Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.86828227914130.0
Sklu_2380.52892909661e-132
CAGL0L09867g2602248831e-120
ACR170C2892678501e-115
KLLA0E08030g3022238421e-113
Scas_685.92001938241e-112
YKL024C (URA6)2042017611e-102
KLLA0F13376g2272092091e-19
Scas_681.182482052065e-19
CAGL0K11418g2222212056e-19
Scas_721.822212091976e-18
CAGL0L11902g2511951971e-17
YDR226W (ADK1)2222091942e-17
AGR187W2772131928e-17
Sklu_2123.22282091872e-16
Kwal_27.116072272101845e-16
KLLA0C17754g2271991792e-15
Kwal_56.234892252031774e-15
AGR115C2512161769e-15
YER170W (ADK2)2251991687e-14
Sklu_2063.3208141770.058
ACL150W219140750.11
Sklu_2430.457171710.60
YDL166C (FAP7)197140690.68
ADR282C22167681.0
KLLA0E21714g32929634.8
Scas_617.742064618.7
YOR154W58794618.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.868
         (279 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.868                                                           548   0.0  
Sklu_2380.5 YKL024C, Contig c2380 11212-12081                         376   e-132
CAGL0L09867g 1054344..1055126 some similarities with sp|P15700 S...   344   e-120
ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH] (653511..65...   332   e-115
KLLA0E08030g complement(724562..725470) some similarities with s...   328   e-113
Scas_685.9                                                            322   e-112
YKL024C (URA6) [3231] chr11 complement(392169..392783) Uridine-m...   297   e-102
KLLA0F13376g 1234589..1235272 highly similar to sp|P07170 Saccha...    85   1e-19
Scas_681.18                                                            84   5e-19
CAGL0K11418g complement(1109653..1110321) highly similar to sp|P...    84   6e-19
Scas_721.82                                                            80   6e-18
CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces...    80   1e-17
YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase (GT...    79   2e-17
AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH] complement(...    79   8e-17
Sklu_2123.2 YDR226W, Contig c2123 4210-4896                            77   2e-16
Kwal_27.11607                                                          75   5e-16
KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces...    74   2e-15
Kwal_56.23489                                                          73   4e-15
AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH] (959464..96...    72   9e-15
YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase (GT...    69   7e-14
Sklu_2063.3 YDL166C, Contig c2063 1224-1850                            34   0.058
ACL150W [899] [Homologous to ScYDL166C (FAP7) - SH] complement(8...    33   0.11 
Sklu_2430.4 YMR105C, Contig c2430 6115-7830                            32   0.60 
YDL166C (FAP7) [705] chr4 complement(163450..164043) Essential p...    31   0.68 
ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)...    31   1.0  
KLLA0E21714g complement(1929294..1930283) gi|1351442|sp|P49378|X...    29   4.8  
Scas_617.7                                                             28   8.7  
YOR154W (YOR154W) [4953] chr15 (624729..626492) Protein of unkno...    28   8.9  

>Kwal_14.868
          Length = 282

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/279 (96%), Positives = 269/279 (96%)

Query: 1   MLKTVFRSRIPSPLIGRTARALPVRIPQIARVYSSNNGPQQTKSRGKXXXXXXXXXXGST 60
           MLKTVFRSRIPSPLIGRTARALPVRIPQIARVYSSNNGPQQTKSRGK          GST
Sbjct: 1   MLKTVFRSRIPSPLIGRTARALPVRIPQIARVYSSNNGPQQTKSRGKLLALVAALAVGST 60

Query: 61  LVSISYQKNGPVEFVEEENSKASTGPAFSDKDVSVIFVLGGPGAGKGTQCANLVRDYQFV 120
           LVSISYQKNGPVEFVEEENSKASTGPAFSDKDVSVIFVLGGPGAGKGTQCANLVRDYQFV
Sbjct: 61  LVSISYQKNGPVEFVEEENSKASTGPAFSDKDVSVIFVLGGPGAGKGTQCANLVRDYQFV 120

Query: 121 HLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVTVALLQQAIQDNYDQGHKRFLVD 180
           HLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVTVALLQQAIQDNYDQGHKRFLVD
Sbjct: 121 HLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVTVALLQQAIQDNYDQGHKRFLVD 180

Query: 181 GFPRKMDQAITFEEQIVPSKFTLFFDCPEKVMLQRLLERGKTSGRSDDNVESIKKRFKTF 240
           GFPRKMDQAITFEEQIVPSKFTLFFDCPEKVMLQRLLERGKTSGRSDDNVESIKKRFKTF
Sbjct: 181 GFPRKMDQAITFEEQIVPSKFTLFFDCPEKVMLQRLLERGKTSGRSDDNVESIKKRFKTF 240

Query: 241 IETSMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAVKE 279
           IETSMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAVKE
Sbjct: 241 IETSMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAVKE 279

>Sklu_2380.5 YKL024C, Contig c2380 11212-12081
          Length = 289

 Score =  376 bits (966), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 197/290 (67%), Positives = 230/290 (79%), Gaps = 18/290 (6%)

Query: 1   MLKTVFRSRIPSPLIGRTARALPVRIPQ---IARVYSSNN---GPQQ------TKSRGKX 48
           ML+TV R+ I      RT   LP+ I +   + R+YS+ N   G  Q      TK RG+ 
Sbjct: 1   MLRTVARTTIAK----RTPNCLPLFINRGLSMTRLYSTQNQQGGQHQEKDQRPTKGRGRA 56

Query: 49  XXXXXXXXXGSTLVSISYQKNGPVEFVEEENSKASTGPAFSDKDVSVIFVLGGPGAGKGT 108
                    GSTL SISYQKN PVEF+E  N+    GPAFS +DVSV+FVLGGPGAGKGT
Sbjct: 57  LLLLGALALGSTLFSISYQKNPPVEFME--NAPEDKGPAFSPEDVSVVFVLGGPGAGKGT 114

Query: 109 QCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVTVALLQQAIQD 168
           QC  LV+DY FVHLSAGDLLRAEQNR+GS+YGALIKHYIKEGLIVPQEVTVALLQ AI++
Sbjct: 115 QCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRE 174

Query: 169 NYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLFFDCPEKVMLQRLLERGKTSGRSDD 228
           N++ G KRFLVDGFPRKMDQAITFE+QIVPSKFTLFFDCPE VML+RLLERGKTSGR+DD
Sbjct: 175 NFEDGKKRFLVDGFPRKMDQAITFEKQIVPSKFTLFFDCPETVMLERLLERGKTSGRTDD 234

Query: 229 NVESIKKRFKTFIETSMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAVK 278
           N+ESIKKRF+TFIETSMPVVEYFEKQ+KV+ VSCD  +++VY++V+ AV+
Sbjct: 235 NIESIKKRFRTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVE 284

>CAGL0L09867g 1054344..1055126 some similarities with sp|P15700
           Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase, hypothetical start
          Length = 260

 Score =  344 bits (883), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 193/224 (86%), Gaps = 4/224 (1%)

Query: 58  GSTLVSISYQKNGPVEFVEEEN----SKASTGPAFSDKDVSVIFVLGGPGAGKGTQCANL 113
           G+T+ S+S +K  P EF+E E      +   GPAFS+  VSVIFVLGGPGAGKGTQCA L
Sbjct: 31  GTTIYSVSNEKGEPKEFLEAEKRAGKQEKQAGPAFSEDQVSVIFVLGGPGAGKGTQCAKL 90

Query: 114 VRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVTVALLQQAIQDNYDQG 173
           V DY+FVHLSAGDLLRAEQNREGS++G LIKHYIKEGLIVPQE+T++LLQ+AI++NY++ 
Sbjct: 91  VNDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEITLSLLQKAIKENYEKN 150

Query: 174 HKRFLVDGFPRKMDQAITFEEQIVPSKFTLFFDCPEKVMLQRLLERGKTSGRSDDNVESI 233
           + +FLVDGFPRKMDQA++FE+QIVPSKFTLFF+CPE+VML+RLLERGKTSGR+DDN+ESI
Sbjct: 151 YTKFLVDGFPRKMDQALSFEKQIVPSKFTLFFECPEQVMLERLLERGKTSGRADDNIESI 210

Query: 234 KKRFKTFIETSMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAV 277
           KKRF+TF ETSMPVV YF+ QDKVV V CDH VE VY QVK A+
Sbjct: 211 KKRFRTFEETSMPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQAL 254

>ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH]
           (653511..654380) [870 bp, 289 aa]
          Length = 289

 Score =  332 bits (850), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 199/267 (74%), Gaps = 10/267 (3%)

Query: 13  PLIGRTARALPVRIPQIARVYSSNNGPQQTKSRGKXXXXXXXXXXGSTLVSISYQKNGPV 72
           P + R+A   P   P      ++   P+    RGK          G+TL SI YQK  P 
Sbjct: 28  PALARSASCRPYSAP------AAGGSPKPRGGRGKLVVLLGALAAGTTLYSIMYQKAPPR 81

Query: 73  EFVEEENSKASTGPAFSDKDVSVIFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQ 132
           E  E E+  A   PA    D SV+FVLGGPG+GKGTQC+ LV   QFVH+ AGDLLR EQ
Sbjct: 82  ELREAEDESARPLPA----DASVVFVLGGPGSGKGTQCSRLVERMQFVHVGAGDLLRDEQ 137

Query: 133 NREGSKYGALIKHYIKEGLIVPQEVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITF 192
           NR GS+YG LIKH+IKEGLIVPQEVTVALL++AI+++Y  G ++FLVDGFPRKMDQA TF
Sbjct: 138 NRPGSQYGELIKHHIKEGLIVPQEVTVALLRRAIEEHYRAGRRKFLVDGFPRKMDQAFTF 197

Query: 193 EEQIVPSKFTLFFDCPEKVMLQRLLERGKTSGRSDDNVESIKKRFKTFIETSMPVVEYFE 252
           E+ +VPSKF LFFDCPE+VML+RLL RG+TSGRSDDN+ESIKKRF+T++ETSMPVVE+F 
Sbjct: 198 EKTVVPSKFVLFFDCPERVMLERLLTRGQTSGRSDDNIESIKKRFRTYVETSMPVVEHFA 257

Query: 253 KQDKVVSVSCDHSVEKVYEQVKAAVKE 279
           +QDKVV +SCD  VE+VY+QV+AAVKE
Sbjct: 258 QQDKVVRLSCDQPVEEVYKQVEAAVKE 284

>KLLA0E08030g complement(724562..725470) some similarities with
           sp|P15700 Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase singleton, hypothetical
           start
          Length = 302

 Score =  328 bits (842), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 160/223 (71%), Positives = 188/223 (84%), Gaps = 3/223 (1%)

Query: 59  STLVSISYQKNGPVEFVEE--ENSKASTGPAFSDKDVSVIFVLGGPGAGKGTQCANLVRD 116
           S++VS+SYQKN PV F E    + K  T PAFS  DV V+FVLGGPGAGKGTQCA LV+D
Sbjct: 77  SSVVSLSYQKNPPVAFEEGPVSDDKKKT-PAFSKDDVLVVFVLGGPGAGKGTQCAKLVKD 135

Query: 117 YQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVTVALLQQAIQDNYDQGHKR 176
           + FVHLSAGDLLRAEQ REGS+YG LIK  IK+G IVPQEVTVALL+ AI  NY+  +K+
Sbjct: 136 FGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVALLKNAITSNYNSSNKK 195

Query: 177 FLVDGFPRKMDQAITFEEQIVPSKFTLFFDCPEKVMLQRLLERGKTSGRSDDNVESIKKR 236
           FLVDGFPRKMDQAITFEE+IVPS  TLFFDCPEK+ML+RLL+RGKTSGR DDN+ESI+KR
Sbjct: 196 FLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIMLERLLQRGKTSGRIDDNIESIQKR 255

Query: 237 FKTFIETSMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAVKE 279
           FKTF+ETS+PVVEYFEKQ+KVV VSC+  V++VY+ V  A+K+
Sbjct: 256 FKTFVETSVPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAIKD 298

>Scas_685.9
          Length = 200

 Score =  322 bits (824), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 152/193 (78%), Positives = 171/193 (88%)

Query: 87  AFSDKDVSVIFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHY 146
           AF+   VSVIFVLGGPGAGKGTQCA LV DY FVHLSAGDLLRAEQNREGS++G LIKHY
Sbjct: 5   AFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHY 64

Query: 147 IKEGLIVPQEVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLFFD 206
           I EGLIVPQE+T+ALL+ AIQ+NYD+G K+FLVDGFPRKMDQA++FEEQIVPSKF LFFD
Sbjct: 65  ITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILFFD 124

Query: 207 CPEKVMLQRLLERGKTSGRSDDNVESIKKRFKTFIETSMPVVEYFEKQDKVVSVSCDHSV 266
           CPE VML+RLL+RGKTSGR DDN+ESIKKRFKTF ETSMPVV+YFE Q KV+ + CD  V
Sbjct: 125 CPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRCDSPV 184

Query: 267 EKVYEQVKAAVKE 279
           + VY+QVKAAV E
Sbjct: 185 DDVYKQVKAAVDE 197

>YKL024C (URA6) [3231] chr11 complement(392169..392783)
           Uridine-monophosphate kinase (uridylate kinase),
           catalyzes the conversion of ATP and UMP to ADP and UDP
           [615 bp, 204 aa]
          Length = 204

 Score =  297 bits (761), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 163/201 (81%)

Query: 79  NSKASTGPAFSDKDVSVIFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSK 138
            +  ++ PAFS   VSVIFVLGGPGAGKGTQC  LV+DY FVHLSAGDLLRAEQ R GS+
Sbjct: 2   TAATTSQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQ 61

Query: 139 YGALIKHYIKEGLIVPQEVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQIVP 198
           YG LIK+ IKEG IVPQE+T+ALL+ AI DN      +FL+DGFPRKMDQAI+FE  IV 
Sbjct: 62  YGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVE 121

Query: 199 SKFTLFFDCPEKVMLQRLLERGKTSGRSDDNVESIKKRFKTFIETSMPVVEYFEKQDKVV 258
           SKF LFFDCPE +ML+RLLERGKTSGRSDDN+ESIKKRF TF ETSMPV+EYFE + KVV
Sbjct: 122 SKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVV 181

Query: 259 SVSCDHSVEKVYEQVKAAVKE 279
            V CD SVE VY+ V+ A+++
Sbjct: 182 RVRCDRSVEDVYKDVQDAIRD 202

>KLLA0F13376g 1234589..1235272 highly similar to sp|P07170
           Saccharomyces cerevisiae YDR226w ADK1 adenylate kinase,
           cytosolic, start by similarity
          Length = 227

 Score = 85.1 bits (209), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 102/209 (48%), Gaps = 33/209 (15%)

Query: 96  IFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQ 155
           + ++G PGAGKGTQ  NL   +   HL+ GD+LR++  ++ +  G   K  + +G +V  
Sbjct: 14  MVLIGPPGAGKGTQAPNLTERFCACHLATGDMLRSQVAKQ-TPLGIEAKKIMDDGKLVSD 72

Query: 156 EVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQIV----PSKFTLFFDCPEKV 211
           E+ + +++  + +N D   K F++DGFPR + QA   +E +     P +  +     +++
Sbjct: 73  EIMINMIKDELTNNQD-CKKGFILDGFPRTIPQAEKLDEMLAQQGRPLEKAVELKIDDEL 131

Query: 212 MLQRLLER--GKTSG-------------------------RSDDNVESIKKRFKTFIETS 244
           ++ R+  R     SG                         RSDDNVE++KKR  ++ + +
Sbjct: 132 LVSRITGRLVHPASGRSYHKVFNPPKTEMKDDITGEDLVQRSDDNVEALKKRLTSYHKQT 191

Query: 245 MPVVEYFEKQDKVVSVSCDHSVEKVYEQV 273
            P+V++++K      V      + V+  +
Sbjct: 192 EPIVDFYKKTGIWAGVDASQPPKTVWSDI 220

>Scas_681.18
          Length = 248

 Score = 84.0 bits (206), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 103/205 (50%), Gaps = 36/205 (17%)

Query: 96  IFVLGGPGAGKGTQCANLVRDYQFVH-LSAGDLLRAEQNREGSKYGALIKHYIKEGLIVP 154
           +  LG PG+GKGTQ + L++    V+ +S+GD+LR E   E +K G L   +I +G ++P
Sbjct: 10  LVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAE-TKLGQLASQFIAQGKLIP 68

Query: 155 QEVTVALLQQAIQD-NYDQGHKR--FLVDGFPRKMDQAITFEEQIVPSKFTLF----FDC 207
            ++   LL   +Q+ N+  G  +  +++DGFPR + QA  F+E +      L      D 
Sbjct: 69  DDLIDKLLISKLQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDV 128

Query: 208 PEKVMLQRLLER--------------------GKTS-------GRSDDNVESIKKRFKTF 240
           P +V+L+R+  R                    GK          RSDD+  + KKR + +
Sbjct: 129 PTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEY 188

Query: 241 IETSMPVVEYFEKQDKVVSVSCDHS 265
            ET  P+ EY++ Q  + ++S + S
Sbjct: 189 HETLGPLKEYYQSQGLLQTISGETS 213

>CAGL0K11418g complement(1109653..1110321) highly similar to
           sp|P07170 Saccharomyces cerevisiae YDR226w ADK1
           adenylate kinase, start by similarity
          Length = 222

 Score = 83.6 bits (205), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 104/221 (47%), Gaps = 33/221 (14%)

Query: 88  FSDKDVSVIFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYI 147
            S  D   + ++G PGAGKGTQ  NLV  +   HL+ GD+LR+ Q  +G++ G   K  +
Sbjct: 1   MSSSDSIRMVLIGPPGAGKGTQAPNLVERFHAAHLATGDMLRS-QISKGTELGLQAKKIM 59

Query: 148 KEGLIVPQEVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFE----EQIVPSKFTL 203
            +G +V  ++ V +++  + +N       F++DGFPR + QA   +    E+  P +  +
Sbjct: 60  DQGGLVSDDIMVNMIKDELTNNP-ACKNGFILDGFPRTIPQAEKLDNMLKERGTPLEKAV 118

Query: 204 FFDCPEKVMLQRLLER--GKTSG-------------------------RSDDNVESIKKR 236
                +++++ R+  R     SG                         RSDDN +++KKR
Sbjct: 119 ELKIDDELLVARITGRLIHPASGRSYHKLFNPPKEDMKDDVTGEPLVQRSDDNEDALKKR 178

Query: 237 FKTFIETSMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAV 277
              + + + P+V++++K      V      E V+  +  A+
Sbjct: 179 LGAYHDQTEPIVDFYKKTGIWADVDASQPPETVWSAILKAL 219

>Scas_721.82
          Length = 221

 Score = 80.5 bits (197), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 98/209 (46%), Gaps = 33/209 (15%)

Query: 96  IFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQ 155
           + ++G PGAGKGTQ  NLV  +   HLS GD+LR+ Q  + ++ G   K  + +G +V  
Sbjct: 8   MVLIGPPGAGKGTQAPNLVEKFHACHLSTGDMLRS-QIAKNTELGQEAKKIMDQGGLVSD 66

Query: 156 EVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQI----VPSKFTLFFDCPEKV 211
           E+ V +++  + +N       F++DGFPR + QA   ++ +     P +  +     + +
Sbjct: 67  EIMVNMIKDELTNN-PACKNGFILDGFPRTIPQAEKLDQMLAERGTPLQRAVELQVDDDL 125

Query: 212 MLQRLLER--GKTSG-------------------------RSDDNVESIKKRFKTFIETS 244
           ++ R+  R     SG                         RSDDN +++KKR   +   +
Sbjct: 126 LVARITGRLIHPASGRSYHKLFNPPKVDMVDDVTGEPLIQRSDDNADALKKRLAGYHAQT 185

Query: 245 MPVVEYFEKQDKVVSVSCDHSVEKVYEQV 273
            P+V++++K      V        V++++
Sbjct: 186 EPIVDFYKKTGIWSGVDASQPPATVWDEI 214

>CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w KAD2, hypothetical start
          Length = 251

 Score = 80.5 bits (197), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 96/195 (49%), Gaps = 34/195 (17%)

Query: 104 AGKGTQCANLVRDY-QFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEV-TVAL 161
           +GKGTQ + L++   +   +S+GD+LR E  + G++ G L   YI +G ++P +V T  L
Sbjct: 19  SGKGTQTSKLLKVLPELKSVSSGDILRHEL-KSGTELGVLAAKYIAQGKLIPDKVITQVL 77

Query: 162 LQQAIQDNYDQGHKRFLVDGFPRKMDQAITFE----EQIVPSKFTLFFDCPEKVMLQRLL 217
           +    ++ +      +L+DGFPR   QA + +    E        +  D PE+V+L+R+ 
Sbjct: 78  IAHLSKEKWLNPQSSWLLDGFPRTERQAFSLDSTLGENNAKLNLVVELDVPEEVILERID 137

Query: 218 ER----------------GKTSG-----------RSDDNVESIKKRFKTFIETSMPVVEY 250
            R                 K +G           RSDDNV+  KKR K + +T  P+ E+
Sbjct: 138 NRYIHVGSGRVYNLQYNPPKVAGKDDVTGEPLVKRSDDNVQVFKKRMKEYKKTLGPIKEH 197

Query: 251 FEKQDKVVSVSCDHS 265
           + KQ  + ++S D S
Sbjct: 198 YAKQGILATISGDTS 212

>YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase
           (GTP:AMP phosphotransferase), cytoplasmic and
           mitochondrial [669 bp, 222 aa]
          Length = 222

 Score = 79.3 bits (194), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 97/209 (46%), Gaps = 33/209 (15%)

Query: 96  IFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQ 155
           + ++G PGAGKGTQ  NL   +   HL+ GD+LR+ Q  +G++ G   K  + +G +V  
Sbjct: 9   MVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRS-QIAKGTQLGLEAKKIMDQGGLVSD 67

Query: 156 EVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFE----EQIVPSKFTLFFDCPEKV 211
           ++ V +++  + +N       F++DGFPR + QA   +    EQ  P +  +     +++
Sbjct: 68  DIMVNMIKDELTNN-PACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDEL 126

Query: 212 MLQRLLER--GKTSG-------------------------RSDDNVESIKKRFKTFIETS 244
           ++ R+  R     SG                         RSDDN +++KKR   +   +
Sbjct: 127 LVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQT 186

Query: 245 MPVVEYFEKQDKVVSVSCDHSVEKVYEQV 273
            P+V++++K      V        V+  +
Sbjct: 187 EPIVDFYKKTGIWAGVDASQPPATVWADI 215

>AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH]
           complement(1102660..1103493) [834 bp, 277 aa]
          Length = 277

 Score = 78.6 bits (192), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 100/213 (46%), Gaps = 33/213 (15%)

Query: 96  IFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQ 155
           + ++G PGAGKGTQ   L   +   HL+ GD+LR++  ++ +  G   K  + +G +V  
Sbjct: 65  MVLIGPPGAGKGTQAPKLKEKFCVCHLATGDMLRSQVAKQ-TALGVQAKKIMDQGGLVSD 123

Query: 156 EVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQIV----PSKFTLFFDCPEKV 211
           E+ V +++  ++ N +  +  F++DGFPR + QA   +E +V    P    +     +++
Sbjct: 124 EIMVNMIKDELRSNPECANG-FILDGFPRTIPQAQKLDEMLVAQGKPLDRAVELKIDDEL 182

Query: 212 MLQRLLER--GKTSG-------------------------RSDDNVESIKKRFKTFIETS 244
           ++ R+  R     SG                         RSDDN +++KKR   +   +
Sbjct: 183 LVARITGRLVHPASGRSYHKLFNPPKVAMTDDVTGDPLVQRSDDNADALKKRLDAYHAQT 242

Query: 245 MPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAV 277
            P+V++++K      V      + V+  +  A+
Sbjct: 243 EPIVDFYKKTGIWAGVDASQPPKTVWSDILKAL 275

>Sklu_2123.2 YDR226W, Contig c2123 4210-4896
          Length = 228

 Score = 76.6 bits (187), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 99/209 (47%), Gaps = 33/209 (15%)

Query: 96  IFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQ 155
           + ++G PGAGKGTQ  NL   +   HL+ GD+LR++  ++ +  G   K  + +G +V  
Sbjct: 15  MVLIGPPGAGKGTQAPNLKERFCACHLATGDMLRSQVAKK-TALGLEAKKIMDQGGLVSD 73

Query: 156 EVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQIV----PSKFTLFFDCPEKV 211
           ++ V ++++ +  N  +    F++DGFPR + QA   +E +     P +  +     +++
Sbjct: 74  DIMVNMIKEELATN-PECKNGFILDGFPRTIPQAEKLDEMLAEQGKPLERAIELKIDDEL 132

Query: 212 MLQRLLER--GKTSG-------------------------RSDDNVESIKKRFKTFIETS 244
           ++ R+  R     SG                         RSDDN +++KKR   + + +
Sbjct: 133 LVARITGRLVHPASGRSYHKLFNPPKVDMKDDVTGEPLVQRSDDNADALKKRLNAYHQQT 192

Query: 245 MPVVEYFEKQDKVVSVSCDHSVEKVYEQV 273
            P+V++++K      V    +   V+  +
Sbjct: 193 EPIVDFYKKTGIWSGVDASQAPSTVWSDI 221

>Kwal_27.11607
          Length = 227

 Score = 75.5 bits (184), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 100/210 (47%), Gaps = 35/210 (16%)

Query: 96  IFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQ 155
           + ++G PGAGKGTQ  NL   +   HL+ GD+LR+ Q  + ++ G   K  + +G +V  
Sbjct: 14  MVLIGPPGAGKGTQAPNLKERFCACHLATGDMLRS-QVAQKTELGLEAKKIMDQGGLVSD 72

Query: 156 EVTVALLQQAIQDNYDQGHKRFLVDGFPR------KMDQAIT-------------FEEQI 196
           ++ V +++  +  N  +    F++DGFPR      K+DQ +T              ++++
Sbjct: 73  DIMVKMIKHELITN-PECKSGFILDGFPRTIPQAEKLDQMLTEQGRPLEKAIELKIDDEL 131

Query: 197 VPSKFT-------------LFFDCPEKVMLQRLLERGKTSGRSDDNVESIKKRFKTFIET 243
           + S+ T               F+ P+K M   +        RSDDN +++KKR   + + 
Sbjct: 132 LVSRITGRLVHPASGRSYHKIFNPPKKEMTDDVTGEALVQ-RSDDNADALKKRLGAYHQQ 190

Query: 244 SMPVVEYFEKQDKVVSVSCDHSVEKVYEQV 273
           + P+V++++K      V      + V+  +
Sbjct: 191 TEPIVDFYKKTGIWSGVDASQPPKTVWADI 220

>KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w ADK2 adenylate kinase, mitochondrial,
           start by similarity
          Length = 227

 Score = 73.6 bits (179), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 98/199 (49%), Gaps = 34/199 (17%)

Query: 100 GGPGAGKGTQCANLVRDYQFVH-LSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVT 158
           G PG+GKGTQ + L++++  +  +S+GDLLR +Q   G+  G     YI++G ++P ++ 
Sbjct: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71

Query: 159 VALLQQAIQD-NYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLF----FDCPEKVML 213
             ++   ++   +   +  +L+DGFPR + QA   ++ ++    +L      D P +V+L
Sbjct: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131

Query: 214 QRLLER--------------------GK-------TSGRSDDNVESIKKRFKTFIETSMP 246
           +R+  R                    GK        + R DD  E   KR + + +T  P
Sbjct: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191

Query: 247 VVEYFEKQDKVVSVSCDHS 265
           + E++ KQ  + ++S + S
Sbjct: 192 LKEHYLKQGILSTISGNTS 210

>Kwal_56.23489
          Length = 225

 Score = 72.8 bits (177), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 94/203 (46%), Gaps = 34/203 (16%)

Query: 96  IFVLGGPGAGKGTQCANLVRDYQFVH-LSAGDLLRAEQNREGSKYGALIKHYIKEGLIVP 154
           I +LG PG+GKGTQ + L+  ++++  +S+GDLLR E  ++ +  G+L   YI +G ++P
Sbjct: 6   ILLLGAPGSGKGTQTSKLLSHFKYIRSISSGDLLRQEIQKK-THLGSLASEYISQGKLLP 64

Query: 155 QEVTVALLQQAIQD-NYDQGHKRFLVDGFPRKMDQAITFEEQIVPS----KFTLFFDCPE 209
             +   L+   +           FL+DGFPR +DQA +   ++ P        +  D P 
Sbjct: 65  DSLVTELVTNELTARGLLSSDSSFLLDGFPRTLDQAKSLRSKLAPHGSPLNLVVELDVPS 124

Query: 210 KVMLQRLLER--------------------GK-------TSGRSDDNVESIKKRFKTFIE 242
            V+L+R+  R                    GK        + R DD  E   KR + + +
Sbjct: 125 SVILERIENRYVHVPSGRVYNLTYNPPLVAGKDDVTGEPLTKRPDDTAEVFGKRLENYAQ 184

Query: 243 TSMPVVEYFEKQDKVVSVSCDHS 265
           T  P+ +++     +  VS + S
Sbjct: 185 TVEPLKQFYADLGILHKVSGETS 207

>AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH]
           (959464..960219) [756 bp, 251 aa]
          Length = 251

 Score = 72.4 bits (176), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 102/216 (47%), Gaps = 35/216 (16%)

Query: 96  IFVLGGPGAGKGTQCANLVRDYQFVH-LSAGDLLRAEQNREGSKYGALIKHYIKEGLIVP 154
           + +LG PGAGKGTQ   L++ +  +  +++GDLLR E    GS  G     +I  G ++P
Sbjct: 33  LLLLGAPGAGKGTQMGRLLQRFPGLQAVASGDLLRREIA-AGSPLGEQAAAHIAAGRLLP 91

Query: 155 QE-VTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQI--VPSKFTLFFD--CPE 209
              V+ A+L +  +  +  G   +L+DGFPR + QA   +  +    +  TL  +   PE
Sbjct: 92  DALVSSAILDELARRRWLHGGASWLLDGFPRTVAQAQELDAALERADAALTLVVEVAVPE 151

Query: 210 KVMLQRLLER------GKT---------------------SGRSDDNVESIKKRFKTFIE 242
            V+L R+ +R      G+                      S R DD  E   KR + +  
Sbjct: 152 DVILDRIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAA 211

Query: 243 TSMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAVK 278
           T+ P+ E++ +Q  + +V    S + V+ Q++  V+
Sbjct: 212 TAGPLKEHYARQGILRTVRGPTS-DIVFPQLERLVQ 246

>YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase
           (GTP:AMP phosphotransferase), mitochondrial [678 bp, 225
           aa]
          Length = 225

 Score = 69.3 bits (168), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 91/199 (45%), Gaps = 34/199 (17%)

Query: 100 GGPGAGKGTQCANLVRDY-QFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVT 158
           G PG+GKGTQ + L++   Q   +S+GD+LR E   E S  G     YI +G ++P ++ 
Sbjct: 21  GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSE-STLGREATTYIAQGKLLPDDLI 79

Query: 159 VALLQQAIQD-NYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLF----FDCPEKVML 213
             L+   +    + +    +L+DGFPR   QA   +E +     +L      D PE  +L
Sbjct: 80  TRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTIL 139

Query: 214 QRLLER------GKT---------------------SGRSDDNVESIKKRFKTFIETSMP 246
           +R+  R      G+                      + R DD  E  KKR + + +T+ P
Sbjct: 140 ERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEP 199

Query: 247 VVEYFEKQDKVVSVSCDHS 265
           + +Y++K     +VS + S
Sbjct: 200 LKDYYKKSGIFGTVSGETS 218

>Sklu_2063.3 YDL166C, Contig c2063 1224-1850
          Length = 208

 Score = 34.3 bits (77), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 60/141 (42%), Gaps = 27/141 (19%)

Query: 96  IFVLGGPGAGKGTQCANLVR---DYQFVHLSAGDLLRAEQNREGSKYGALIK-HYIKEGL 151
           I V G PG GK T C  LVR   DY + ++S  D  R  +  +G  Y  + K H + E  
Sbjct: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSHIVDEDK 65

Query: 152 IVPQEVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLFFDCPEKV 211
           ++ +   +    ++I D +       + D FP ++                +   C   +
Sbjct: 66  LLDELEPLLRKGKSIVDWH-------VNDVFPERL------------IDLVVVLRCDNSI 106

Query: 212 MLQRLLERGKTSGRSDDNVES 232
           +  RL +RG    + ++N+++
Sbjct: 107 LYDRLHKRGYHDSKIEENLDA 127

>ACL150W [899] [Homologous to ScYDL166C (FAP7) - SH]
           complement(87745..88404) [660 bp, 219 aa]
          Length = 219

 Score = 33.5 bits (75), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 57/140 (40%), Gaps = 25/140 (17%)

Query: 96  IFVLGGPGAGKGTQCANLVR---DYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLI 152
           I V G PG GK T C  L R   DYQ+ ++S  D  R     +G    A   H + E  +
Sbjct: 10  ILVSGTPGCGKSTTCELLQRHLPDYQYFNIS--DFAREHNCYDGYD-EARKSHIVDEDRL 66

Query: 153 VPQEVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLFFDCPEKVM 212
           + +   +     AI D +       + D FP ++                +   C   ++
Sbjct: 67  LDELEPLLRRGGAIVDWH-------VNDIFPERL------------IDLVVVLRCDNAIL 107

Query: 213 LQRLLERGKTSGRSDDNVES 232
             RL +RG  S + ++N+++
Sbjct: 108 HDRLQKRGYHSSKIEENIDA 127

>Sklu_2430.4 YMR105C, Contig c2430 6115-7830
          Length = 571

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 34/71 (47%)

Query: 97  FVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQE 156
            V+G  G       ++++R Y    ++ G +L A  N  G+K    IK+ +  G   P+ 
Sbjct: 86  LVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFGIKYNLSNGGPAPES 145

Query: 157 VTVALLQQAIQ 167
           VT  + +++ Q
Sbjct: 146 VTNKIFEKSKQ 156

>YDL166C (FAP7) [705] chr4 complement(163450..164043) Essential
           protein important for Skn7p-dependent transcription of
           target genes during oxidative stress [594 bp, 197 aa]
          Length = 197

 Score = 31.2 bits (69), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 62/140 (44%), Gaps = 25/140 (17%)

Query: 96  IFVLGGPGAGKGTQCA---NLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLI 152
           I V G PG GK + C    N ++DY++ ++S  D  +     EG   G       ++  I
Sbjct: 10  IIVTGTPGCGKSSTCEFLKNKLKDYKYYNIS--DFAKDNDCFEGYDEG-------RKSHI 60

Query: 153 VPQEVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLFFDCPEKVM 212
           V ++  + +L+  ++    QG+   +VD     +     F E+++     +   C    +
Sbjct: 61  VDEDKLLDMLEPLLR----QGNS--IVDWHVNDV-----FPERLI--DLVVVLRCDNSNL 107

Query: 213 LQRLLERGKTSGRSDDNVES 232
             RL  RG    + ++N+++
Sbjct: 108 YSRLHARGYHDSKIEENLDA 127

>ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)
           [666 bp, 221 aa]
          Length = 221

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 135 EGSKYGALIK-----HYIKEGLIVPQEVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQA 189
           E  KY AL++     H       +P+   VAL+ + +++    G    L+ GFPR M +A
Sbjct: 126 EHDKYHALLEELHAVHGDDYSAHLPKGALVALMGRYLKEVCQAGDSVVLL-GFPRNMQEA 184

Query: 190 ITFEEQI 196
           I FE ++
Sbjct: 185 IQFESEV 191

>KLLA0E21714g complement(1929294..1930283)
           gi|1351442|sp|P49378|XYL1_KLULA Kluyveromyces lactis
           NAD(P)H-dependent xylose reductase, start by similarity
          Length = 329

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 64  ISYQKNGPVEFVEEENSKASTGPAFSDKD 92
           ++Y   GPV F+E EN KA   P   + D
Sbjct: 219 VAYSSFGPVSFLELENKKALNTPTLFEHD 247

>Scas_617.7
          Length = 420

 Score = 28.1 bits (61), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 30/64 (46%)

Query: 119 FVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVTVALLQQAIQDNYDQGHKRFL 178
           F H+  G L +AE  +        I+   KE +++  E+T+ +     ++  D   K F+
Sbjct: 238 FSHIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFI 297

Query: 179 VDGF 182
            +GF
Sbjct: 298 EEGF 301

>YOR154W (YOR154W) [4953] chr15 (624729..626492) Protein of unknown
           function, has moderate similarity to uncharacterized C.
           albicans Orf6.3650p [1764 bp, 587 aa]
          Length = 587

 Score = 28.1 bits (61), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 39/94 (41%), Gaps = 14/94 (14%)

Query: 189 AITFEEQIVPSKFTLFFD------CPEKVMLQRLLERGKTSGRSDDNVESIKKRFKTFIE 242
           A++   +++P KF  FF       CP K M+             +   ++I KR      
Sbjct: 388 ALSCTSKLIPLKFDEFFKVLNASFCPSKQMISSSSSSAVPVIPEESIFKNIMKRLSQLET 447

Query: 243 TSMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAA 276
            S   V Y E+Q K++S        K +EQ++ A
Sbjct: 448 NSSLTVSYIEEQSKLLS--------KSFEQLEMA 473

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,508,385
Number of extensions: 353490
Number of successful extensions: 1073
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1046
Number of HSP's successfully gapped: 35
Length of query: 279
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 179
Effective length of database: 13,134,309
Effective search space: 2351041311
Effective search space used: 2351041311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)