIKEISGLESNILSMDICH 307

Query: 89  FSK--GTKIEDKNEDDTGLTTGR 109
             K  G  +ED+      +TTG+
Sbjct: 308 LGKMLGLCLEDERVCFCDVTTGK 330

>Kwal_56.22345
          Length = 396

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 101/247 (40%), Gaps = 26/247 (10%)

Query: 100 EDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKG--HASRINDFDIHPSN-RI 156
           E+  GL     +   LIS SDD ++ IW +K  +   T     H+  +N+   H S+  I
Sbjct: 160 ENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNI 219

Query: 157 AISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQF--VRWCGDSGEFFAVALLTKVLIY- 213
             SVSED       LM   K     L+K  Q   F  + +   S   FA A  T  ++Y 
Sbjct: 220 YGSVSEDSF-----LMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAA-GTDAMVYL 273

Query: 214 ---KTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTV----SMFPAKSLYDEE 266
              +  T  +H  +   + ++  +E  +   KD I+ + G+        +F   +   EE
Sbjct: 274 FDSRKPTEALHS-MSGHQEAVTSLEFAH--HKDGILCSGGSDRRVLLWDLFQIGTEQQEE 330

Query: 267 ASEEPVTPEFNLQ--GHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDC 324
            +++   PE  +   GH + + DF F  N     + ++  +  + +W  S K     +  
Sbjct: 331 DADD-GGPELLMMHAGHKSAINDFSFSPN-VPWLMASVEEENIVQIWKPSRKLTNPYFPQ 388

Query: 325 GERLNCL 331
           G  +  L
Sbjct: 389 GYDIRSL 395

>KLLA0D12760g complement(1090428..1091909) weakly similar to
           sgd|S0006168 Saccharomyces cerevisiae YPL247c, start by
           similarity
          Length = 493

 Score = 32.7 bits (73), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 271 PVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMS 314
           P TP   L+GH   V   +++  + G  LV+ G D +++ WD S
Sbjct: 389 PGTPLLTLEGHIGPVNQVQWHPKKSG-VLVSCGDDCQVLYWDTS 431

>Kwal_33.15591
          Length = 714

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 49/120 (40%), Gaps = 30/120 (25%)

Query: 47  LDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLT 106
           +D S     S SND  ++I D++  K L TL+ H+  + ++KF+    +           
Sbjct: 192 IDASGEKFASCSNDGTVKINDMEG-KTLKTLVGHESFVYSVKFAPNGDV----------- 239

Query: 107 TGRGNSKWLISASDDHNLVIWRVKDWENFGTLKG----HASRINDFDIHPSNRIAISVSE 162
                    IS  +D  + IW+       GT+K      A    D DI P+  I I  S+
Sbjct: 240 ---------ISCGEDRTVRIWKAD-----GTVKQVIRVPAVSTWDLDILPNGDILIGCSD 285

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 82/198 (41%), Gaps = 44/198 (22%)

Query: 35  FHFQAHSLSVKCLDISKRYLVSGSNDEHIRIY-----------------DLQKRKELGTL 77
           F    H  +V  L+ S+ Y++SGS D   +++                 D++   E+G  
Sbjct: 99  FVLIGHENNVCVLNSSQGYVLSGSWDTTAKVWFQGALKHELKGHTASVWDVKMLPEVGFY 158

Query: 78  LSHQGSITALKFSKGTKIEDKNEDDTGLTTG-------RGNSKWLISASDDHNLVIWRVK 130
           ++     T +K  +G K+    +  TGL T          + +   S S+D  +   ++ 
Sbjct: 159 MTASADGT-IKLWEGEKVL---KTFTGLHTDVIRHIDIDASGEKFASCSNDGTV---KIN 211

Query: 131 DWE--NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNL-MTVKKAGVLKLKKYN- 186
           D E     TL GH S +      P+  + IS  ED ++R+W    TVK+  V+++   + 
Sbjct: 212 DMEGKTLKTLVGHESFVYSVKFAPNGDV-ISCGEDRTVRIWKADGTVKQ--VIRVPAVST 268

Query: 187 ------QNGQFVRWCGDS 198
                  NG  +  C DS
Sbjct: 269 WDLDILPNGDILIGCSDS 286

>Kwal_47.17572
          Length = 434

 Score = 32.7 bits (73), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 60/139 (43%), Gaps = 24/139 (17%)

Query: 241 GKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQG-HTNRVKDFKFYKNEFGHYL 299
           G DY+ +   NG V       +YD + ++ P+    N  G H   ++   + KN  G YL
Sbjct: 38  GGDYLAMGCTNGAVI------IYDMDTAK-PIAMLGNKGGAHVRSIQSIAWSKN--GRYL 88

Query: 300 VTIGSDGKIVVWDMS---NKEQVAVYD-----CGERL----NCLALCDESVEKYEMMKKR 347
           +T   D  + VWD+S      + AV+D     C   L     C A   E+   Y  +   
Sbjct: 89  LTSSRDWTVKVWDLSMPGEPMRQAVFDSPIWACQWSLISEWKCFATTYEN--PYAFVIDF 146

Query: 348 VAEEADLGEQSEVEEDTES 366
            ++E ++ +   VEE  ES
Sbjct: 147 SSKEPEITKLCSVEELEES 165

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 119/290 (41%), Gaps = 40/290 (13%)

Query: 32  TPIFHFQAH---SLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQG-SITAL 87
           T I  +  H   + S++ +  +   L+SG ND  I+++D    +EL  L +++G S+T  
Sbjct: 126 TKIAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHEREL--LRTYEGHSMT-- 181

Query: 88  KFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRIND 147
                  I+D N  D G +          SAS D  + IW  +       L+   S  N 
Sbjct: 182 -------IKDLNFTDNGHS--------FASASFDKWVKIWNTEKGIIDKRLR-FNSVPNC 225

Query: 148 FDIHPSNRIAISVSEDHS-IRLWNLMTVKKAGVLKLKKYNQNGQF-VRWCGDSGEFFAVA 205
              HP ++  + V   +S IR ++L   +  G ++   ++Q     +++  D  +  + +
Sbjct: 226 ITFHPKDKNQLVVGLSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSS 285

Query: 206 LLTKVLIYKTSTAKVHRELD-TGKSSIMRMEIENIDGKDYIVLAFGNG--TVSMFPAKSL 262
               V I++       +++  T + S+  ++I N  G+ +   +  N   T SM P    
Sbjct: 286 EDKTVRIWENRINIPIKQISGTAQHSMPWIDI-NPQGQSFCTQSMDNTIYTYSMLPKYKR 344

Query: 263 YDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWD 312
           +          P    +GH        F  +  G Y+ +  S G+  +WD
Sbjct: 345 H----------PNKTFKGHNTTGYGIHFAFSPDGQYIASGDSKGQTFIWD 384

>Scas_717.68
          Length = 908

 Score = 32.7 bits (73), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 114 WLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN-RIAISVSEDHSIRLWNLM 172
           +LI++S D  + +W ++   +  T + H   +     HP++ R  IS   DH +RLW+++
Sbjct: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 15/77 (19%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSK 113
           +V  S+D  IRI+DL+K+K L  L   Q   +  K                L T +G  +
Sbjct: 488 IVVTSSDSRIRIFDLEKKKLLEYLKGFQSGASQHK--------------ACLATVKGQ-Q 532

Query: 114 WLISASDDHNLVIWRVK 130
            ++S+SDDH +  W++K
Sbjct: 533 VVLSSSDDHWVHGWKLK 549

>ABL141C [451] [Homologous to ScYNL182C - SH] (131672..133228) [1557
           bp, 518 aa]
          Length = 518

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 12/73 (16%)

Query: 111 NSKWLISASDDHNLVIWRV------KDWENFGTLKGHASRINDFDIHPS------NRIAI 158
           N K++++A  D  L+IW+       ++ +    L  H   I DF +  +      N    
Sbjct: 140 NGKYVVTAGADSRLIIWQTASLVLEEEPKPLYVLHDHTLAITDFAVSNAHNGKYLNSKLY 199

Query: 159 SVSEDHSIRLWNL 171
           +VSED ++R + L
Sbjct: 200 TVSEDMTVRCYQL 212

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 39/92 (42%), Gaps = 7/92 (7%)

Query: 42  LSVKCLDISKRYLVSGSNDEHIR---IYDLQKRKELGTLLSHQGSITALKFSKGTKIEDK 98
           L+  C D  K  L+ G  D  I    ++       L TL+ HQG++ +L F  G  I   
Sbjct: 57  LNSVCYDSEKELLLFGGKDTMINGVPLFATSGEDPLYTLIGHQGNVCSLSFQDGVVIS-G 115

Query: 99  NEDDTGLTTGRGNSKWLISASDDHNLVIWRVK 130
           + D T      G+  + + A   HN  +W  K
Sbjct: 116 SWDKTAKVWKEGSLVYNLQA---HNASVWDAK 144

>YER124C (DSE1) [1554] chr5 complement(407338..409059) Protein
           involved in cell wall metabolism, shows
           daughter-specific expression regulated by Ase2p and
           Cbk1p [1722 bp, 573 aa]
          Length = 573

 Score = 32.3 bits (72), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 36  HFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQK--RKELGTLLSHQGSITALKFSKGT 93
           H Q  + S+ C+ IS  ++    ND+ I+I+D+Q    K +  L + +G I +LKF++ T
Sbjct: 312 HLQRKNTSLDCVWISNHHVAQSLNDK-IQIWDIQSCDGKPVCELYAKKGYIESLKFNENT 370

>Scas_706.24
          Length = 460

 Score = 32.3 bits (72), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 78/191 (40%), Gaps = 30/191 (15%)

Query: 140 GHASRINDFDIHPS--NRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVR--WC 195
           G+   IND   +PS  N  A +VS  + I +WN+       V KL+  +     V+   C
Sbjct: 103 GNDKVINDLSFNPSELNEFA-TVSNSNEIFIWNIQNDSSPTVNKLRTLSLPSSKVKVNRC 161

Query: 196 GDSGE---FFAVALLTKVLIYKT-------STAKVHRELDTGKSSIMRMEIENIDGKDYI 245
                   FFA      + IY         ++  VH   D   + I  +  +N  GK +I
Sbjct: 162 AYDPRGIWFFAATKSDCLYIYNVKEEHSMVASLPVHSISDENDT-IYSISWDN-SGK-FI 218

Query: 246 VLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNL--QGHTNRVKDFKFYKNEFGHYLVTIG 303
            + F +G +++         E S++     F L  Q H + +   K   +  G +++T  
Sbjct: 219 FIGFRSGKLALL--------EVSDDTGEMTFKLIVQAHRSAISVIKM--DPVGRFVITGS 268

Query: 304 SDGKIVVWDMS 314
           +DG   +WD S
Sbjct: 269 TDGSCALWDTS 279

>YNL182C (IPI3) [4418] chr14 complement(295960..297627) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has low similarity
           to uncharacterized C. albicans Orf6.5122p [1668 bp, 555
           aa]
          Length = 555

 Score = 32.3 bits (72), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 19/94 (20%)

Query: 111 NSKWLISASDDHNLVIWRVKDW--------ENFGTLKGHASRINDFDIHPSNRIAIS--- 159
           N K++I++ +D  ++IW+  D         +    L  H   + DF +  S    +S   
Sbjct: 150 NGKYIITSGNDSRVIIWQTVDLVSASNDDPKPLCILHDHTLPVTDFQVSSSQGKFLSCTD 209

Query: 160 -----VSEDHSIRLWNLMTVKKAGVLKLKKYNQN 188
                VS+D +IR ++L  +   G  K +K N+N
Sbjct: 210 TKLFTVSQDATIRCYDLSLI---GSKKKQKANEN 240

>AGR067W [4377] [Homologous to ScYDR128W - SH]
           complement(842182..845559) [3378 bp, 1125 aa]
          Length = 1125

 Score = 32.7 bits (73), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 38/204 (18%), Positives = 81/204 (39%), Gaps = 27/204 (13%)

Query: 102 DTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGT---LKGHASRINDFDIHPSN-RIA 157
           D   +   G   W++S S+    ++W +    +      L GH   I D + HP +  + 
Sbjct: 72  DVQWSPHAGKPYWVVSTSN-QKAIVWNLARSSSNAVEHELHGHTRAITDINFHPIHPELL 130

Query: 158 ISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIY--KT 215
            + S D  +  W+ M   +        ++     V+W        A +  + V I+  + 
Sbjct: 131 ATCSIDTYVHAWD-MRCSQRPFYGTSDWSSGASQVKWNFKDANIIASSHASTVFIWDIRK 189

Query: 216 STAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPE 275
            +  ++R L+   SS+  ++  N + +  I+ ++ +GT+  +        +   EP + +
Sbjct: 190 GSVPLYR-LNGSGSSVNNIDF-NRNNECEIMSSYNDGTIKFW--------DYGHEPASAQ 239

Query: 276 FNLQGHTNRVKDFKFYKNEFGHYL 299
           F +        DF  ++   G YL
Sbjct: 240 FTINA------DFPVWR---GRYL 254

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 32.3 bits (72), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
            + H  ++  L      ++SGS D  IR++DL +   L  ++S++  I++L F     + 
Sbjct: 600 LEGHMDAITSLKFDATTIISGSLDGTIRLWDL-RSNNLTDIISYEKPISSLDFDAKHIVV 658

Query: 97  DKNEDDTGLTTGRGNSKW 114
             NE +T +      +KW
Sbjct: 659 ASNEHNTHIYDRNDGNKW 676

 Score = 32.3 bits (72), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 64/156 (41%), Gaps = 14/156 (8%)

Query: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96
             AH   V  L I    L++ S D+ IR +DL   K +     +  S++A K S      
Sbjct: 495 LDAHLDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSS----FM 550

Query: 97  DKNEDDTGLTT------GRGNS--KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDF 148
             NED   L T      G   S    L + + D  + +W ++  E    L+GH   I   
Sbjct: 551 KSNEDSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSL 610

Query: 149 DIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKK 184
               +    IS S D +IRLW+L +     ++  +K
Sbjct: 611 KFDAT--TIISGSLDGTIRLWDLRSNNLTDIISYEK 644

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 13/68 (19%)

Query: 28  TPIFTPIFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL 87
           TPI   I  F A              L +G+ D  IR++D++  + +  L  H  +IT+L
Sbjct: 564 TPIIGSIQSFDA-------------ALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSL 610

Query: 88  KFSKGTKI 95
           KF   T I
Sbjct: 611 KFDATTII 618

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 26/50 (52%)

Query: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWN 170
           DH + +W        G ++GH + I+   +  +  +  + S+D +++LWN
Sbjct: 426 DHIVKLWDYTKKRQIGAMEGHVATISCMQVDKNYNMVATGSKDATVKLWN 475

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 32.3 bits (72), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 57/295 (19%), Positives = 115/295 (38%), Gaps = 39/295 (13%)

Query: 54  LVSGSNDEHIRIYDL-QKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNS 112
            +SG ND  ++I+D+  +R  L     H+ +I+A  FS                    ++
Sbjct: 190 FLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSH-------------------DN 230

Query: 113 KWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVS-EDHSIRLWNL 171
               S+S D  + IW  +  +    L   A+  N    HP N+  + V   D  IR ++L
Sbjct: 231 VQFASSSYDKTVKIWDTETGDIINRLSFKATP-NCMTFHPQNKEQLLVGFSDSKIRHFDL 289

Query: 172 MTVKKAGVLKLKKYNQNG-QFVRWCGDSGEFFAVALLTKVLIYKTS---TAKVHRELDTG 227
              KK GV+++  ++      +R+  D  +F + +    + I++       K   + D  
Sbjct: 290 RVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWENQINIPIKQISDTDQY 349

Query: 228 KSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKD 287
            +  +++  E+     +   +  N ++ ++  K  Y          P    +GH +   +
Sbjct: 350 PAPWIQLHPEH---NQFAAQSMDN-SIYVYSMKPKYKRH-------PRKAFRGHKSAGYN 398

Query: 288 FKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDC--GERLNCLALCDESVEK 340
             F     G Y+    + G++ +WD    + +   +   GE L  +A   +   K
Sbjct: 399 SMFDIAPDGRYVAAGDTSGRLFIWDWKTTKILRQLETTKGETLKQVAWSPQETSK 453

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 280 GHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYDCGER 327
           GH       +F +   GH  ++ G+DG + +WDM ++  +    CG R
Sbjct: 172 GHDRGTTALEFLRKT-GHLFLSGGNDGVLKIWDMYHERLLLRDYCGHR 218

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 32.0 bits (71), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 274 PEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSN--KEQVAVYDCGERLNC 330
           P   L+GH N++ DF++ ++     +++   DG +++WD ++  K+     D    L+C
Sbjct: 84  PNIVLKGHNNKISDFRWSRDS--KRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSC 140

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/138 (19%), Positives = 54/138 (39%), Gaps = 24/138 (17%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQG---------------------SITALKFSKG 92
           +V+GS++  I +YDL+    + T    +G                     S   LK +  
Sbjct: 285 IVAGSDNGAINMYDLRSDCSIATFSLFRGYEERTPTPTYMAANMEYNTAQSPQTLKSTSS 344

Query: 93  TKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHP 152
           + ++++       +    + + + S   D   V+W V   E  G L+GH  R+      P
Sbjct: 345 SYLDNQGVVSLDFS---ASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSP 401

Query: 153 SNRIAISVSEDHSIRLWN 170
                 + S D ++++W+
Sbjct: 402 DGLAVCTGSWDSTMKIWS 419

 Score = 28.5 bits (62), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 8/82 (9%)

Query: 138 LKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGD 197
           LKGH ++I+DF     ++  +S S+D  + +W+  +  K   + L     + Q+V  C  
Sbjct: 88  LKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPL-----DSQWVLSCAI 142

Query: 198 SGEFFAVA---LLTKVLIYKTS 216
           S     VA   L     IY+ S
Sbjct: 143 SPSSTLVASAGLNNNCTIYRVS 164

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 32.0 bits (71), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 115 LISASDDHNLVIWRVKD--WENFGTLKGHASRI--NDFDIHPSNRIAISVSEDHSIRLWN 170
           L S+S D  + IW  +D  WE    L GH   +  +DF+   +     S S+D ++R+W 
Sbjct: 165 LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224

Query: 171 LMT 173
            +T
Sbjct: 225 CLT 227

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 65/176 (36%), Gaps = 35/176 (19%)

Query: 29  PIFTPIFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTL----------- 77
           P    +   + H      +DISK  L +GS D  I++ D++  K +  L           
Sbjct: 2   PNLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRS 61

Query: 78  ---LSHQGSITALKFSKGTKIEDKNEDD-------TGLTTGRGN----------SKWLIS 117
                H   + A  F     I  +++DD         +  G  N            +L +
Sbjct: 62  VAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLAT 121

Query: 118 ASDDHNLVIWRV----KDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLW 169
            S D ++ IW      +++E    L+ H+  +     H S  +  S S D ++R+W
Sbjct: 122 CSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 55/138 (39%), Gaps = 34/138 (24%)

Query: 50  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTG 108
           S+  L +   D  I +YD++     L  +  HQ S+T ++FS  T          G+   
Sbjct: 285 SRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD---------GIICS 335

Query: 109 RGNSKWLISASDDHNLVIW--------RVKDWENFGTLK------GHASRINDFDIHPS- 153
            G+         D   +IW        + +D  + G  +      GH S +N+F  +P  
Sbjct: 336 SGS---------DRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQI 386

Query: 154 NRIAISVSEDHSIRLWNL 171
             +  S  ED+ I+ W +
Sbjct: 387 PWLLASTEEDNVIQAWKV 404

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 66/178 (37%), Gaps = 34/178 (19%)

Query: 148 FDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVLKLKKYNQNGQFVRWCGDSGEFFAVALL 207
           F+ H S  + +S S+D ++ LW++   KK   + L  ++     V+W       F     
Sbjct: 194 FNPHISGEL-LSGSDDTTVALWDIEAAKKPKSI-LTSHDDIVNDVKWHEFESNVFGTVSE 251

Query: 208 TKVL-----------IYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSM 256
            K L           + K  TA     L   K S   +    +D + Y            
Sbjct: 252 DKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIY------------ 299

Query: 257 FPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMS 314
                LYD      P+     + GH + V   +F  +  G  + + GSD + ++WD++
Sbjct: 300 -----LYDMRDMSSPL---HVMSGHQDSVTTVEFSPHTDG-IICSSGSDRRAIIWDLT 348

>Scas_660.8
          Length = 510

 Score = 32.0 bits (71), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 12/117 (10%)

Query: 202 FAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFGNGTVSMFPAKS 261
           FAV   T+V I+ + T +V +     K  +      + DGK   +L  G+ T  +    S
Sbjct: 55  FAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRS-DGK---LLVAGDATGLV----S 106

Query: 262 LYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQ 318
           +YD   S  P T   ++   T+     KF+  +    L+T   D  I +WD+SN  Q
Sbjct: 107 VYD---SYNPRTILLSINASTHPTHVTKFHPQD-NKTLITASDDRVIRLWDISNAYQ 159

>Scas_712.34
          Length = 399

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 288 FKFYKNEFGHYLVTIGSDGKIVVWDMSNKEQVAVYD 323
           F    N  G +L T G D K+ VWD+ +KE+V   +
Sbjct: 297 FALSFNSTGEFLATSGYDSKVRVWDVKSKERVTTLN 332

>Scas_721.7
          Length = 325

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 85/212 (40%), Gaps = 52/212 (24%)

Query: 141 HASRINDFDIHPSNRIAISVSEDHSIRLWNL-------MTVKKAGVLKLKKYNQNGQFVR 193
           H + I++    P N+   S S+D +I + +L       +    A V+ L  YN +G  + 
Sbjct: 56  HVAPISEVAWSPDNQCLASASDDFTIEITHLTHGCLHRLMGHTAPVISL-TYNDSGNLL- 113

Query: 194 WCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENIDGKDYIVLAFG--N 251
                   F  ++   + I+ T    + + +     S++ + I     +D  VLA G  +
Sbjct: 114 --------FTSSMDESIKIWDTFHGAILKTISAHSESVVSLSI--CPDRDSSVLASGSFD 163

Query: 252 GTVSMFPAKS-------LYDEE-ASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIG 303
           G + +F  ++        YD++  S++ V P          +   +F  N  G +L+   
Sbjct: 164 GLIRLFDTRTGHCLKTLTYDKDWKSDDGVVP----------ISQVRFSPN--GKFLLVSS 211

Query: 304 SDGKIVVWDM-----------SNKEQVAVYDC 324
            DG + +WD            S+ E VA+  C
Sbjct: 212 FDGIVKIWDCVRGYVVRTFKPSDGESVALKHC 243

>AFL157C [3038] [Homologous to ScYPL247C - SH] (140404..141720)
           [1317 bp, 438 aa]
          Length = 438

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 271 PVTPEFNLQGHTNRVKDFKFYKNEFGHYLVTIGSDGKIVVWDM 313
           P +P   L+GH   V   K++ ++  + L T G D +I+ WD+
Sbjct: 332 PGSPMLLLEGHAAPVNQLKWHPSK-PNVLATCGDDCQILYWDL 373

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 115 LISASDDHNLVIWRVKDWENFGT----LKGHASRINDFDIHPSN-RIAISVSEDHSIRLW 169
           L +   D N+VI  + D    G+    L+GHA+ +N    HPS   +  +  +D  I  W
Sbjct: 314 LATIQQDSNVVI--ILDMRYPGSPMLLLEGHAAPVNQLKWHPSKPNVLATCGDDCQILYW 371

Query: 170 NLMTVKKA 177
           +L+ +  A
Sbjct: 372 DLLELLSA 379

>ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH]
           (567357..569840) [2484 bp, 827 aa]
          Length = 827

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 140 GHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT---VKKAGVLKLKKYNQNGQF--VRW 194
           GH  +I    I PS     + S+D ++R+W ++T   V KA ++ +K  NQ+     V W
Sbjct: 461 GHKGKIRTLSIDPSGLWLATGSDDGTVRVWEILTGREVYKATIVDIKN-NQDDHIETVEW 519

Query: 195 CGD 197
             D
Sbjct: 520 NPD 522

>CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces
           cerevisiae YAR003w, hypothetical start
          Length = 440

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 10/75 (13%)

Query: 241 GKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFN-LQGHTNRVKDFKFYKNEFGHYL 299
           G DY+ L   NG V ++   +L       +P+T   + L GH   V    +  +  G YL
Sbjct: 37  GGDYLALGCSNGAVIIYDMDTL-------KPITMLGSKLGGHVQAVNSVSW--SGCGRYL 87

Query: 300 VTIGSDGKIVVWDMS 314
           +T   D  I +WD++
Sbjct: 88  ITTSRDWFIKLWDLA 102

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,599,740
Number of extensions: 570419
Number of successful extensions: 3878
Number of sequences better than 10.0: 338
Number of HSP's gapped: 3419
Number of HSP's successfully gapped: 745
Length of query: 390
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 286
Effective length of database: 12,995,837
Effective search space: 3716809382
Effective search space used: 3716809382
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)