Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.87472271238390.0
Sklu_2380.677471727040.0
ACR168W70771921990.0
KLLA0E07986g72172120560.0
Scas_685.1076073920160.0
YKL022C (CDC16)84077418920.0
CAGL0L09823g74370117280.0
Scas_599.58092721686e-12
YHR166C (CDC23)6263901427e-09
AGL294W6562521284e-07
YBL084C (CDC27)7582531231e-06
Kwal_27.107406282631212e-06
CAGL0I02288g6392931185e-06
CAGL0C01903g7692651186e-06
YBR112C (SSN6)9662101178e-06
Scas_680.356312291105e-05
ADL344W9101911105e-05
KLLA0A05258g6322681097e-05
KLLA0B09262g9412101052e-04
Scas_705.559072141052e-04
KLLA0C15455g5662011042e-04
AEL281C1390711052e-04
CAGL0D01364g1148210970.002
Kwal_23.3670802190960.003
ABR206W682217950.003
KLLA0E20933g710163930.005
CAGL0J09570g549122900.011
CAGL0K05599g710105890.017
YPR189W (SKI3)1432126860.042
CAGL0E01573g90459830.090
YDR244W (PEX5)612226820.10
CAGL0K11209g590210810.15
AFR663W1038106790.25
CAGL0L12936g600137780.29
Scas_721.6457850780.33
KLLA0B03520g1401118770.39
Scas_585.491861770.39
KLLA0B09966g370108760.46
KLLA0D01155g335105760.47
KLLA0A07062g58183760.48
Scas_589.5108765750.74
CAGL0G10087g141155750.78
Kwal_23.5408141066750.85
AFR453W56950740.97
Kwal_56.24750619336721.3
YHR117W (TOM71)639167721.4
Scas_718.37d60147711.7
AEL224W58070712.2
YGR047C (TFC4)1025112712.2
YOL145C (CTR9)1077125712.2
CAGL0B01375g111025712.3
Scas_666.2359677702.9
KLLA0B10197g62163693.5
YOR238W303100674.8
CAGL0F04257g34963674.9
KLLA0C02453g102866685.2
CAGL0A03630g106259676.0
ADR280W41860666.5
Kwal_33.14767594146666.9
Scas_631.41398124667.7
Kwal_33.134281052106667.7
Kwal_55.221521101144668.3
CAGL0M01914g67642669.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.874
         (712 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.874                                                          1483   0.0  
Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement     1046   0.0  
ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH] complement...   851   0.0  
KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces c...   796   0.0  
Scas_685.10                                                           781   0.0  
YKL022C (CDC16) [3233] chr11 complement(394369..396891) Componen...   733   0.0  
CAGL0L09823g 1050447..1052678 some similarities with sp|P09798 S...   670   0.0  
Scas_599.5                                                             69   6e-12
YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component...    59   7e-09
AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH] complement...    54   4e-07
YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of...    52   1e-06
Kwal_27.10740                                                          51   2e-06
CAGL0I02288g complement(203605..205524) similar to sp|P16522 Sac...    50   5e-06
CAGL0C01903g complement(199487..201796) similar to sp|P38042 Sac...    50   6e-06
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    50   8e-06
Scas_680.35                                                            47   5e-05
ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH] complement(...    47   5e-05
KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces c...    47   7e-05
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    45   2e-04
Scas_705.55                                                            45   2e-04
KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces...    45   2e-04
AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH] (111535..11...    45   2e-04
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    42   0.002
Kwal_23.3670                                                           42   0.003
ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH] complement(...    41   0.003
KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042 Saccha...    40   0.005
CAGL0J09570g complement(939447..941096) some similarities with s...    39   0.011
CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces c...    39   0.017
YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein w...    38   0.042
CAGL0E01573g complement(148847..151561) similar to sp|P42842 Sac...    37   0.090
YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein ...    36   0.10 
CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces...    36   0.15 
AFR663W [3856] [Homologous to ScYGR047C (TFC4) - SH] complement(...    35   0.25 
CAGL0L12936g 1380327..1382129 similar to sp|P07213 Saccharomyces...    35   0.29 
Scas_721.64                                                            35   0.33 
KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces c...    34   0.39 
Scas_585.4                                                             34   0.39 
KLLA0B09966g complement(872760..873872) similar to sp|P33313 Sac...    34   0.46 
KLLA0D01155g complement(104847..105854) similar to sgd|S0005533 ...    34   0.47 
KLLA0A07062g complement(636546..638291) similar to sp|P15705 Sac...    34   0.48 
Scas_589.5                                                             33   0.74 
CAGL0G10087g 962823..967058 similar to sp|P17883 Saccharomyces c...    33   0.78 
Kwal_23.5408                                                           33   0.85 
AFR453W [3645] [Homologous to ScYDR244W (PEX5) - SH] complement(...    33   0.97 
Kwal_56.24750                                                          32   1.3  
YHR117W (TOM71) [2405] chr8 (342351..344270) Minor import recept...    32   1.4  
Scas_718.37d                                                           32   1.7  
AEL224W [2282] [Homologous to ScYOR027W (STI1) - SH] complement(...    32   2.2  
YGR047C (TFC4) [2012] chr7 complement(586394..589471) RNA polyme...    32   2.2  
YOL145C (CTR9) [4679] chr15 complement(49553..52786) Protein req...    32   2.2  
CAGL0B01375g complement(123330..126662) similar to sp|P89105 Sac...    32   2.3  
Scas_666.23                                                            32   2.9  
KLLA0B10197g complement(891842..893707) weakly similar to sgd|S0...    31   3.5  
YOR238W (YOR238W) [5028] chr15 (783677..784588) Protein of unkno...    30   4.8  
CAGL0F04257g complement(422678..423727) similar to sp|P38199 Sac...    30   4.9  
KLLA0C02453g complement(216740..219826) gi|12656113|gb|AAK00752....    31   5.2  
CAGL0A03630g complement(364712..367900) similar to sp|P33339 Sac...    30   6.0  
ADR280W [2021] [Homologous to ScYDL097C (RPN6) - SH] complement(...    30   6.5  
Kwal_33.14767                                                          30   6.9  
Scas_631.4                                                             30   7.7  
Kwal_33.13428                                                          30   7.7  
Kwal_55.22152                                                          30   8.3  
CAGL0M01914g 232780..234810 some similarities with sp|P14922 Sac...    30   9.0  

>Kwal_14.874
          Length = 722

 Score = 1483 bits (3839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/712 (100%), Positives = 712/712 (100%)

Query: 1   MSRGNTPSQHNSTLAISPLVGSRTLQGPQHRNQTNASSTRQWSGEHRTAQTPHHSVTYSP 60
           MSRGNTPSQHNSTLAISPLVGSRTLQGPQHRNQTNASSTRQWSGEHRTAQTPHHSVTYSP
Sbjct: 1   MSRGNTPSQHNSTLAISPLVGSRTLQGPQHRNQTNASSTRQWSGEHRTAQTPHHSVTYSP 60

Query: 61  LVQKIQNNASLATPAPVQDHGSTAGLLASMTKNGLFGPQIPSTLRKVSIVGDSRRHPGSS 120
           LVQKIQNNASLATPAPVQDHGSTAGLLASMTKNGLFGPQIPSTLRKVSIVGDSRRHPGSS
Sbjct: 61  LVQKIQNNASLATPAPVQDHGSTAGLLASMTKNGLFGPQIPSTLRKVSIVGDSRRHPGSS 120

Query: 121 SGAGGDITDPNAQLDSDHVISAIDIAQLPAAEKLRLWRHDSLMQHQYRTAEFLGDKVYAM 180
           SGAGGDITDPNAQLDSDHVISAIDIAQLPAAEKLRLWRHDSLMQHQYRTAEFLGDKVYAM
Sbjct: 121 SGAGGDITDPNAQLDSDHVISAIDIAQLPAAEKLRLWRHDSLMQHQYRTAEFLGDKVYAM 180

Query: 181 TGDPNDAFWLAQVYYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKKYEDALDIV 240
           TGDPNDAFWLAQVYYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKKYEDALDIV
Sbjct: 181 TGDPNDAFWLAQVYYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKKYEDALDIV 240

Query: 241 GETNPFRDPLGSHVKNQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDVKNFE 300
           GETNPFRDPLGSHVKNQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDVKNFE
Sbjct: 241 GETNPFRDPLGSHVKNQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDVKNFE 300

Query: 301 AFDELISKNLLTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQVFKAHDFLN 360
           AFDELISKNLLTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQVFKAHDFLN
Sbjct: 301 AFDELISKNLLTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQVFKAHDFLN 360

Query: 361 EEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYELGGKN 420
           EEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYELGGKN
Sbjct: 361 EEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYELGGKN 420

Query: 421 KLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHT 480
           KLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHT
Sbjct: 421 KLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHT 480

Query: 481 YAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPL 540
           YAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPL
Sbjct: 481 YAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPL 540

Query: 541 LLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAV 600
           LLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAV
Sbjct: 541 LLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAV 600

Query: 601 TCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLKQALDV 660
           TCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLKQALDV
Sbjct: 601 TCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLKQALDV 660

Query: 661 NMSTILDDSHPLVISSKLQDQNSDVVSRKRAANRVDVRDIAKRLKHGQESSE 712
           NMSTILDDSHPLVISSKLQDQNSDVVSRKRAANRVDVRDIAKRLKHGQESSE
Sbjct: 661 NMSTILDDSHPLVISSKLQDQNSDVVSRKRAANRVDVRDIAKRLKHGQESSE 712

>Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement
          Length = 774

 Score = 1046 bits (2704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/717 (69%), Positives = 590/717 (82%), Gaps = 12/717 (1%)

Query: 1   MSRGNTPSQHNSTLAISPLVGSRTLQGPQHRNQTNASSTRQWSGEHRTAQTPHHSVTYSP 60
           MS GNTPSQHNSTLAISPLV  RT    Q  +Q      R+W G   TAQTPHH VT SP
Sbjct: 54  MSTGNTPSQHNSTLAISPLVTKRTSLHGQKNSQQQHQQLRRWCGATSTAQTPHHPVTNSP 113

Query: 61  LVQKIQNNASLATPAPVQDHGSTAGLLASMTKNGLFGPQIPSTLRKVSIVGDSRRHPGSS 120
           L+QKIQN  SLATPAP    GSTAGLLASM+K+GLFGP +PSTLRK+S+   +R   G +
Sbjct: 114 LIQKIQNPTSLATPAPPAGDGSTAGLLASMSKSGLFGPAVPSTLRKISV---TRSFDGQT 170

Query: 121 SGAGGDITDPNAQLDSD-HVISA--IDIAQLPAAEKLRLWRHDSLMQHQYRTAEFLGDKV 177
           S       D N++LD +  VIS   IDI+ L  AEKLRLWRHD+LMQH YRTAE++GDKV
Sbjct: 171 SAKD----DSNSELDDNLEVISGATIDISTLSPAEKLRLWRHDALMQHHYRTAEYIGDKV 226

Query: 178 YAMTGDPNDAFWLAQVYYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKKYEDAL 237
           Y++T DPNDAFWLAQVYYN+GSYIRAVELLSR+ LDTSSVMCRYLTALCLI+++KY+DAL
Sbjct: 227 YSITRDPNDAFWLAQVYYNNGSYIRAVELLSRDGLDTSSVMCRYLTALCLIKMEKYDDAL 286

Query: 238 DIVGETNPFRDPLGSHVKNQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDVK 297
           DIVGE+NPF+D    HVKNQDGGIKLESS+CYLRGKI+SA N+F+KAK S KEAV VDVK
Sbjct: 287 DIVGESNPFKDVSAQHVKNQDGGIKLESSLCYLRGKIYSAQNNFEKAKQSFKEAVQVDVK 346

Query: 298 NFEAFDELISKNLLTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQVFKAHD 357
           NFEAFDELIS NLLTP++EW F+++LDF+DLDDNE+LI+SLY ++LSKYLNLDQ+ +A +
Sbjct: 347 NFEAFDELISNNLLTPNQEWEFLSTLDFSDLDDNEELIKSLYTTKLSKYLNLDQISEARE 406

Query: 358 FLNEEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYELG 417
           +L  EY L  NTDLI S+ DT FTQCKFS CL LCE+ LE+DEFNF +LP +I+CLYELG
Sbjct: 407 YLINEYNLEDNTDLIRSEIDTFFTQCKFSKCLCLCEQVLERDEFNFYVLPTYIACLYELG 466

Query: 418 GKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGF 477
           GKNKLFL+SHK+AENFPK P+TW GVG YY+  NKVAEARKYFSKASILDP+F QAWIGF
Sbjct: 467 GKNKLFLVSHKLAENFPKSPVTWLGVGTYYLSINKVAEARKYFSKASILDPNFGQAWIGF 526

Query: 478 AHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCPY 537
           AHTYA EGEHEQA+SAYSTASRFFPGTHLPNLFLGMQY++M TL LAEEY  LAYD+CP+
Sbjct: 527 AHTYAAEGEHEQAVSAYSTASRFFPGTHLPNLFLGMQYIVMNTLSLAEEYLTLAYDICPH 586

Query: 538 DPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENE 597
           DPLLLNEMGV+YFKK DY KAKKY KKAWEA K L+S+SK+W+SIHTNL HTYRK+G+ E
Sbjct: 587 DPLLLNEMGVIYFKKSDYPKAKKYFKKAWEASKRLNSDSKAWLSIHTNLGHTYRKMGDYE 646

Query: 598 KAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLKQA 657
           +AV CFK+VLET+ +DT   CA+G +YL++ +IEKAID+LH ALAL+PSNQ AQDLLKQA
Sbjct: 647 RAVACFKIVLETSNQDTSVYCAIGLIYLKLRKIEKAIDSLHNALALQPSNQIAQDLLKQA 706

Query: 658 LDVNMSTILDDSHPLVISSKLQDQNSDVV--SRKRAANRVDVRDIAKRLKHGQESSE 712
           L+VNM T+LD++HPLV+SSK+ +  S+    S+KR         IAKRL  GQ+SS+
Sbjct: 707 LEVNMCTVLDETHPLVVSSKINESASNYFPNSKKRDLVNQSAAKIAKRLIQGQDSSD 763

>ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH]
           complement(650615..652738) [2124 bp, 707 aa]
          Length = 707

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/719 (58%), Positives = 523/719 (72%), Gaps = 27/719 (3%)

Query: 1   MSRGNTPSQHNSTLAISPLVGSRTLQGPQHRNQTNASSTRQWSGEHRTA----QTPHHSV 56
           MS GNTPSQH STLAISP V +R     + R     S+     G    A     TP +SV
Sbjct: 1   MSTGNTPSQHESTLAISPFVTNRGRSQQEQRRVMMPSTGEDSLGPSGMADSGTHTPRNSV 60

Query: 57  TYSPLVQKIQNNASLATPAPVQDHGSTAGLLASMTKNGLFGPQIPSTLRKVSIVGDSRRH 116
            +SPLVQK Q    L TP  + +  +T GLL SM+K  LFGP +PSTLRKVS V + RR 
Sbjct: 61  VHSPLVQKTQ----LGTPY-MAEGAATGGLLGSMSKTALFGPAVPSTLRKVSNVREYRR- 114

Query: 117 PGSSSGAGGDITDPNAQLDSDHVISAIDIAQLPAAEKLRLWRHDSLMQHQYRTAEFLGDK 176
                        P            +D+A+L AAEKLRLWRHD+LMQH YRTAE++GDK
Sbjct: 115 -------------PGDSDGEGGEGYGVDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDK 161

Query: 177 VYAMTGDPNDAFWLAQVYYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKKYEDA 236
           VY+MT DPNDAFWLAQVYYN G YIRAVELLSR+ LD SSVMCRYLTALCL++++KY+DA
Sbjct: 162 VYSMTRDPNDAFWLAQVYYNMGQYIRAVELLSRDGLDASSVMCRYLTALCLVKMEKYDDA 221

Query: 237 LDIVGETNPFRDPLGSHVKNQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDV 296
           LDIVGE NPF+D    HV+N DGGIKLESS+CYLRG+I+SA N+ D AK+  KEAV VDV
Sbjct: 222 LDIVGEVNPFKDDSAEHVRNLDGGIKLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDV 281

Query: 297 KNFEAFDELISKNLLTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQVFKAH 356
           KNFEAFD LIS N+LTP EE  FIA LDFTDLDDN++LIR LY ++LSKY +L ++  AH
Sbjct: 282 KNFEAFDRLISNNMLTPDEETEFIARLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAH 341

Query: 357 DFLNEEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYEL 416
            FL +EY L  N D+  ++ + L  Q K+ +CL+LCE+ LE+DEFNF +LP ++ CLYEL
Sbjct: 342 RFLLDEYHLEDNKDVQTTEIELLIFQGKYLECLELCEKVLEQDEFNFDVLPTYVQCLYEL 401

Query: 417 GGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIG 476
           GGKNKLFL+SHK+AE+FPK  +TWF VG YY   N + EARKYFSKAS+LDP+F  AW+G
Sbjct: 402 GGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLG 461

Query: 477 FAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCP 536
           FAHTYAVEGEHEQA+SAYSTA+RFFPGTHLP+L+LGMQY  M TL LAEEYF++AYD+CP
Sbjct: 462 FAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICP 521

Query: 537 YDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSW-VSIHTNLAHTYRKLGE 595
            DPLLLNE+GV+YFKK DY +AKK+ K+A EAI    S++ S  +S + NL HTYRKL E
Sbjct: 522 TDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDE 581

Query: 596 NEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLK 655
           +E+A+ CFK VLE      +  CAL  VYL+M +++KAIDALH  LA+ P++Q  Q LLK
Sbjct: 582 DERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLK 641

Query: 656 QALDVNMSTILDDSHPLVISSKLQDQNSDVVS--RKRAANRVDVRDIAKRLKHGQESSE 712
            ALDVN+   LD+ HPL++S+K+  +N  + S  +KR+   +D   IAKRLK G  SS+
Sbjct: 642 IALDVNVHLPLDNGHPLMVSAKIS-ENMKMSSNDKKRSLGNIDPVVIAKRLKQGSTSSD 699

>KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces
           cerevisiae YKL022c CDC16 subunit of anaphase-promoting
           complex (cyclosome) singleton, start by similarity
          Length = 721

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/721 (55%), Positives = 520/721 (72%), Gaps = 30/721 (4%)

Query: 2   SRGNTPSQHNSTLAISPLVGSRT--LQGPQHRNQ-TNASSTRQWSGEH----RTAQTPHH 54
           S  +TPS   STLAISPLV  RT   +G  +RN     S  R   G      + AQTPH 
Sbjct: 3   SSHDTPSHVQSTLAISPLV-QRTGANRGSMNRNDPIGNSQGRNVEGGRSNIPQIAQTPHQ 61

Query: 55  SVTYSPLVQKIQNNASLATPAPVQDHGSTAG--LLASMTKNGLFGPQIPSTLRKVSIVGD 112
               SPLVQKI++ + LATPA V  H  TAG  LLASMTKNGLFGP +PSTLRK S   D
Sbjct: 62  D--RSPLVQKIRDVSHLATPA-VMRHNGTAGSSLLASMTKNGLFGPALPSTLRKTSTSTD 118

Query: 113 SRRHPGSSSGAGGDITDPNAQLDSDHVISAIDIAQLPAAEKLRLWRHDSLMQHQYRTAEF 172
           +     S++       D +    SD+V    D++ L + EKLRLWRHD+LMQH Y+TAE 
Sbjct: 119 TVELNNSTN-------DEDIDHASDNVF---DVSDLSSVEKLRLWRHDALMQHHYKTAEH 168

Query: 173 LGDKVYAMTGDPNDAFWLAQVYYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKK 232
           +GD +Y+MT DPNDAFWLAQVYYN GSY+RAVEL+  + LD+ S+MCRYL ALCL +L K
Sbjct: 169 IGDLIYSMTKDPNDAFWLAQVYYNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNK 228

Query: 233 YEDALDIVGETNPFRDPLGSHVKNQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAV 292
            E+ALDI+G+TNPF+    S   N DGG+KLESSMC LRG+I+ +L++ ++AK+  KEAV
Sbjct: 229 LEEALDIIGDTNPFQSEPSS-PGNADGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAV 287

Query: 293 LVDVKNFEAFDELISKNLLTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQV 352
            VDVKN+EAFD L+SK++LT +E+W  + SL F DLDDNE+++R LY+SRLSKY +  ++
Sbjct: 288 QVDVKNYEAFDYLLSKHMLTTAEQWDLVRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEI 347

Query: 353 FKAHDFLNEEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISC 412
             A   L+++Y L  N  ++ ++ + L  Q KF+ C+KLCE+ LE DE+N  +LPI+I C
Sbjct: 348 EHARKVLSDKYYLKDNRTVLLAEIELLNNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQC 407

Query: 413 LYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQ 472
           L+    KNKLFL+SHK+AENFPK P+TWF V  YY+C  KV+EARKYFS++SI+DPSF  
Sbjct: 408 LHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGY 467

Query: 473 AWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAY 532
           +W+GFAHTY  EGEHEQA+SAYSTA+RFFPGTHLP+L+LGMQY  M  L LAEEYF++AY
Sbjct: 468 SWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAY 527

Query: 533 DVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRK 592
           D+CP DPLLLNE+GV+YFK+ +Y KAKKY+K+A +AIK + SESK+W+SI  NL HTYRK
Sbjct: 528 DMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRK 587

Query: 593 LGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQD 652
           LGE+E+A+ CFK VLE++       C+LG++YLRM +IEKAID+ H ALAL   NQA+  
Sbjct: 588 LGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNK 647

Query: 653 LLKQALDVNMSTILDDSHPLVISSKLQDQNSDVVS---RKRAA---NRVDVRDIAKRLKH 706
           LLK AL++N   I+D++HP+VISS +Q+  +  VS   +KR +      D    AKRLK 
Sbjct: 648 LLKTALEINAHMIIDENHPMVISSNIQNIPTSHVSKNDKKRTSLGITSFDPVTEAKRLKQ 707

Query: 707 G 707
           G
Sbjct: 708 G 708

>Scas_685.10
          Length = 760

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/739 (53%), Positives = 518/739 (70%), Gaps = 40/739 (5%)

Query: 2   SRGNTPSQHNSTLAISPLVGSRTL-QGPQHR--------------NQTNASSTRQWSGEH 46
           S   TPSQHNST+AISP VG+RT  + P HR              NQ N S  R  SG  
Sbjct: 6   SPNQTPSQHNSTIAISPFVGNRTRSRLPTHRIHPATNAQRENPLSNQLNQSWNRTVSG-- 63

Query: 47  RTAQTPHHSVTYSPLVQKIQNN---ASLATP-------APVQ-DHGSTAGLLASMTKNGL 95
              Q+P+ S+  SPLVQK   +   ASL TP        P   +    + LLAS++K  +
Sbjct: 64  ---QSPYRSLANSPLVQKTNPSIITASLTTPHQKNTGTIPTNLNANPNSSLLASLSKGNV 120

Query: 96  FGPQIPSTLRKVSI-----VGDSRRHPGSSSGAGGDITDPNAQLDSDHVISAIDIAQLPA 150
           FG  I S+LRKVSI     + ++     + S      T      ++  V   ID+++L +
Sbjct: 121 FGSTISSSLRKVSIQPNSNIPETNTKDENMSNEINKATTTTLTTNTTIVSPEIDLSELTS 180

Query: 151 AEKLRLWRHDSLMQHQYRTAEFLGDKVYAMTGDPNDAFWLAQVYYNSGSYIRAVELLSRN 210
            E+LRLWRHD+LMQH YRTAE++G+K+Y +T DPNDAFWLAQVYYN+  +IRA++LL+++
Sbjct: 181 IERLRLWRHDALMQHMYRTAEYIGNKIYTITEDPNDAFWLAQVYYNNNEFIRAIDLLTKD 240

Query: 211 NLDTSSVMCRYLTALCLIQLKKYEDALDIVGETNPFRDPL--GSHVKNQDGGIKLESSMC 268
           NL++ +++CRYL  LCL +L++Y+DALD+V E NPF D           DGGIK+ESS+C
Sbjct: 241 NLESLNIICRYLMGLCLFKLQRYDDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESSLC 300

Query: 269 YLRGKIFSALNDFDKAKDSLKEAVLVDVKNFEAFDELISKNLLTPSEEWAFIASLDFTDL 328
           YLRG IF+A N+  KAK + KEAVLVDVKN+EAF+ LISKNL++P EEW  + SLDF+ L
Sbjct: 301 YLRGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTL 360

Query: 329 DDNEDLIRSLYVSRLSKYLNLDQVFKAHDFLNEEYKLSSNTDLIHSKADTLFTQCKFSDC 388
            DNE++IR LY   +SKY++ D    A   L++EY LS+N D++  + +TL++QCKFS+C
Sbjct: 361 GDNEEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSEC 420

Query: 389 LKLCEEALEKDEFNFSILPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYM 448
           L+ CE+AL+ DE+N +ILP +ISCLYE  GKNKLFL+SH +AE FPK  ITWF V  YYM
Sbjct: 421 LEACEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYM 480

Query: 449 CSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPN 508
               V +ARKYFSKASILDPSFS AW+GFAHTY +EGEH+QA+SAY+TA+RFFPG H+PN
Sbjct: 481 AIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPN 540

Query: 509 LFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEA 568
           LFLGM+Y+   TL LAEEYF LAYD C YDPLLLNEMGV+YFKK +  K+K+YLKKA EA
Sbjct: 541 LFLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEA 600

Query: 569 IKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMN 628
           ++     S   +SI  NLAHTYRKLGE E+A+ CFKLVLE AGKD +  CALG++YL+  
Sbjct: 601 VRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTK 660

Query: 629 RIEKAIDALHGALALRPSNQAAQDLLKQALDVNMSTILDDSHPLVISSKLQDQNSDVVSR 688
           R+ KAID LH +LAL+PSN +AQ+LL  AL++N S +LD++HPLV++++L   N D + +
Sbjct: 661 RLGKAIDYLHESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAELYSNNEDKLIQ 720

Query: 689 KRAAN--RVDVRDIAKRLK 705
           K+  N    +   ++K++K
Sbjct: 721 KKRGNISSTEAASMSKKMK 739

>YKL022C (CDC16) [3233] chr11 complement(394369..396891) Component
           of anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [2523 bp, 840 aa]
          Length = 840

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/774 (48%), Positives = 520/774 (67%), Gaps = 75/774 (9%)

Query: 1   MSRGNTPSQHNSTLAISPLVGSRTLQGPQHRNQTNASSTRQWSGEHRT--AQTPHHSVTY 58
           MS     SQHNSTLA SP V + +    Q    T+A + R     +RT  A +P+ S+  
Sbjct: 43  MSPSEQHSQHNSTLAASPFVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLAN 102

Query: 59  SPLVQKIQNNASLATPAPVQDHGSTA-----------------GLLASMTKNGLFGPQIP 101
           SPL+QK+Q  A++ TP     H  +A                  LLASM+KN +FG  IP
Sbjct: 103 SPLIQKLQ--ANIMTP-----HQPSANSNSNSNSITGNVVNDNNLLASMSKNSMFGSTIP 155

Query: 102 STLRKVSIVGDSRRHPGSSSGA----------------------------GGDITDPNAQ 133
           STLRKVS+    R +  S  G                             G +       
Sbjct: 156 STLRKVSL---QREYKDSVDGVVRDEDNDEDVHNNGDAAANANNDRESKLGHNGPLTTTT 212

Query: 134 LDSDHVISAIDIAQLPAAEKLRLWRHDSLMQHQYRTAEFLGDKVYAMTGDPNDAFWLAQV 193
           L +    + +D+++L A E+LRLWR D+LMQH YRTAE++ DKVY ++ DP+DAFWL QV
Sbjct: 213 LTTTTTATQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLGQV 272

Query: 194 YYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKKYEDALDIVGETNPF-RDPLGS 252
           YYN+  Y+RAVEL++RNNLD  +++CRYL  L  ++L++++DALD++GE NPF  DP  +
Sbjct: 273 YYNNNQYVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPSTT 332

Query: 253 HVKNQ--------------DGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDVKN 298
                              DGGIK+ESS+C+LRGKI+ A N+F+KA+D+ +EA+LVD+KN
Sbjct: 333 AANTMSNNGNNSNTSQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDIKN 392

Query: 299 FEAFDELISKNLLTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQVFKAHDF 358
           FEAF+ L+SKNLLTP EEW    SLDF +  ++++++++LY   LSKY+N + + K+++ 
Sbjct: 393 FEAFEMLLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSNEI 452

Query: 359 LNEEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYELGG 418
           L ++YKL+ N D++ SK D  +TQCKF++CL+LCE  LE DEFN +ILP +I CLYEL  
Sbjct: 453 LAKDYKLADNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYELSN 512

Query: 419 KNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFA 478
           KNKLFL+SH++AE FPK  ITWF V  YYM  ++++EA+KY+SK+SILDPSF+ AW+GFA
Sbjct: 513 KNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFA 572

Query: 479 HTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCPYD 538
           HTYA+EGE +QA++AYSTASRFFPG HLP LFLGMQ++ M +L LAE YFVLAYD+CP D
Sbjct: 573 HTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPND 632

Query: 539 PLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEK 598
           PL+LNEMGV+YFKK ++ KAKKYLKKA E +K LD  S++ +SI  NL HTYRKL ENE 
Sbjct: 633 PLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEI 692

Query: 599 AVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLKQAL 658
           A+ CF+ VLE   K+++  C+LGY+YL+  +++KAID LH +L L+P+N +A  LLK AL
Sbjct: 693 AIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNAL 752

Query: 659 DVNMSTILDDSHPLVISSKLQDQNSD---VVSRKRAANRVDVRDIAKRLKHGQE 709
           ++N++  LD SHPL+  S L  Q S     +++KR++   D  ++AKRL+  +E
Sbjct: 753 ELNVTLSLDASHPLIDKSNLMSQASKDKASLNKKRSSLTYDPVNMAKRLRTQKE 806

>CAGL0L09823g 1050447..1052678 some similarities with sp|P09798
           Saccharomyces cerevisiae YKL022c CDC16, hypothetical
           start
          Length = 743

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/701 (49%), Positives = 474/701 (67%), Gaps = 54/701 (7%)

Query: 59  SPLVQKIQNNASLATP-----APVQDHGSTAGLLASMTKNGLFGPQIPSTLRKVSIV--- 110
           SPLVQK    ASLATP     A   ++G+   LLASM+KN + G  IPSTLRKVS+    
Sbjct: 30  SPLVQKYAG-ASLATPRKHLGASNSNNGNNGSLLASMSKNSMLGSTIPSTLRKVSLQREF 88

Query: 111 --GDSR----------RHPGSSSG---------AGGDIT-DPNAQLD------------- 135
              DS           R   S+ G         AGGD T  P    +             
Sbjct: 89  HDNDSDVVGAGVGGGPRWSKSAQGDGDVIIVGAAGGDNTASPTGDGEGLNTTTLTTTTTT 148

Query: 136 ----SDHVISAIDIAQLPAAEKLRLWRHDSLMQHQYRTAEFLGDKVYAMTGDPNDAFWLA 191
               + +  + IDIA++P  E+L+LWRHD+ +QH Y TAEF+  K+Y MTGD NDAFWLA
Sbjct: 149 VTSGAGNGSNEIDIAKIPLIERLQLWRHDAWIQHLYGTAEFVATKIYTMTGDANDAFWLA 208

Query: 192 QVYYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKKYEDALDIVGETNPFRDPLG 251
            +YY+ GS+ R +ELL+++++ + S++CRYL A C I +K Y+DALDIVGETNPF D   
Sbjct: 209 LIYYSMGSHNRCIELLTKDDIISVSIVCRYLLARCYIDVKNYDDALDIVGETNPFADTAE 268

Query: 252 SHVK-NQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDVKNFEAFDELISKNL 310
           +  +   DGGIKLESSMC+LRGKI+ A NDF +AK++ KEAVLVD KNFEA+ +L+  +L
Sbjct: 269 ASARIESDGGIKLESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLVDSHL 328

Query: 311 LTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQVFKAHDFLNEEYKLSSNTD 370
           LT +EEW  + SLDF  L D+  L++SLY   LSK  N D++ +A D L ++Y L+ + D
Sbjct: 329 LTTNEEWELLDSLDFDSLGDDSILVKSLYTLELSKNQNQDRITEAQDILRQDYDLADDID 388

Query: 371 LIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYELGGKNKLFLISHKMA 430
           ++ S  D LF QCKFS CL +CE  L++D+FN  ILP +ISCLYE+   NKLFL++H++A
Sbjct: 389 IVTSDIDILFNQCKFSQCLNVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELA 448

Query: 431 ENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQA 490
           E  P++ ITW+ V  YYM  +++ EARKYFSK+SI+DP+F+ AW+GFAHT+A+EGE +QA
Sbjct: 449 EKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQA 508

Query: 491 ISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNEMGVLYF 550
           ISAYSTA+RFFPG  LPNLFLGMQY+   TL LAEEYF LAY+  P DP++LNE+GVL F
Sbjct: 509 ISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKF 568

Query: 551 KKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETA 610
           KKG+  KAK+YLKKA E  K ++  SK+ +S+  NL+HTYR+LGENEKA+     +LE  
Sbjct: 569 KKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDT 628

Query: 611 GKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLKQALDVNMSTILDDSH 670
              ++  C+LG++YL+ N+++KAIDALH  LA+ P N +AQ LL  AL++N++  LD++H
Sbjct: 629 ENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPGNSSAQKLLNYALELNVTLELDENH 688

Query: 671 PLVISSKLQDQN---SDVVSRKRAANRVDVRDIAKRLKHGQ 708
           PLV++S + D+    S +  R++    ++V    KR K GQ
Sbjct: 689 PLVVNSNILDEEHSASKIGKRRQPFESINVD--KKRNKAGQ 727

>Scas_599.5
          Length = 809

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 116/272 (42%), Gaps = 27/272 (9%)

Query: 381 TQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYELGGKNKLFLISHKMAENFPKHPITW 440
           T  K+   L+L +    KD   FS L      L+ L  K  L  +S+ + + F   P TW
Sbjct: 540 TSLKYFKKLRLLQPTRIKDLETFSTL------LWHLHDKTNLTDLSNILMDEFRDKPETW 593

Query: 441 FGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRF 500
             VG  +       EA + F KA+ LDP        F + Y ++G    ++ +Y TA  F
Sbjct: 594 CAVGNLFSLQKDHDEAIRAFDKATKLDP-------NFVYAYTLQGHEYLSMDSYDTAKTF 646

Query: 501 FPGT-----HLPNLF--LGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKG 553
           +        H  N +  +GM  + +G    A  YF  A  + P + +L+   GV   K G
Sbjct: 647 YRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLG 706

Query: 554 DYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKD 613
           +  KA  Y + A + I+   S +K         AH    + +  +A+  F+ +++ A ++
Sbjct: 707 NQEKALNYYELACQ-IQPTSSLAK------FKRAHLLYSMAKYTQALDAFEELIKIAPEE 759

Query: 614 TDTLCALGYVYLRMNRIEKAIDALHGALALRP 645
                 LG +Y  M R + AI     A+ L P
Sbjct: 760 ATVQFILGQLYQIMGRKKDAIKRYTIAMNLDP 791

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/218 (20%), Positives = 95/218 (43%), Gaps = 12/218 (5%)

Query: 472 QAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYF--V 529
           + W    + ++++ +H++AI A+  A++  P         G +YL M +   A+ ++   
Sbjct: 591 ETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKA 650

Query: 530 LAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHT 589
           ++ D+  Y+      MG+   K G+Y +A  Y +KA    ++++  +   +        T
Sbjct: 651 ISNDLHHYNAYY--GMGMCSMKLGEYEQALVYFEKA----RSINPSNAILICC---CGVT 701

Query: 590 YRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQA 649
             KLG  EKA+  ++L  +     +       ++   M +  +A+DA    + + P    
Sbjct: 702 MEKLGNQEKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEAT 761

Query: 650 AQDLLKQALDVNMSTILDDSHPLVISSKLQDQNSDVVS 687
            Q +L Q   + M    D      I+  L  + S+++S
Sbjct: 762 VQFILGQLYQI-MGRKKDAIKRYTIAMNLDPKGSNLIS 798

>YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component of
           anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [1881 bp, 626 aa]
          Length = 626

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 82/390 (21%), Positives = 159/390 (40%), Gaps = 34/390 (8%)

Query: 239 IVGETNPFRDPLGSHVKNQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDVKN 298
           I+ E N F +     + + +  + L + + YLRG I     +  KA  S  +++     N
Sbjct: 190 ILKEINTFLESYEIKIDDDEADLGL-ALLYYLRGVILKQEKNISKAMSSFLKSLSCYSFN 248

Query: 299 FEAF-----------DELISKNLLTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYL 347
           +  +           D L+  N L  + ++ F  +L      +   +I+  +  ++ + L
Sbjct: 249 WSCWLELMDCLQKVDDALLLNNYLYQNFQFKFSENLGSQRTIEFNIMIK-FFKLKVFEEL 307

Query: 348 N--LDQVFKAHDFL-----NEEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDE 400
           N  L+  F+  +FL     N  +  + N  + ++  D +  + +F D +K       +D 
Sbjct: 308 NGQLEDYFEDLEFLLQVFPNFTFLKAYNATISYNNLDYVTAESRFDDIVK-------QDP 360

Query: 401 FNFSILPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYF 460
           +  + L  + + LY +   +KL  ++  +++     P T   +  YY    +  ++  YF
Sbjct: 361 YRLNDLETYSNILYVMQKNSKLAYLAQFVSQIDRFRPETCCIIANYYSARQEHEKSIMYF 420

Query: 461 SKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGT 520
            +A  LD   + AW    H +        AI  Y  A    P        LG  Y ++  
Sbjct: 421 RRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDM 480

Query: 521 LPLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWV 580
              +  YF  A  + P+D  +   +G  Y K G+  +A K  K++ +A + +D  +    
Sbjct: 481 HLYSLYYFQKACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKASQTVDQNT---- 536

Query: 581 SIHTNLAHTYRKLGENEKAVTCFKLVLETA 610
           SI+  LA  Y +L   E    C K +++  
Sbjct: 537 SIYYRLAQLYEEL---EDLQECKKFMMKCV 563

>AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH]
           complement(154711..156681) [1971 bp, 656 aa]
          Length = 656

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 106/252 (42%), Gaps = 10/252 (3%)

Query: 408 IFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILD 467
           ++ + L+ L  K +L  + H++     K+ ITW  +G  +  +    EA K   KA+ L+
Sbjct: 409 VYSTLLWHLHDKIRLADLCHELMAQDDKNCITWCCLGNLFSLNRDHDEAIKALKKATSLN 468

Query: 468 PSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEY 527
           P F+ A+    H Y+     + A   Y  A    P  +  +  LGM  + +G    A  +
Sbjct: 469 PQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLH 528

Query: 528 FVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLA 587
           F  A  + P + +L    GV   + G   KA  + + A E    L   S   +   + L 
Sbjct: 529 FEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACE----LQPNSSLALFKKSQLL 584

Query: 588 HTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSN 647
                LG+   A+  F+ + +    +      LG +Y  + R + AI     A+ L P+ 
Sbjct: 585 FN---LGQYSNALQNFEKLEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMNLDPN- 640

Query: 648 QAAQDLLKQALD 659
                L+K+AL+
Sbjct: 641 --GIQLVKEALE 650

>YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of
           anaphase-promoting complex (APC), required for the
           metaphase-anaphase transition and for Clb2p degradation
           [2277 bp, 758 aa]
          Length = 758

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 102/253 (40%), Gaps = 8/253 (3%)

Query: 406 LPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASI 465
           + IF + L+ L  K K   +++ + +  P  P TW  +G           A K F KA+ 
Sbjct: 509 MEIFSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQ 568

Query: 466 LDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAE 525
           LDP+F+ A+    H ++     + A + Y  A    P  +     LG   + +G    A 
Sbjct: 569 LDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEAL 628

Query: 526 EYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTN 585
            YF  A  + P + +L+   G    K G   KA +Y + A   ++   S SK        
Sbjct: 629 LYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACH-LQPTSSLSK------YK 681

Query: 586 LAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRP 645
           +      +     A+  F+ +++    D      LG  Y  + R + AI  L  A+ L P
Sbjct: 682 MGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDP 741

Query: 646 -SNQAAQDLLKQA 657
             NQ   D L++ 
Sbjct: 742 KGNQVIIDELQKC 754

>Kwal_27.10740
          Length = 628

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 107/263 (40%), Gaps = 10/263 (3%)

Query: 397 EKDEFNFSILPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEA 456
           E   F    + IF + L+ L     L  + H++ E     P TW  +G  +       E+
Sbjct: 370 EAQPFRLPDMEIFSTLLWHLNDTTGLSHLCHELLEVNRLAPETWCCIGNLFSLKKDHEES 429

Query: 457 RKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYL 516
            K F +++ LDPSF+ A+    H Y+     + A++ Y  A       +     LGM  L
Sbjct: 430 IKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYGLGMCSL 489

Query: 517 IMGTLPLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSES 576
            +G       +F  A  + P + +L+   GV   K     +A +    A E       + 
Sbjct: 490 KLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACEL------QP 543

Query: 577 KSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDA 636
            S +++    A     +G+   A+  F+ +++ A  +      LG +Y  + R + A+  
Sbjct: 544 MSSLALFKR-AQLLLAMGKYNYALESFEKLVKIAPDEATIHFLLGQLYQIVGRKQDAVKE 602

Query: 637 LHGALALRPSNQAAQDLLKQALD 659
           L  A+ L P       L+K AL+
Sbjct: 603 LTIAMNLDPK---GSQLIKSALE 622

>CAGL0I02288g complement(203605..205524) similar to sp|P16522
           Saccharomyces cerevisiae YHR166c CDC23, hypothetical
           start
          Length = 639

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 118/293 (40%), Gaps = 17/293 (5%)

Query: 369 TDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYELGGKNKLFLISHK 428
           T L   KA T +    + +  ++ E+ +E D +    +  F + LY +    KL  ++  
Sbjct: 342 TFLQAQKALTSYQYMDYVNSEQIFEKIMEDDPYRLDDMDTFSNILYVMQKNAKLAYLAQF 401

Query: 429 MAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHE 488
           +++     P T   +  YY    +  ++  YF +A  LD   + AW    H +       
Sbjct: 402 VSQIDRFRPETCCVIANYYSARQEHEKSIMYFRRALTLDKKTTSAWTLMGHEFVELKNSN 461

Query: 489 QAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNEMGVL 548
            AI +Y  A    P        LG  Y ++     +  YF  A  + P D  +   +G  
Sbjct: 462 AAIESYRRAVDIDPRDFRAWYGLGQAYEVLDMHLYSLYYFQRACILKPLDKRMWQALGSC 521

Query: 549 YFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAV----TCFK 604
           Y K G++++A K  ++A +    L ++S+   ++   LA  + +    +K       C +
Sbjct: 522 YAKVGNHAEAIKCYERALQ----LTTQSEQDTALLYKLALLFEQTNGIDKCKLLMEKCVE 577

Query: 605 LVLETAGKDTDTLCA----LGYVYLRMNRIEKAIDALHGALALRPSNQAAQDL 653
           +   T G  TD        L    L+ N   KA D     LA+  SN  +Q++
Sbjct: 578 IERITEGLVTDESVKARLWLAKFELKTNNYVKAYD-----LAVGVSNGTSQEM 625

>CAGL0C01903g complement(199487..201796) similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex, hypothetical start
          Length = 769

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 103/265 (38%), Gaps = 8/265 (3%)

Query: 394 EALEKDEFNFSILPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKV 453
           +  E   +  S   IF + L+ L    +L  +   +   +P  P TW  VG Y       
Sbjct: 508 QLFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPNKPETWCCVGNYLSLKKDH 567

Query: 454 AEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGM 513
            +A + F KA+ +DP F+ A+    H  +     + A   +  A    P  +     +G+
Sbjct: 568 EDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGI 627

Query: 514 QYLIMGTLPLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALD 573
             + +G    A  YF  A  + P + +L+   GV   K     KA +Y    +E    L 
Sbjct: 628 YSMKLGHYDEALLYFEKARQIYPINAVLICCCGVALEKLEYQDKALEY----YELACTLQ 683

Query: 574 SESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKA 633
             S        NL +    +G    A+  F+ + +   ++      LG +Y  M R  +A
Sbjct: 684 PNSNLARFKRANLLYA---MGRYNLALQSFEELSKLTPEEPTVHFVLGQLYQIMGRKNEA 740

Query: 634 IDALHGALALRP-SNQAAQDLLKQA 657
           I     A+ L P  NQ   D L++ 
Sbjct: 741 IREFTVAMNLDPKGNQLILDALEKC 765

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by sequence-specific
           DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex
           undergoes Hog1p-dependent conversion to a
           transcriptional activator [2901 bp, 966 aa]
          Length = 966

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 91/210 (43%), Gaps = 13/210 (6%)

Query: 447 YMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHL 506
           Y   +    A + + +A +++P  S  W    H Y +  + ++A +AY  A       ++
Sbjct: 90  YRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNV 149

Query: 507 PNLF--LGMQYLIMGTLPLAEEYFVLAYDVCPY---DPLLLNEMGVLYFKKGDYSKAKKY 561
           P L+  +G+ Y   G+L  AEE F    ++ P+      +   +G++Y  +G +S+A + 
Sbjct: 150 PKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALEC 209

Query: 562 LKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALG 621
            +       A   E   W  + + L      +GE + A   ++ VL         L  LG
Sbjct: 210 FRYILPQPPAPLQEWDIWFQLGSVL----ESMGEWQGAKEAYEHVLAQNQHHAKVLQQLG 265

Query: 622 YVY----LRMNRIEKAIDALHGALALRPSN 647
            +Y    ++    +KA+D L  +L   PS+
Sbjct: 266 CLYGMSNVQFYDPQKALDYLLKSLEADPSD 295

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 95/227 (41%), Gaps = 27/227 (11%)

Query: 434 PKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQA---WIGFAHTYAVEGEHEQA 490
           P  P  W G+G  Y     +  A + F+K   LDP F +A   +      Y  +G+  QA
Sbjct: 147 PNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQA 206

Query: 491 ISAYSTASRFFPGTHLP----NLF--LGMQYLIMGTLPLAEEYF--VLAYDVCPYDPLLL 542
           +  +       P    P    +++  LG     MG    A+E +  VLA +   +   +L
Sbjct: 207 LECF---RYILPQPPAPLQEWDIWFQLGSVLESMGEWQGAKEAYEHVLAQNQ--HHAKVL 261

Query: 543 NEMGVLYFKKG----DYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEK 598
            ++G LY        D  KA  YL K+ EA     S++ +W   H    H  R   +   
Sbjct: 262 QQLGCLYGMSNVQFYDPQKALDYLLKSLEADP---SDATTW--YHLGRVHMIRT--DYTA 314

Query: 599 AVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRP 645
           A   F+  +    ++    C++G +Y ++++   A+DA   A+ L P
Sbjct: 315 AYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNP 361

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%)

Query: 584 TNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGAL 641
           T+LAH YR     ++A   ++  L    + +D    LG+ YL ++ +++A +A   AL
Sbjct: 84  TSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 141

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 1/67 (1%)

Query: 435 KHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAV-EGEHEQAISA 493
           ++PI W  +G  Y   ++  +A   +++A  L+P  S+ W      Y     +   A+ A
Sbjct: 328 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDA 387

Query: 494 YSTASRF 500
           Y  A+R 
Sbjct: 388 YKQAARL 394

>Scas_680.35
          Length = 631

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 91/229 (39%), Gaps = 8/229 (3%)

Query: 391 LCEEALEKDEFNFSILPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCS 450
           L E+ ++ D +    L  + + LY +   +KL  ++  +A+       T   +  YY   
Sbjct: 356 LFEQVVKMDPYRLDDLDTYSNILYVMQKHSKLAYLAQFVAQIDKFRSETCCIMANYYSAR 415

Query: 451 NKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLF 510
            +  ++  YF +A  L+   + AW    H +        AI  Y  A             
Sbjct: 416 QEHEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDINVRDFKAWYG 475

Query: 511 LGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIK 570
           LG  Y ++     +  YF  A  + P D  +   +G  Y K G+ ++A K  ++A +   
Sbjct: 476 LGQAYEVLDMHLYSLYYFQKACTLKPLDRRMWQALGTCYTKIGNKTEAIKCFERAIQLSG 535

Query: 571 ALDSESKSWVSIHTNLAHTYRKLGE----NEKAVTCFKLVLETAGKDTD 615
             D ++    ++  NLA  Y +L +     +  + C  +  +  G+ TD
Sbjct: 536 NADQDT----TLMYNLAKLYDQLNDAANCKQYMIRCVNMEAQMDGQQTD 580

>ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH]
           complement(103567..106299) [2733 bp, 910 aa]
          Length = 910

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 83/191 (43%), Gaps = 12/191 (6%)

Query: 447 YMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHL 506
           Y   +    A + + +A  ++P     W    H Y +  + ++A +AY  A       ++
Sbjct: 106 YRSRDVFQRAAELYQRALAVNPELGDVWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNV 165

Query: 507 PNLF--LGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNE----MGVLYFKKGDYSKAKK 560
           P L+  +G+ Y   G+L  AEE F    ++ P+    +NE    +G++Y  +G +++A +
Sbjct: 166 PKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHF-EKVNEIYFRLGIIYKHQGKWNQALE 224

Query: 561 YLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCAL 620
             +       A   E   W  + + L      +GE + A   ++ VL    +    L  L
Sbjct: 225 CFRYILPQPPAPLQEWDVWFQLGSVL----ESMGEWQGAREAYEHVLSQNDRHAKVLQQL 280

Query: 621 GYVYLRMNRIE 631
           G +Y  MN ++
Sbjct: 281 GCLY-GMNNVQ 290

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 80/209 (38%), Gaps = 9/209 (4%)

Query: 439 TWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTAS 498
           TW  + +          A   +      +PS ++A    AH Y      ++A   Y  A 
Sbjct: 64  TWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDVFQRAAELYQRAL 123

Query: 499 RFFPGTHLPNLFLGMQYLIMGTLPLAEEYF--VLAYDVCPYDPLLLNEMGVLYFKKGDYS 556
              P        LG  YL++  L  A   +   L +   P  P L + +G+LY + G   
Sbjct: 124 AVNPELGDVWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIGILYDRYGSLD 183

Query: 557 KAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAG---KD 613
               Y ++A+  +  LD   +    I+  L   Y+  G+  +A+ CF+ +L       ++
Sbjct: 184 ----YAEEAFAKVLELDPHFEKVNEIYFRLGIIYKHQGKWNQALECFRYILPQPPAPLQE 239

Query: 614 TDTLCALGYVYLRMNRIEKAIDALHGALA 642
            D    LG V   M   + A +A    L+
Sbjct: 240 WDVWFQLGSVLESMGEWQGAREAYEHVLS 268

 Score = 37.0 bits (84), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 85/222 (38%), Gaps = 17/222 (7%)

Query: 434 PKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSF---SQAWIGFAHTYAVEGEHEQA 490
           P  P  W G+G  Y     +  A + F+K   LDP F   ++ +      Y  +G+  QA
Sbjct: 163 PNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKVNEIYFRLGIIYKHQGKWNQA 222

Query: 491 ISAYSTASRFFPGTHLPN------LFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNE 544
           +  +       P    P         LG     MG    A E +            +L +
Sbjct: 223 LECF---RYILPQPPAPLQEWDVWFQLGSVLESMGEWQGAREAYEHVLSQNDRHAKVLQQ 279

Query: 545 MGVLY-FKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCF 603
           +G LY      +   +  L    ++++A  +++ +W   H    H  R   +   A   F
Sbjct: 280 LGCLYGMNNVQFYDPQTALNLLLKSLEADSTDATTW--YHLGRIHMVRN--DYTAAYDAF 335

Query: 604 KLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRP 645
           +  +    ++    C++G +Y ++++   A+DA   A+ L P
Sbjct: 336 QQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNP 377

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 574 SESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKA 633
           S +++W+SI  +LA T   LG+ ++A   +   L+     T  L +L ++Y   +  ++A
Sbjct: 60  SAAETWLSI-ASLAET---LGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDVFQRA 115

Query: 634 IDALHGALALRP 645
            +    ALA+ P
Sbjct: 116 AELYQRALAVNP 127

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

Query: 435 KHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTY-AVEGEHEQAISA 493
           ++P  W  +G  Y   ++  +A   +++A  L+P  S+ W      Y     +   A+ A
Sbjct: 344 RNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDA 403

Query: 494 YSTASRFFP 502
           Y  A R  P
Sbjct: 404 YKQAVRLDP 412

>KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces
           cerevisiae YHR166c CDC23 subunit of anaphase-promoting
           complex (cyclosome), start by similarity
          Length = 632

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 102/268 (38%), Gaps = 29/268 (10%)

Query: 339 YVSRLSKYLNLDQVFKAHDFLNEEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEK 398
           Y+  L + +   +VF    FL  ++ L +   + ++ A+ +F            +E +  
Sbjct: 320 YIEELGEIM---KVFPNFSFLRAQHALINYKYMDYANAEIVF------------DELVTM 364

Query: 399 DEFNFSILPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARK 458
           D +    L  + + LY L    KL  ++   A      P T   +  Y+    +  ++  
Sbjct: 365 DPYRLDDLDTYSNVLYVLQKPYKLAYLAQYAANVDIYRPETCCIIANYFSSKQQHEKSIL 424

Query: 459 YFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIM 518
           YF +A +LD S++ AWI   H +        AI  Y  AS   P        LG  Y ++
Sbjct: 425 YFRRALMLDKSYTHAWILMGHEFIEMKNSHAAIECYRRASDVNPRDFQAWYGLGQAYEVL 484

Query: 519 GTLPLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKS 578
                A  YF  A  + P D  +       Y K          L K  +AIK     S+ 
Sbjct: 485 DKHSFALYYFQKACALKPLDKRMWFASASCYEK----------LDKTVQAIKCFQRSSQ- 533

Query: 579 WVSIHTNLAHTYR--KLGENEKAVTCFK 604
            +S   +++  YR  KL E    V+  K
Sbjct: 534 -LSGEQDISILYRLAKLHEKNNDVSSCK 560

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8 general repressor
           of transcription singleton, hypothetical start
          Length = 941

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 85/210 (40%), Gaps = 21/210 (10%)

Query: 447 YMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHL 506
           Y   +    A + + +A   +P     W    H Y +  E + A +AY  A       ++
Sbjct: 152 YRSRDMFQRAAELYQRALSANPELGDIWATLGHCYLMLDELQNAYAAYQQALYHLSNPNI 211

Query: 507 PNLF--LGMQYLIMGTLPLAEEYFVLAYDVCPYDPLL--LNE----MGVLYFKKGDYSKA 558
           P L+  +G+ Y   G+L  AEE F     V   DP     NE    +G++Y  +G +++A
Sbjct: 212 PKLWHGIGILYDRYGSLDYAEEAFA---KVLELDPQFEKANEIYFRLGIIYKHQGKWNQA 268

Query: 559 KKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLC 618
            +  +       A   E   W      L      +GE + A   ++ ++    +    L 
Sbjct: 269 LECFRYILPQPPAPLQEWDVWFQ----LGSVLESMGEWQGARDAYEHIISQNDRHAKVLQ 324

Query: 619 ALGYVYLRMNRI-----EKAIDALHGALAL 643
            LG +Y  MN +     +KA++ L  +L +
Sbjct: 325 QLGCLY-GMNNVSFYDPQKALNLLLKSLEI 353

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 84/222 (37%), Gaps = 17/222 (7%)

Query: 434 PKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQA---WIGFAHTYAVEGEHEQA 490
           P  P  W G+G  Y     +  A + F+K   LDP F +A   +      Y  +G+  QA
Sbjct: 209 PNIPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQA 268

Query: 491 ISAYSTASRFFPGTHLPN------LFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNE 544
           +  +       P    P         LG     MG    A + +            +L +
Sbjct: 269 LECFR---YILPQPPAPLQEWDVWFQLGSVLESMGEWQGARDAYEHIISQNDRHAKVLQQ 325

Query: 545 MGVLY-FKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCF 603
           +G LY      +   +K L    ++++   +++ SW   H    H  R   +   A   F
Sbjct: 326 LGCLYGMNNVSFYDPQKALNLLLKSLEIDSTDATSWY--HLGRIHMIR--NDYTSAYDAF 381

Query: 604 KLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRP 645
           +  +    ++    C++G +Y ++ +   A+DA   A+ L P
Sbjct: 382 QQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNP 423

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

Query: 435 KHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAV-EGEHEQAISA 493
           ++P  W  +G  Y    +  +A   +++A  L+P  S+ W      Y     +   A+ A
Sbjct: 390 RNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQVNDALDA 449

Query: 494 YSTASRFFP 502
           Y  A+R  P
Sbjct: 450 YKQAARLDP 458

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%)

Query: 584 TNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGAL 641
           T+LAH YR     ++A   ++  L    +  D    LG+ YL ++ ++ A  A   AL
Sbjct: 146 TSLAHLYRSRDMFQRAAELYQRALSANPELGDIWATLGHCYLMLDELQNAYAAYQQAL 203

>Scas_705.55
          Length = 907

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 89/214 (41%), Gaps = 21/214 (9%)

Query: 447 YMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHL 506
           Y   +    A + + +A  ++P  S  W    H Y +  + ++A ++Y  A       ++
Sbjct: 100 YRSRDMFQRAAELYERALSINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNV 159

Query: 507 PNLF--LGMQYLIMGTLPLAEEYFVLAYDVCPYDPLL--LNE----MGVLYFKKGDYSKA 558
           P L+  +G+ Y   G+L  AEE F     V   DP     NE    +G++Y  +G +++A
Sbjct: 160 PKLWHGIGILYDRYGSLDYAEEAFA---KVLELDPQFEKANEIYFRLGIIYKHQGKWTQA 216

Query: 559 KKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLC 618
            +  +       A   E   W      L      + E + A   ++ VL         L 
Sbjct: 217 LECFRYILNQPPAPLQEWDIWFQ----LGSVLESMNEWQGAREAYEHVLLQNENHAKVLQ 272

Query: 619 ALGYVYLRMNRI-----EKAIDALHGALALRPSN 647
            LG +Y  MN +     +KA++ L  +L + P++
Sbjct: 273 QLGCLY-GMNNVSFYDPQKALNYLLKSLEVDPND 305

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 80/208 (38%), Gaps = 9/208 (4%)

Query: 439 TWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTAS 498
           TW  + +          A   +      +P  ++A    AH Y      ++A   Y  A 
Sbjct: 58  TWLSIASLAETVGDADRAAMAYDATLQFNPQSTKALTSLAHLYRSRDMFQRAAELYERAL 117

Query: 499 RFFPGTHLPNLFLGMQYLIMGTLPLAEEYF--VLAYDVCPYDPLLLNEMGVLYFKKGDYS 556
              P        LG  YL++  L  A   +   L +   P  P L + +G+LY + G   
Sbjct: 118 SINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHGIGILYDRYGSLD 177

Query: 557 KAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAG---KD 613
               Y ++A+  +  LD + +    I+  L   Y+  G+  +A+ CF+ +L       ++
Sbjct: 178 ----YAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQALECFRYILNQPPAPLQE 233

Query: 614 TDTLCALGYVYLRMNRIEKAIDALHGAL 641
            D    LG V   MN  + A +A    L
Sbjct: 234 WDIWFQLGSVLESMNEWQGAREAYEHVL 261

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 86/226 (38%), Gaps = 25/226 (11%)

Query: 434 PKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQA---WIGFAHTYAVEGEHEQA 490
           P  P  W G+G  Y     +  A + F+K   LDP F +A   +      Y  +G+  QA
Sbjct: 157 PNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQA 216

Query: 491 ISAYSTASRFF---PGTHLPN----LFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLN 543
           +  +    R+    P   L        LG     M     A E +            +L 
Sbjct: 217 LECF----RYILNQPPAPLQEWDIWFQLGSVLESMNEWQGAREAYEHVLLQNENHAKVLQ 272

Query: 544 EMGVLYFKKG----DYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKA 599
           ++G LY        D  KA  YL K+ E      ++S +W   H    H  R   +   A
Sbjct: 273 QLGCLYGMNNVSFYDPQKALNYLLKSLEVDP---NDSTTWY--HLGRVHMIR--NDYTAA 325

Query: 600 VTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRP 645
              F+  +    ++    C++G +Y ++++   A+DA   A+ L P
Sbjct: 326 YDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNP 371

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 435 KHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAV-EGEHEQAISA 493
           ++PI W  +G  Y   ++  +A   +++A  L+P  S+ W      Y     +   A+ A
Sbjct: 338 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDA 397

Query: 494 YSTASRFFP 502
           Y  A+R  P
Sbjct: 398 YKQAARLDP 406

>KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, start by similarity
          Length = 566

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 75/201 (37%), Gaps = 17/201 (8%)

Query: 452 KVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFL 511
           K++EA   F  A   DP+   AW+          +    ISA        P      + +
Sbjct: 293 KLSEAALAFEAAVQEDPAHVDAWLKLGLVQTQNEKEMNGISALEQCLSLDPTNQQALMTI 352

Query: 512 GMQYLIMG----TLPLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKA--KKYLKKA 565
            + Y+  G       +   +    Y      P + +E  +  F   + SK    KYL+ A
Sbjct: 353 SISYINEGYDLTAFSMLNRWLDSKYPELTRSPTI-DEANIDRF---NLSKQVITKYLQVA 408

Query: 566 WEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYL 625
             A+  +D E      +   L   +    E  K + CF+  LE    D      LG    
Sbjct: 409 -NALPQVDPE------VQLGLGTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLA 461

Query: 626 RMNRIEKAIDALHGALALRPS 646
             NR E+AI A H ALAL+PS
Sbjct: 462 NSNRSEEAIQAYHKALALKPS 482

>AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH]
           (111535..115707) [4173 bp, 1390 aa]
          Length = 1390

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 34/71 (47%)

Query: 443 VGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFP 502
           +G YY+   + AE+ ++F  A  +D S  +AWIG    YA  G  E +I  +  A    P
Sbjct: 666 LGVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELSP 725

Query: 503 GTHLPNLFLGM 513
                 LFL +
Sbjct: 726 EHKYAGLFLAI 736

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 30/74 (40%)

Query: 434  PKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISA 493
            PK P  WF +    +  + V  A+   ++   L P    +W   A T   EG+  ++   
Sbjct: 974  PKEPTIWFNMSLLALKCHDVEFAKLVLNQLHGLAPQMPHSWFAKALTLEKEGDINESTRM 1033

Query: 494  YSTASRFFPGTHLP 507
            ++ A     G + P
Sbjct: 1034 FAYAFLISNGRYKP 1047

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
           cerevisiae YBR112c CYC8 general repressor of
           transcription, hypothetical start
          Length = 1148

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 88/210 (41%), Gaps = 24/210 (11%)

Query: 456 ARKYFSKASIL-------DPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPN 508
           +R  F KA+ L       +P  S  W    H Y +  + ++A +AY  A       ++P 
Sbjct: 94  SRDMFQKAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPK 153

Query: 509 LF--LGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAW 566
           L+  +G+ Y   G+L  AEE F    ++ P+      +   +YF+ G   K +    +A 
Sbjct: 154 LWHGIGILYDRYGSLDYAEEAFAKVLELDPH----FEKANEIYFRLGIIYKHQGKWSQAL 209

Query: 567 EAIKALDSES----KSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGY 622
           E  + + ++     + W  I   L      +GE + A   ++ VL            LG 
Sbjct: 210 ECFRYILAQPPTPLQEW-DIWFQLGSVLESMGEWQGAREAYEHVLLQNDHHAKVFQQLGC 268

Query: 623 VYLRMNRI-----EKAIDALHGALALRPSN 647
           +Y  MN +     +KA+  L  +L + PS+
Sbjct: 269 LY-GMNNVQFYDPQKALSYLLKSLEVDPSD 297

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 88/226 (38%), Gaps = 25/226 (11%)

Query: 434 PKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQA---WIGFAHTYAVEGEHEQA 490
           P  P  W G+G  Y     +  A + F+K   LDP F +A   +      Y  +G+  QA
Sbjct: 149 PNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQA 208

Query: 491 ISAYSTASRFF---PGTHLPN----LFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLN 543
           +  +    R+    P T L        LG     MG    A E +        +   +  
Sbjct: 209 LECF----RYILAQPPTPLQEWDIWFQLGSVLESMGEWQGAREAYEHVLLQNDHHAKVFQ 264

Query: 544 EMGVLYFKKG----DYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKA 599
           ++G LY        D  KA  YL K+ E      S++ +W   H    H  R   +   A
Sbjct: 265 QLGCLYGMNNVQFYDPQKALSYLLKSLEVDP---SDATTW--YHLGRVHMIR--SDYTAA 317

Query: 600 VTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRP 645
              F+  +    ++    C++G +Y ++++   A+DA   A+ L P
Sbjct: 318 YDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNP 363

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%)

Query: 584 TNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGAL 641
           T+LAH YR     +KA   ++  L+   + +D    LG+ YL ++ +++A +A   AL
Sbjct: 86  TSLAHLYRSRDMFQKAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 143

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 435 KHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAV-EGEHEQAISA 493
           ++PI W  +G  Y   ++  +A   +++A  L+P  S+ W      Y     +   A+ A
Sbjct: 330 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDA 389

Query: 494 YSTASRFFP 502
           Y  A+R  P
Sbjct: 390 YKQAARLDP 398

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 574 SESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKA 633
           S +++W+SI  +LA T   LG+ ++A   +   L+     T  L +L ++Y   +  +KA
Sbjct: 46  STAETWLSI-ASLAET---LGDADRAAMAYDATLQHNASSTKGLTSLAHLYRSRDMFQKA 101

Query: 634 IDALHGALALRP 645
            +    AL + P
Sbjct: 102 AELYECALQVNP 113

>Kwal_23.3670
          Length = 802

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 77/190 (40%), Gaps = 15/190 (7%)

Query: 447 YMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHL 506
           Y   +    A + + +A  ++P     W    H Y +  + ++A +AY  A       ++
Sbjct: 110 YRSRDMFQRAAELYQRALTVNPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNV 169

Query: 507 PNLF--LGMQYLIMGTLPLAEEYFVLAYDVCPYDPLL--LNE----MGVLYFKKGDYSKA 558
           P L+  +G+ Y   G+L  AEE F     V   DP     NE    +G++Y  +G +++A
Sbjct: 170 PKLWHGIGILYDRYGSLDYAEEAFA---KVLELDPQFEKANEIYFRLGIIYKHQGKWNQA 226

Query: 559 KKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLC 618
            +  +       A   E   W  + + L      + E + A   ++ VL    +    L 
Sbjct: 227 LECFRYILTQPPAPLQEWDVWFQLGSVL----ESMSEWQGAREAYEHVLLQNERHAKVLQ 282

Query: 619 ALGYVYLRMN 628
            LG +Y   N
Sbjct: 283 QLGCLYGMQN 292

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 85/210 (40%), Gaps = 13/210 (6%)

Query: 439 TWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTAS 498
           TW  + +          A   +      +PS ++A    AH Y      ++A   Y  A 
Sbjct: 68  TWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYQRAL 127

Query: 499 RFFPGTHLPNLF--LGMQYLIMGTLPLAEEYF--VLAYDVCPYDPLLLNEMGVLYFKKGD 554
              P   L +++  LG  YL++  L  A   +   L +   P  P L + +G+LY + G 
Sbjct: 128 TVNP--ELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIGILYDRYGS 185

Query: 555 YSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAG--- 611
                 Y ++A+  +  LD + +    I+  L   Y+  G+  +A+ CF+ +L       
Sbjct: 186 LD----YAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILTQPPAPL 241

Query: 612 KDTDTLCALGYVYLRMNRIEKAIDALHGAL 641
           ++ D    LG V   M+  + A +A    L
Sbjct: 242 QEWDVWFQLGSVLESMSEWQGAREAYEHVL 271

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 46/223 (20%), Positives = 86/223 (38%), Gaps = 19/223 (8%)

Query: 434 PKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQA---WIGFAHTYAVEGEHEQA 490
           P  P  W G+G  Y     +  A + F+K   LDP F +A   +      Y  +G+  QA
Sbjct: 167 PNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQA 226

Query: 491 ISAYSTASRFF---PGTHLPN----LFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLN 543
           +  +    R+    P   L        LG     M     A E +            +L 
Sbjct: 227 LECF----RYILTQPPAPLQEWDVWFQLGSVLESMSEWQGAREAYEHVLLQNERHAKVLQ 282

Query: 544 EMGVLY-FKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTC 602
           ++G LY  +   +   +  L    ++++   +++ +W   H    H  R   +   A   
Sbjct: 283 QLGCLYGMQNVQFYNTQTALNLLLKSLEVDSTDATTW--YHLGRIHMVR--NDYTAAYDA 338

Query: 603 FKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRP 645
           F+  +    ++    C++G +Y ++++   A+DA   A+ L P
Sbjct: 339 FQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNP 381

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 574 SESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKA 633
           S +++W+SI  +LA T   LG+ ++A   +   L+     T  L +L ++Y   +  ++A
Sbjct: 64  STAETWLSI-ASLAET---LGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQRA 119

Query: 634 IDALHGALALRP 645
            +    AL + P
Sbjct: 120 AELYQRALTVNP 131

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 30/67 (44%), Gaps = 1/67 (1%)

Query: 435 KHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAV-EGEHEQAISA 493
           ++P  W  +G  Y   ++  +A   +++A  L+P  S+ W      Y     +   A+ A
Sbjct: 348 RNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDA 407

Query: 494 YSTASRF 500
           Y  A+R 
Sbjct: 408 YKQAARL 414

>ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH]
           complement(787181..789229) [2049 bp, 682 aa]
          Length = 682

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 85/217 (39%), Gaps = 9/217 (4%)

Query: 393 EEALEKDEFNFSILPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNK 452
           +E ++ D +    L I+ + LY +   +KL  +S   A+     P T   +  Y+    +
Sbjct: 408 DEIVKLDPYRLDDLDIYSNILYVIQKPHKLAYLSQFAADLDAYRPETCCIIANYFSAKQQ 467

Query: 453 VAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLG 512
             +A  YF +A  L+ + + AW    H +        AI  Y  A    P        LG
Sbjct: 468 HEKAIMYFRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLG 527

Query: 513 MQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKAL 572
             Y ++     A  Y   A  + P D  +   +   Y K    ++A K  ++A +     
Sbjct: 528 QAYEVLDRHLYALYYLQKACSLKPLDKRMWQALANCYDKLDRPNQAIKCFQRASQLSNDQ 587

Query: 573 DSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLET 609
           D      ++I   LA  Y ++   + A++C   +L+ 
Sbjct: 588 D------ITILYYLATLYERV---QDAISCKNYMLKC 615

>KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex (cyclosome), start by
           similarity
          Length = 710

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 77/163 (47%), Gaps = 16/163 (9%)

Query: 152 EKLRLWRHDSLMQHQYRTAEFLGDKVYAMTGDPNDAFW---LAQVYYNSGSYIR-----A 203
           ++L     D L Q    +A F+ + ++A   + +++     LA  +Y+   Y+      A
Sbjct: 71  KRLETLISDHLSQLNIESAVFVSELLFAECSNLDESSQERALANYFYSLSLYLNNDFHTA 130

Query: 204 VELLSRNNLDTSSVMCRYLTALCLIQLKK-YEDALDIVGETNPFRDPLGSHVKNQDGGIK 262
           + + S    D  ++ C Y+ + C ++LKK Y DALD +       D   SH      G  
Sbjct: 131 MHVSSERRHD--NLACAYVYSRCCLKLKKNYSDALDCLLSLQSCWDTCLSHF-----GYP 183

Query: 263 LESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDVKNFEAFDEL 305
            +S++C L GK+F  L+   K++  L+ ++  +   +EA  EL
Sbjct: 184 KKSTICLLVGKLFKLLDHESKSETFLRSSLDGNPYLWEASTEL 226

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 61/146 (41%), Gaps = 2/146 (1%)

Query: 403 FSILPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSK 462
           F  +  F + L+ L  K  L  +  ++      +PI W  +G  +  +    EA   F K
Sbjct: 458 FQDMDTFSTVLWHLQDKTHLSALCAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGK 517

Query: 463 ASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLF-LGMQYLIMGTL 521
           A  LDP F+ A+    H Y+     + A S +  A      TH   L+ LGM  + +G  
Sbjct: 518 AIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALT-IEKTHYNALYGLGMCCVKLGKF 576

Query: 522 PLAEEYFVLAYDVCPYDPLLLNEMGV 547
             A  +F  A  + P + +L    GV
Sbjct: 577 EEALLFFEKARALNPVNVILNCCCGV 602

>CAGL0J09570g complement(939447..941096) some similarities with
           sp|P35056 Saccharomyces cerevisiae YDR244w PAS10
           peroxisomal targeting signal receptor, hypothetical
           start
          Length = 549

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 52/122 (42%), Gaps = 4/122 (3%)

Query: 396 LEKDEFNFSILPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAE 455
           + +D+   ++L +F    Y LG  +       K+ E  PK  ITW  +GA    S +   
Sbjct: 387 ITRDKDILTVLALFN---YLLGRSDNAIKCFEKLLEQDPKDEITWNHLGATLANSKRYDT 443

Query: 456 ARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQY 515
           A + +     L PSF +A      T    GE ++ I +  TA     G+ +P +   ++ 
Sbjct: 444 AIQVYMNTIELKPSFVRARYNLGSTLVKNGELQRGIESLLTA-LVMQGSPIPPIATNLES 502

Query: 516 LI 517
            I
Sbjct: 503 FI 504

>CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces
           cerevisiae YOR080w, hypothetical start
          Length = 710

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 48/105 (45%), Gaps = 6/105 (5%)

Query: 544 EMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWV-SIHTNLAHTYRKLGENEKAVTC 602
           E+G  YFK  DY KA+   +K   A+K +DS SK  +  +   + H      E  K V C
Sbjct: 12  ELGTTYFKSEDYRKARSLFEK---ALKLVDSYSKDEIKKLRGEIYHVDELPDELYKRVKC 68

Query: 603 FKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSN 647
            +++  T  K    L  L   + + N ++ A+   H  + L P N
Sbjct: 69  ERII--THPKHVKILDNLSACWEKQNILDNALKLSHKMVKLEPFN 111

>YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein with
           tetratricopeptide (TPR) repeats, part of a system to
           protect cells from double-stranded RNA (dsRNA) viruses
           [4299 bp, 1432 aa]
          Length = 1432

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 52/126 (41%), Gaps = 26/126 (20%)

Query: 549 YFKK-----GDYSKAKKYL------KKAWEAIKALDSE------------SKSWVSIHTN 585
           YFK      GDY+ AK Y+      K  W+A  ++ S             S +W      
Sbjct: 651 YFKAFDLDAGDYTAAK-YITETYASKPNWQAASSIASRLIKGEKAKAELRSNNWPFRVVG 709

Query: 586 LAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRP 645
           +AH  ++  E   ++  F+  L     D ++   LG  Y    RIE +I     A+ LRP
Sbjct: 710 IAHLEKQ--EESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRP 767

Query: 646 SNQAAQ 651
           S+  AQ
Sbjct: 768 SHTFAQ 773

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 34/77 (44%)

Query: 443 VGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFP 502
           VG  ++   + +++ ++F  A  +DP+  ++W+G    Y   G  E +I  +  A +  P
Sbjct: 708 VGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRP 767

Query: 503 GTHLPNLFLGMQYLIMG 519
                  F  +    +G
Sbjct: 768 SHTFAQYFKAISLCDVG 784

>CAGL0E01573g complement(148847..151561) similar to sp|P42842
           Saccharomyces cerevisiae YNL313c, start by similarity
          Length = 904

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%)

Query: 439 TWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTA 497
           TW+  G   +  NK+  A + F++ + LDP+ + +W   +  Y  +G+ ++A S    A
Sbjct: 635 TWYFYGCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQA 693

>YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein
           (peroxin), receptor for proteins carrying peroxisomal
           targeting signal 1 (PTS1) sequence, contains
           tetratricopeptide (TPR) repeats [1839 bp, 612 aa]
          Length = 612

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 46/226 (20%), Positives = 77/226 (34%), Gaps = 59/226 (26%)

Query: 434 PKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISA 493
           P H   W  +G     + K         +   LDP   +A    A +Y  EG     +SA
Sbjct: 344 PDHVDAWLRLGLVQTQNEKELNGISALEECLKLDPKNLEAMKTLAISYINEGYD---MSA 400

Query: 494 YSTASRFFPGTHLPNLF-------------LGMQYLIMGTLPLAEEYFVLAYDVCPYDPL 540
           ++   ++   T  P ++              G  ++ M    + +++  LA ++   DP 
Sbjct: 401 FTMLDKW-AETKYPEIWSRIKQQDDKFQKEKGFTHIDMNA-HITKQFLQLANNLSTIDPE 458

Query: 541 LLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAV 600
           +   +G+L++ K D+                                         +K +
Sbjct: 459 IQLCLGLLFYTKDDF-----------------------------------------DKTI 477

Query: 601 TCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPS 646
            CF+  L     D      LG      NR E+AI A H AL L+PS
Sbjct: 478 DCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 523

>CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, hypothetical start
          Length = 590

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 75/210 (35%), Gaps = 35/210 (16%)

Query: 452 KVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHE-QAISAYSTASRFFPGTHLPNLF 510
           K++EA   F  A   DP    AW+       ++ E E   +SA  T  +  P        
Sbjct: 301 KLSEAALAFEAAIKQDPKHVDAWLKLG-IVQIQNEKELNGMSALETCLKLDPNN------ 353

Query: 511 LGMQYLIMGTLPLAEEYFVLAYDVCPYD----------PLLLNEMGVLYFKKGDY----S 556
                 +     LA  Y    YD+  Y+          P   N    L  K+ ++    S
Sbjct: 354 ------LEAMKNLAISYINEGYDMSAYNMLNRWADTKYPGFYNS-AELEGKRDEHENIHS 406

Query: 557 KAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDT 616
           K  +        I ++D +      I   L   +    E ++ + CF+  L+    D   
Sbjct: 407 KMTRRFLSLVNRINSVDPD------IQLCLGLLFYANDEFDRTIDCFQAALKVNPNDELM 460

Query: 617 LCALGYVYLRMNRIEKAIDALHGALALRPS 646
              LG      NR E+AI A H AL L+PS
Sbjct: 461 WNRLGASLANSNRSEEAIQAYHRALQLKPS 490

>AFR663W [3856] [Homologous to ScYGR047C (TFC4) - SH]
           complement(1647675..1650791) [3117 bp, 1038 aa]
          Length = 1038

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 45/106 (42%), Gaps = 2/106 (1%)

Query: 463 ASILDPSFSQAWIGFAHTYAVEGEH-EQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTL 521
           A+ L+PS  + W   A T + E +H  QA+  YS A    P          M Y   G L
Sbjct: 186 AAHLNPSDWEFWKMVA-TLSSELKHIRQAVYCYSRAISMNPQEWECIYSRAMLYKDTGQL 244

Query: 522 PLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWE 567
             + E F   Y   PYD  +L E+ VLY + G    A     K +E
Sbjct: 245 GRSLEGFQRLYKHSPYDSNILRELAVLYVEYGRVQDAIMLYMKVFE 290

>CAGL0L12936g 1380327..1382129 similar to sp|P07213 Saccharomyces
           cerevisiae YNL121c TOM70 or sp|P38825 Saccharomyces
           cerevisiae YHR117w TOM7, hypothetical start
          Length = 600

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 57/137 (41%), Gaps = 11/137 (8%)

Query: 409 FISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDP 468
           FI+  YE  G++       K  E+ PK+   +  +       NK+AE  K F +A    P
Sbjct: 391 FITQNYEKAGED-----FKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFP 445

Query: 469 SFSQAWIGFAHTYAVEGEHEQAISAYSTASRFF---PGTHLPNLFLGMQYLIMGTLPLAE 525
           +  +    +A   A +G+ ++A+  Y+ A R        H+    L  +  I+   P  E
Sbjct: 446 TAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPE 505

Query: 526 EYFVLAY---DVCPYDP 539
            +  ++    D C  DP
Sbjct: 506 NFATISQLLEDACKADP 522

>Scas_721.64
          Length = 578

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%)

Query: 597 EKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPS 646
           +K + CFK  L+    D      LG      N+ E AI A H AL L+PS
Sbjct: 448 DKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKPS 497

>KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces
           cerevisiae YPR189w SKI3 antiviral protein singleton,
           start by similarity
          Length = 1401

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 24/118 (20%)

Query: 546 GVLYFKKGDYSKAKKYLKKA-------WEAIKALDSESKSWVSIHTNLAHTYRKLGENEK 598
           G+++ +  ++ +A K+LK A       WE + A       W  +HT         G  ++
Sbjct: 484 GLIFIEMKNWQEACKFLKDAVVEFPDNWEIVSAY-----GWSLLHT---------GNTQQ 529

Query: 599 AVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKA-IDALHGALALRPSNQAAQDLLK 655
           A+  F+LVLE A   ++ L ++ +  L   RI K  +  +H A  +   N+A Q L++
Sbjct: 530 AINKFRLVLEKAP--SNDLKSIEFRALNCWRIAKCLLHDVHDASDIELINEAYQTLIR 585

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%)

Query: 439  TWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEG 485
            +W+ +    + +N    AR    KA  + P  SQ+W+G A  Y  EG
Sbjct: 988  SWYCMAMLALSNNDTDLARDILMKAQSIAPEDSQSWLGLALIYEKEG 1034

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 27/56 (48%)

Query: 439 TWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAY 494
           +W G+G  Y+   +V  + K F K   LD +   AW   A   +  GE +++I  +
Sbjct: 705 SWVGLGQAYLNCGRVEASIKVFKKVLELDENHHFAWYFLAIALSALGEFDRSIEIF 760

>Scas_585.4
          Length = 918

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%)

Query: 433 FPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAIS 492
           +P +  TW+  G   +  NK+  A + FS+   LDP+ + AW   +  Y    + ++A S
Sbjct: 640 YPLNFETWYFYGCVALECNKMEVAAEAFSRCVSLDPTHAMAWSNLSAAYVELNKLKEAFS 699

Query: 493 A 493
            
Sbjct: 700 C 700

>KLLA0B09966g complement(872760..873872) similar to sp|P33313
           Saccharomyces cerevisiae YBR155w CNS1 singleton,
           hypothetical start
          Length = 370

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 3/108 (2%)

Query: 553 GDYSKAKKYLKKAWEAIKALDSESKSWV---SIHTNLAHTYRKLGENEKAVTCFKLVLET 609
            D  K K++       +KALD +        S++ NLA    ++      +   +  L+ 
Sbjct: 78  NDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREALKL 137

Query: 610 AGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLKQA 657
             K+      +G  YL + R E +++A+   LA+ P N A + +  +A
Sbjct: 138 NAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKA 185

>KLLA0D01155g complement(104847..105854) similar to sgd|S0005533
           Saccharomyces cerevisiae YOR007c SGT2, start by
           similarity
          Length = 335

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 552 KGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAG 611
           +G+ + A K   +A E   A    S S    ++N A  Y  L + E+AV   +  +E   
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 612 KDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLKQ 656
             +     LG+    +N+ E+A+DA    L +    + A D++K+
Sbjct: 161 TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE--GEKATDVMKR 203

>KLLA0A07062g complement(636546..638291) similar to sp|P15705
           Saccharomyces cerevisiae YOR027w STI1 stress-induced
           protein, start by similarity
          Length = 581

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 1/83 (1%)

Query: 538 DPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENE 597
           D   LN      ++KGDY  A + L KA E  + L ++ K        + ++Y KLG+ +
Sbjct: 287 DITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLK 346

Query: 598 KAVTCFKLVLETAGKDTDTLCAL 620
           KA+  ++  L T  +  D L  L
Sbjct: 347 KAIDYYEKSL-TEHRTPDILTKL 368

>Scas_589.5
          Length = 1087

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 525 EEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHT 584
           EE   +  D  P +  LLN +G  YF  GD  KAK+Y   A      L ++S S  +I+ 
Sbjct: 506 EEIQFINKDNVPLE--LLNNIGSFYFINGDADKAKEYFDLAK---SKLSNDSSSLTTINY 560

Query: 585 NLAHT 589
           N+A T
Sbjct: 561 NIART 565

>CAGL0G10087g 962823..967058 similar to sp|P17883 Saccharomyces
           cerevisiae YPR189w SKI3 antiviral protein, start by
           similarity
          Length = 1411

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 29/55 (52%)

Query: 443 VGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTA 497
           +G  Y+   + AE+ ++F  A  +DP+  ++WIG   +Y   G  E ++  +  A
Sbjct: 685 LGVAYLEKQQDAESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERA 739

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 11/80 (13%)

Query: 179 AMTGDPNDA-FW--LAQVYYNSGSYIRAVELLSRN-NLDTSSVMCRYLTALCLIQLKKYE 234
           A+  DP D   W  L Q Y N G    ++++  R  +LD       Y  A+C  QL +YE
Sbjct: 705 ALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDLDEHHSYALYYKAVCHSQLGEYE 764

Query: 235 DAL----DIVGE---TNPFR 247
           ++L    ++VGE   T PF+
Sbjct: 765 ESLKLMYNLVGENPKTIPFK 784

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%)

Query: 434 PKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAI 491
           P    +W G+G  Y+   +V  + K F +A  LD   S A    A  ++  GE+E+++
Sbjct: 710 PTDVESWIGLGQSYLNCGRVEASLKVFERALDLDEHHSYALYYKAVCHSQLGEYEESL 767

>Kwal_23.5408
          Length = 1410

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 30/66 (45%)

Query: 454 AEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGM 513
           +E+ ++F  A  +DPS  ++W+G    Y   G  E ++  +  A    P +   + F  +
Sbjct: 697 SESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSAYAHYFKAL 756

Query: 514 QYLIMG 519
               MG
Sbjct: 757 SLSRMG 762

>AFR453W [3645] [Homologous to ScYDR244W (PEX5) - SH]
           complement(1251018..1252727) [1710 bp, 569 aa]
          Length = 569

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%)

Query: 597 EKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPS 646
           +K + CF+  L     D      LG      NR E+AI A H A+ L+P+
Sbjct: 434 DKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPT 483

>Kwal_56.24750
          Length = 619

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 68/336 (20%), Positives = 130/336 (38%), Gaps = 25/336 (7%)

Query: 239 IVGETNPFRDPLGSHVKNQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDVKN 298
           I+ E N +   L +    Q  G+ L   + YLRG ++   +    A +S   ++ +   N
Sbjct: 198 ILKELNHY---LSTEGNQQTLGVAL---LHYLRGVLYKIQDISSNAINSFLSSLSIFPYN 251

Query: 299 FEAFDELISKNLLTPSEEWAFIASL---DFTDLDDNEDLIRSLYVSRLSKYLNLDQVFKA 355
           +  + EL+S   ++ S+E   +  +    FTD  +   L+   +       L+L Q F  
Sbjct: 252 WACWTELLS--CISRSDESILLLKILNEKFTD--EKSQLMLKFFK------LSLFQEFNG 301

Query: 356 H--DFLNE-EYKLSSNTDLIHSKADTLFTQCKFSDCLK---LCEEALEKDEFNFSILPIF 409
           +  DF+ E +Y LS   +    K         + D +    + E  ++ D +    +  +
Sbjct: 302 NIDDFIQELDYLLSIFPNFAFLKTQHALINYHYMDYVSAGLIFENIIKIDPYRLEDMDTY 361

Query: 410 ISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPS 469
            + LY +   +KL  ++   +        T   +  YY    +  ++  YF +A  L+  
Sbjct: 362 SNILYVMQKPSKLAYLAQFASGVDRFRAETCCIIANYYSAKQEHEKSIMYFRRALTLNKK 421

Query: 470 FSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFV 529
            + AW    H +        AI  Y  A    P        LG  Y ++     +  YF 
Sbjct: 422 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQ 481

Query: 530 LAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKA 565
            +  + P D  +   +   Y K G+ +++ K   +A
Sbjct: 482 KSCALKPLDKRMWQALASCYEKVGNAAESIKCYTRA 517

>YHR117W (TOM71) [2405] chr8 (342351..344270) Minor import receptor
           of the mitochondrial outer membrane, similar to Tom70p
           in sequence and in function, has tetratricopeptide (TPR)
           repeats [1920 bp, 639 aa]
          Length = 639

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 67/167 (40%), Gaps = 21/167 (12%)

Query: 365 LSSNTDLIHS--KADTLFTQCKFSDCLKLC--------------EEALEKDEFNFSILP- 407
           L+ +TD+ HS   A+T+    + +  L LC               + L ++  N    P 
Sbjct: 320 LTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPN 379

Query: 408 --IFIS-CLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKAS 464
             IF++  L +     + F    K  +  P++P T++  G  Y        A++ F KA 
Sbjct: 380 SYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQ 439

Query: 465 ILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPG-THLPNLF 510
            L+P     +I  A     +G+  ++ + ++     FP    +P  F
Sbjct: 440 SLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFF 486

>Scas_718.37d
          Length = 601

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%)

Query: 451 NKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTA 497
           N +  +  Y+ +A   DP+ S  W+  A  Y   G+ E AI++Y  A
Sbjct: 309 NNIPLSYDYYQRAISSDPALSFIWVSIASLYLRLGQIEDAIASYWEA 355

>AEL224W [2282] [Homologous to ScYOR027W (STI1) - SH]
           complement(207712..209454) [1743 bp, 580 aa]
          Length = 580

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%)

Query: 538 DPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENE 597
           D   LN      ++KGDY  A K L+KA E  + L ++ K        L + + KL + +
Sbjct: 286 DITYLNNRAAAEYEKGDYESAIKTLEKAVEEGRELRADYKVIAKSFARLGNAHYKLADLK 345

Query: 598 KAVTCFKLVL 607
           KA+  ++  L
Sbjct: 346 KAIEYYEKSL 355

>YGR047C (TFC4) [2012] chr7 complement(586394..589471) RNA
           polymerase transcription III initiation factor TFIIIC
           (tau), 131 kDa subunit, has 11 tetratricopeptide (TPR)
           repeats [3078 bp, 1025 aa]
          Length = 1025

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 4/112 (3%)

Query: 535 CPYDPLLLNEMGVLYFKKGD-YSKAKKYLKKAWEAIKALDS-ESKSWVSIHTNLAHTYRK 592
           C YD    +++  LYF+     ++A+KY K+A +    L S E      +   LA  Y++
Sbjct: 457 CLYDETF-SDVADLYFEAATALTRAEKY-KEAIDFFTPLLSLEEWRTTDVFKPLARCYKE 514

Query: 593 LGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALR 644
           +   E A   ++L +++   D D   +L  VY R+N  E     L   + +R
Sbjct: 515 IESYETAKEFYELAIKSEPDDLDIRVSLAEVYYRLNDPETFKHMLVDVVEMR 566

>YOL145C (CTR9) [4679] chr15 complement(49553..52786) Protein
           required for normal expression of G1 cyclins CLN1 and
           CLN2, has tetratricopeptide (TPR) repeats and binds
           triplex DNA, may be involved in transcription elongation
           [3234 bp, 1077 aa]
          Length = 1077

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 20/125 (16%)

Query: 537 YDPLLLNEMGVLYFKKGDYSKA-----KKYLKKAWEAIKALDSESKSWVSIHTNLAHTYR 591
           ++P+LL  +   Y+ KGDY         + LK +    K + SES  W          + 
Sbjct: 296 HNPVLLTLLQTYYYFKGDYQTVLDIYHHRILKMSPMIAKIVLSESSFWC------GRAHY 349

Query: 592 KLGENEKAVTCFKLVLETAGKDTDTLCA---LGYVYLRMNRIEKAIDALHGALALRPSNQ 648
            LG+  K+   F+   E+  K+ D L A   LG   ++ N +E++I        L  +N+
Sbjct: 350 ALGDYRKSFIMFQ---ESLKKNEDNLLAKLGLGQTQIKNNLLEESIITFEN---LYKTNE 403

Query: 649 AAQDL 653
           + Q+L
Sbjct: 404 SLQEL 408

>CAGL0B01375g complement(123330..126662) similar to sp|P89105
           Saccharomyces cerevisiae YOL145c CTR9 required for G1
           cyclin expression, hypothetical start
          Length = 1110

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 1/25 (4%)

Query: 539 PL-LLNEMGVLYFKKGDYSKAKKYL 562
           PL +LN +  LYF  GDY KA+KYL
Sbjct: 510 PLEVLNNLSCLYFITGDYEKAQKYL 534

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 56/123 (45%), Gaps = 20/123 (16%)

Query: 539 PLLLNEMGVLYFKKGDYSKA-----KKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKL 593
           P+LL  +   +F KGDY K      +K  K ++ A +++ SES  W    +     YRK 
Sbjct: 297 PVLLVLLQTFFFFKGDYEKVITIHDQKISKLSFLAPESVYSESLFWCGRASYAMGDYRK- 355

Query: 594 GENEKAVTCFKLVLETAGKDTDTLCA---LGYVYLRMNRIEKAIDALHGALALRPSNQAA 650
                    F +  E+  +D + L A   LG   ++ + +E++I       +L  +N+  
Sbjct: 356 --------AFTMFQESLKRDENNLLARLGLGQTQIKNSLVEESILTFE---SLYKANENV 404

Query: 651 QDL 653
           Q+L
Sbjct: 405 QEL 407

>Scas_666.23
          Length = 596

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 435 KHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAY 494
           K+   ++  G  Y  + +  +A + F KA  LDP     +I  A     E + +   + +
Sbjct: 372 KNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDCETLF 431

Query: 495 STASRFFPG-THLPNLF 510
           S A R FP  + +PN +
Sbjct: 432 SEARRKFPNSSEVPNFY 448

>KLLA0B10197g complement(891842..893707) weakly similar to
           sgd|S0002728 Saccharomyces cerevisiae YDR320c SWA2
           clathrin-binding protein required for normal clathrin
           function and for uncoating of clathrin-coated vesicles,
           start by similarity
          Length = 621

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 546 GVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKL 605
           GV YF  GDY  A    +K++  +          +S+ +N+     KLGEN KA+   KL
Sbjct: 340 GVKYFSSGDYHNALLEFEKSFNTLPF--KHPLRIISL-SNIVSCQLKLGENSKALESVKL 396

Query: 606 VLE 608
            L+
Sbjct: 397 ALD 399

>YOR238W (YOR238W) [5028] chr15 (783677..784588) Protein of unknown
           function, has moderate similarity to uncharacterized C.
           albicans Orf6.3018p [912 bp, 303 aa]
          Length = 303

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 22/100 (22%)

Query: 344 SKYLNLDQVFKAHDFLNEEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNF 403
           S+ +N+D++F       EE+ L S  +LI+S         +F +  K   + +    F F
Sbjct: 130 SQNVNVDELFYGGSITTEEFSLDSFDNLIYSIY-------RFEEVNKKFPQKITIIGFAF 182

Query: 404 SILPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGV 443
             +P FISC              H  A ++P+  IT+ G+
Sbjct: 183 K-MPRFISC--------------HAKAIDYPQSNITYIGI 207

>CAGL0F04257g complement(422678..423727) similar to sp|P38199
           Saccharomyces cerevisiae YBL032w, hypothetical start
          Length = 349

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 567 EAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLR 626
           EA K + ++  S  S+  N  +   K+G +EK   C   VL  +G+  D   ALG V   
Sbjct: 13  EAAKVIGTQGNSIQSVRDN--NNNVKIGISEKVPGCSDRVLTCSGEVEDVCSALGDVVTL 70

Query: 627 MNR 629
           +N+
Sbjct: 71  LNK 73

>KLLA0C02453g complement(216740..219826)
           gi|12656113|gb|AAK00752.1|AF229182_1 Kluyveromyces
           lactis transcription factor Tfc4p, start by similarity
          Length = 1028

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 570 KALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNR 629
           +A+   ++ W  I+ N A  Y+++G+  +A   F+ +      D + L  L  +Y+  NR
Sbjct: 204 RAIRINNEEWECIY-NRALLYKEIGQLGRAFDGFQKLYAYDPLDANILRELAVIYVEYNR 262

Query: 630 IEKAID 635
           + +AI+
Sbjct: 263 VSEAIE 268

>CAGL0A03630g complement(364712..367900) similar to sp|P33339
           Saccharomyces cerevisiae YGR047c TFC4, hypothetical
           start
          Length = 1062

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 577 KSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAID 635
           + W  I+   A  Y++ G+  +A+  F+ +   +  D + L  L  +Y+  N++EKAI+
Sbjct: 233 EEWECIYRR-ALLYKQTGQIARALDGFQKMYTKSPSDANILRELAILYVDYNKVEKAIE 290

>ADR280W [2021] [Homologous to ScYDL097C (RPN6) - SH]
           complement(1180818..1182074) [1257 bp, 418 aa]
          Length = 418

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 545 MGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIH---TNLAHTYRKLGENEKAVT 601
           +  LY++KG Y  + + + +  +  K LD +S S V +H   + + H  R L +++ A+T
Sbjct: 127 LATLYYQKGQYHDSLQLINELLKEFKKLDDKS-SLVEVHLLESKVYHKLRNLAKSKAALT 185

>Kwal_33.14767
          Length = 594

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 52/146 (35%), Gaps = 1/146 (0%)

Query: 428 KMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEH 487
           K  E FP+ P T+  +        +  E    F KA  LDP+ +  +      + +  + 
Sbjct: 332 KAVEYFPR-PNTYIYMALIMADKGQATEYFDNFEKALELDPNCAAVYYHRGQMHFITQQF 390

Query: 488 EQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNEMGV 547
           EQA   +  A         P + L       G    +E  F  A    P  P + N    
Sbjct: 391 EQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSETLFSEARRKFPTSPEVPNFYAE 450

Query: 548 LYFKKGDYSKAKKYLKKAWEAIKALD 573
               KGD + AKK    A +   ALD
Sbjct: 451 TLSDKGDIAGAKKEYDIAAKLESALD 476

>Scas_631.4
          Length = 1398

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 56/124 (45%), Gaps = 7/124 (5%)

Query: 531 AYDVCPYDPLLLNEMGVLYFKKGDYSKAKKY---LKKAWEAIKALDSESKSWVSIHTNLA 587
           A+++   D +  N M  +Y K  ++S A +    L KA +A + L  ++ +W      + 
Sbjct: 617 AFELDAGDHIAANYMTEVYAKSNNWSSAVQIAERLVKAEKAKRVL--QTMNWPYRVIGIG 674

Query: 588 HTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSN 647
           +  R+  +   ++  F+  +     D ++   LG  YL   RIE +I     A+ L  S+
Sbjct: 675 NLERQ--QESDSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSH 732

Query: 648 QAAQ 651
             A+
Sbjct: 733 TYAK 736

>Kwal_33.13428
          Length = 1052

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 43/106 (40%)

Query: 463 ASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLP 522
           A+ L+PS  + W   A   A  G   Q+I  Y+ A R             + Y     L 
Sbjct: 211 AAHLNPSDWEFWKVVATLSADLGHIRQSIYCYTRALRMNSEEWECVYGRAVLYRKTNQLG 270

Query: 523 LAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEA 568
            A E F   Y+  P+D  LL E+ VLY      ++A     K +EA
Sbjct: 271 RALEGFQRLYNNNPFDGNLLRELAVLYVDYNRINEAIGLYVKIFEA 316

>Kwal_55.22152
          Length = 1101

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 63/144 (43%), Gaps = 17/144 (11%)

Query: 526 EYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTN 585
           + F     V PY+      + +++ +   Y  A + L+K  ++   LD+ES     +H N
Sbjct: 702 QLFQKVLQVDPYNVFAAQGLSIIFAENKRYGPALEILRKVRDS---LDNES-----VHIN 753

Query: 586 LAHTYRKLGENEKAVTCFKLVLETAGKDTDT---LCALGYVYLRMNRIEKAIDALHGALA 642
           L H   ++ E  KA+  +++ L+    +      L  LG  +      E++++    +L 
Sbjct: 754 LGHCLLEMQEFAKAIENYEIALKKFTNEASRPLLLNLLGRAWYSRGVKERSLECFEKSL- 812

Query: 643 LRPSNQAAQDLLKQALDVNMSTIL 666
                + AQD L   ++ + S ++
Sbjct: 813 -----EYAQDALAAEMERSNSKMV 831

>CAGL0M01914g 232780..234810 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8, general repressor
           of transcription, hypothetical start
          Length = 676

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%)

Query: 456 ARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTA 497
           A +YF  +  L P+    WI  A  Y   G+ E +++ YS A
Sbjct: 320 AYEYFQNSLSLTPNLPFIWISVASLYLTLGQLEDSLATYSQA 361

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,906,561
Number of extensions: 1073413
Number of successful extensions: 3918
Number of sequences better than 10.0: 98
Number of HSP's gapped: 3925
Number of HSP's successfully gapped: 138
Length of query: 712
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 603
Effective length of database: 12,822,747
Effective search space: 7732116441
Effective search space used: 7732116441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)