Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.87227727412071e-169
Kwal_26.841657132618.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.872
         (274 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.872                                                           469   e-169
Kwal_26.8416                                                           28   8.2  

>Kwal_14.872
          Length = 277

 Score =  469 bits (1207), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 233/274 (85%), Positives = 233/274 (85%)

Query: 1   MEDCFLIDFLLEDDYSQGSHDDTLFHSKWLTDESPTCSDGALKQHKKGSRAKLKSRRKRV 60
           MEDCFLIDFLLEDDYSQGSHDDTLFHSKWLTDESPTCSDGALKQHKKGSRAKLKSRRKRV
Sbjct: 1   MEDCFLIDFLLEDDYSQGSHDDTLFHSKWLTDESPTCSDGALKQHKKGSRAKLKSRRKRV 60

Query: 61  KEQCLDDSIEELMDLILKDNKLSLQNDNGFKGNTDKSINHLXXXXXXXXXXXXXXGEFQK 120
           KEQCLDDSIEELMDLILKDNKLSLQNDNGFKGNTDKSINHL              GEFQK
Sbjct: 61  KEQCLDDSIEELMDLILKDNKLSLQNDNGFKGNTDKSINHLASKARRNKNKNSSNGEFQK 120

Query: 121 DLKVIYEGHGTEENFAFDFSGKEDGLVTLQAANLNGMXXXXXXXXXXXXDKILTDSSVER 180
           DLKVIYEGHGTEENFAFDFSGKEDGLVTLQAANLNGM            DKILTDSSVER
Sbjct: 121 DLKVIYEGHGTEENFAFDFSGKEDGLVTLQAANLNGMKKSRRKKKSKSSDKILTDSSVER 180

Query: 181 SQSEPYNSSSIPETIEKPIQSTVAKEAXXXXXXXXXXXXXXXPEASNGGVQTDAKETSQD 240
           SQSEPYNSSSIPETIEKPIQSTVAKEA               PEASNGGVQTDAKETSQD
Sbjct: 181 SQSEPYNSSSIPETIEKPIQSTVAKEAKVSSKKNRSQRKKKNPEASNGGVQTDAKETSQD 240

Query: 241 HQADNKKKGKSSDRRYRRKIQNRESSKSEGLASQ 274
           HQADNKKKGKSSDRRYRRKIQNRESSKSEGLASQ
Sbjct: 241 HQADNKKKGKSSDRRYRRKIQNRESSKSEGLASQ 274

>Kwal_26.8416
          Length = 571

 Score = 28.1 bits (61), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 24/32 (75%)

Query: 46  KKGSRAKLKSRRKRVKEQCLDDSIEELMDLIL 77
           K+ S +K++  ++++KEQ ++ SI+EL +L L
Sbjct: 469 KRSSVSKVQHPKRKLKEQEMEGSIQELSELAL 500

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,080,509
Number of extensions: 304505
Number of successful extensions: 955
Number of sequences better than 10.0: 9
Number of HSP's gapped: 955
Number of HSP's successfully gapped: 9
Length of query: 274
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 174
Effective length of database: 13,134,309
Effective search space: 2285369766
Effective search space used: 2285369766
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 61 (28.1 bits)