Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.86362861931030.0
Sklu_2380.362263319670.0
ACR172W61263518040.0
KLLA0E08085g65663715570.0
Scas_685.764565115550.0
CAGL0L09889g71744511901e-155
YKL025C (PAN3)67969810341e-132
ADR313W578136960.002
CAGL0K01661g482111900.008
Sklu_2099.2420110760.34
YMR001C (CDC5)705171760.43
Kwal_33.14192577148760.48
YDL025C62094750.53
Scas_653.2566695750.58
Sklu_2396.328548730.69
CAGL0J04972g33940730.91
KLLA0A02717g43241731.0
Kwal_55.21088145598711.9
YGR052W36952692.5
AEL284C47941692.6
Sklu_1585.223873682.7
YOR129C89363693.0
CAGL0J11638g746146693.2
Scas_649.2129422665.6
YDR151C (CTH1)32522656.5
Kwal_14.127341539657.7
YDL195W (SEC31)1273116658.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.863
         (619 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.863                                                          1199   0.0  
Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement        762   0.0  
ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH] complement(...   699   0.0  
KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces c...   604   0.0  
Scas_685.7                                                            603   0.0  
CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces...   462   e-155
YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component...   402   e-132
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    42   0.002
CAGL0K01661g complement(146952..148400) some similarities with t...    39   0.008
Sklu_2099.2 , Contig c2099 975-2237 reverse complement                 34   0.34 
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    34   0.43 
Kwal_33.14192                                                          34   0.48 
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    33   0.53 
Scas_653.25                                                            33   0.58 
Sklu_2396.3 YLR136C, Contig c2396 8035-8892 reverse complement         33   0.69 
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    33   0.91 
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    33   1.0  
Kwal_55.21088                                                          32   1.9  
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    31   2.5  
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    31   2.6  
Sklu_1585.2 YNL191W, Contig c1585 1282-1998                            31   2.7  
YOR129C (YOR129C) [4931] chr15 complement(566877..569558) Protei...    31   3.0  
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    31   3.2  
Scas_649.21                                                            30   5.6  
YDR151C (CTH1) [995] chr4 complement(764172..765149) Protein con...    30   6.5  
Kwal_14.1273                                                           30   7.7  
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    30   8.9  

>Kwal_14.863
          Length = 628

 Score = 1199 bits (3103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/619 (93%), Positives = 579/619 (93%)

Query: 1   MNNPKAQSKIATTDMDKANAEWAKDIPCKNITIYGFCKYENEGCIFNHGNANQNTNSAGL 60
           MNNPKAQSKIATTDMDKANAEWAKDIPCKNITIYGFCKYENEGCIFNHGNANQNTNSAGL
Sbjct: 1   MNNPKAQSKIATTDMDKANAEWAKDIPCKNITIYGFCKYENEGCIFNHGNANQNTNSAGL 60

Query: 61  KFNAKTASSFTPSKALSTKNSTSTAIXXXXXXXXXXXXXEQPSTSSPLAAKSAPFGSSYN 120
           KFNAKTASSFTPSKALSTKNSTSTAI             EQPSTSSPLAAKSAPFGSSYN
Sbjct: 61  KFNAKTASSFTPSKALSTKNSTSTAIKAEKVAKALASAAEQPSTSSPLAAKSAPFGSSYN 120

Query: 121 PYAANFTPVGSAGXXXXXXXXXXXXXFNPYSAPAGMTTPGEAPLQPGASFIPGSPAPYAQ 180
           PYAANFTPVGSAG             FNPYSAPAGMTTPGEAPLQPGASFIPGSPAPYAQ
Sbjct: 121 PYAANFTPVGSAGTSTPPPAAASRTSFNPYSAPAGMTTPGEAPLQPGASFIPGSPAPYAQ 180

Query: 181 DAPGRYTNFPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPETLFIPNNMREELLKK 240
           DAPGRYTNFPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPETLFIPNNMREELLKK
Sbjct: 181 DAPGRYTNFPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPETLFIPNNMREELLKK 240

Query: 241 NHAALQVFPSGGNLPEIVGDYFGLVPLEFHNRVSNKDRYQGHQNSLYKVFSNFDGKVYIM 300
           NHAALQVFPSGGNLPEIVGDYFGLVPLEFHNRVSNKDRYQGHQNSLYKVFSNFDGKVYIM
Sbjct: 241 NHAALQVFPSGGNLPEIVGDYFGLVPLEFHNRVSNKDRYQGHQNSLYKVFSNFDGKVYIM 300

Query: 301 RRIHDVKMKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCVVHEYFPQSSSLY 360
           RRIHDVKMKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCVVHEYFPQSSSLY
Sbjct: 301 RRIHDVKMKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCVVHEYFPQSSSLY 360

Query: 361 ETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGDS 420
           ETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGDS
Sbjct: 361 ETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGDS 420

Query: 421 CVHDILYFQDERDVLKEQKHDFXXXXXXXXXXXXXXVGSQDNTVDSLAVDDDFKQVLNYL 480
           CVHDILYFQDERDVLKEQKHDF              VGSQDNTVDSLAVDDDFKQVLNYL
Sbjct: 421 CVHDILYFQDERDVLKEQKHDFADLGGLLKDLAAKLVGSQDNTVDSLAVDDDFKQVLNYL 480

Query: 481 LDPKSLKTLPELMALFSHKILPIISSLQTFTEYTESILARELENARLFRLMCKMNFIFGR 540
           LDPKSLKTLPELMALFSHKILPIISSLQTFTEYTESILARELENARLFRLMCKMNFIFGR
Sbjct: 481 LDPKSLKTLPELMALFSHKILPIISSLQTFTEYTESILARELENARLFRLMCKMNFIFGR 540

Query: 541 IESRIDINWSESGEKFPIILFYDYVFHQADETGKPVMDLTHVLRCLNKLDAGIGEKLMLV 600
           IESRIDINWSESGEKFPIILFYDYVFHQADETGKPVMDLTHVLRCLNKLDAGIGEKLMLV
Sbjct: 541 IESRIDINWSESGEKFPIILFYDYVFHQADETGKPVMDLTHVLRCLNKLDAGIGEKLMLV 600

Query: 601 TPDEMNCIIISYKELKDLI 619
           TPDEMNCIIISYKELKDLI
Sbjct: 601 TPDEMNCIIISYKELKDLI 619

>Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement
          Length = 622

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/633 (61%), Positives = 456/633 (72%), Gaps = 48/633 (7%)

Query: 15  MDKANAEWAKDIPCKNITIYGFCKYENEGCIFNHGNANQNT---------NSAGLKFNAK 65
           MDKAN EWAKDIPCKNITI+GFCK+EN+GCIFNHG++   T         NSA  KFNAK
Sbjct: 1   MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGSSGTKTGVNTPTGIMNSAS-KFNAK 59

Query: 66  TASSFTPSKALSTKNSTSTAIXXXXXXXXXXXXXEQPSTSSPLAAK---SAPFGSSYNPY 122
           TASSFTPSK  S+  +  +                   T++P+AA    S  F +++NPY
Sbjct: 60  TASSFTPSKITSSDFNGVSGFTSDKSATV---------TTAPVAASVVNSPTFATNFNPY 110

Query: 123 AAN-FTPVGSAGXXXXXXXXXXXXXFNPYSAPAGM-----------TTP----GEAPLQP 166
            A+ FTP GSAG             FNPYSAP+G+           T P     + P  P
Sbjct: 111 VADSFTPSGSAGVSSPS--------FNPYSAPSGIGGASSTATHTQTAPVTGFTQRPPDP 162

Query: 167 GASFIPGSPAPYAQDAPGRYTNFPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPET 226
            +S    S  P A        NFP+IYPP HSILQYHLYAPDPP HLKVPLK NERTPET
Sbjct: 163 RSSLT--SAGPIASSRVSATQNFPTIYPPPHSILQYHLYAPDPPPHLKVPLKPNERTPET 220

Query: 227 LFIPNNMREELLKKNHAALQVFPSGGNLPEIVGDYFGLVPLEFHNRVSNKDRYQGHQNSL 286
           LFIPN++REEL+KKN +ALQVFPSGG+LPEIVGDYFGLVPLEFH+R S K RY GHQNSL
Sbjct: 221 LFIPNDLREELVKKNQSALQVFPSGGSLPEIVGDYFGLVPLEFHSRASYKQRYMGHQNSL 280

Query: 287 YKVFSNFDGKVYIMRRIHDVKMKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASL 346
           YKVFSN DGK+YIMRRIHDV + E+ Q+ +PFQ W+KV  +NVV+ KDAFITRAFND+SL
Sbjct: 281 YKVFSNSDGKIYIMRRIHDVNITEATQVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSL 340

Query: 347 CVVHEYFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNICLDKV 406
           CVVHEYFPQSSSLYETHFV+F+ TPITQD LW+YLVQL +A++  H++NL+ N +  DKV
Sbjct: 341 CVVHEYFPQSSSLYETHFVNFTLTPITQDYLWAYLVQLTNALKEVHSQNLSINILGWDKV 400

Query: 407 IVTGNPGRVKIGDSCVHDILYFQDERDVLKEQKHDFXXXXXXXXXXXXXXVGSQDNTVDS 466
           IVTG PGR+K+ D  V+DIL+  + RD+ +EQ+ DF                S+D +   
Sbjct: 401 IVTGEPGRIKVSDCGVYDILHSLESRDIEEEQQKDFEELGKLLNGLVTKIASSKDTSTQD 460

Query: 467 LAVDDDFKQVLNYLLDPKSLKTLPELMALFSHKILPIISSLQTFTEYTESILARELENAR 526
           L VD DFK VL+YLL     K + EL +LF+ +IL ++SSLQT  E TE+ L+RELEN R
Sbjct: 461 LKVDSDFKIVLDYLLLNDHKKNVRELASLFTDRILSVVSSLQTHVECTEAYLSRELENGR 520

Query: 527 LFRLMCKMNFIFGRIESRIDINWSESGEKFPIILFYDYVFHQADETGKPVMDLTHVLRCL 586
           LFRLMCK+NFIFGR ESR+DINWSESGEKFPIILFYDYVFHQ DE GK +MDLTHVLRCL
Sbjct: 521 LFRLMCKLNFIFGRTESRVDINWSESGEKFPIILFYDYVFHQVDEAGKSIMDLTHVLRCL 580

Query: 587 NKLDAGIGEKLMLVTPDEMNCIIISYKELKDLI 619
           NKLDAG+ EK+MLVTPDEMNCIIISYKELKDLI
Sbjct: 581 NKLDAGVTEKIMLVTPDEMNCIIISYKELKDLI 613

>ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH]
           complement(655564..657402) [1839 bp, 612 aa]
          Length = 612

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/635 (56%), Positives = 429/635 (67%), Gaps = 64/635 (10%)

Query: 15  MDKANAEWAKDIPCKNITIYGFCKYENEGCIFNHG---------------NANQNTNSAG 59
           M+K+  +WAKD PCKNITIYG+CKYEN+GCIFNHG               +A  +  S G
Sbjct: 3   MNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPLSTSSNTGGAAAGSAEDSAASGG 62

Query: 60  LK--------FNAKTASSFTPSKALSTKNSTSTAIXXXXXXXXXXXXXEQPSTSSPLAAK 111
           +         FNAKTA+SFTPS A+   N+  +                +   SSP    
Sbjct: 63  VTVGNTGKSTFNAKTATSFTPSVAIPDFNNIPS-------------FTPERIVSSPAGDG 109

Query: 112 SAPFGSSYNPY-------AANFTPVGSAGXXXXXXXXXXXXXFNPYSAPAGMTTPGEAPL 164
           +  F  S+NPY       +AN +  GSA                P S    + T G  PL
Sbjct: 110 ATAFTPSFNPYGSDSFNPSANVSGPGSAVFAAASGNAGASATAAPRSQSVHVGTGGYLPL 169

Query: 165 QPGASFIPGSPAPYAQDAPGRYTNFPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTP 224
                                 T FP++YPPSHSILQYHLYAPDPP HL+VPLKANERTP
Sbjct: 170 AG--------------------TAFPTVYPPSHSILQYHLYAPDPPPHLQVPLKANERTP 209

Query: 225 ETLFIPNNMREELLKKNHAALQVFPSGGNLPEIVGDYFGLVPLEFHNRVSNKDRYQGHQN 284
           ETLFIPNN+RE LLK+N +ALQVFPS GNLP+IVGDYFGLVPLEFHNR + K RY GHQN
Sbjct: 210 ETLFIPNNLREHLLKRNLSALQVFPSDGNLPDIVGDYFGLVPLEFHNRQTGKGRYLGHQN 269

Query: 285 SLYKVFSNFDGKVYIMRRIHDVKMKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDA 344
           SLYKVFSNFDGKVYI+RRIHDVK  +  Q+  PF+ W+KV   NVV+ KDAF T AF D+
Sbjct: 270 SLYKVFSNFDGKVYIIRRIHDVKTTDVGQISLPFRKWQKVSCPNVVKVKDAFTTLAFGDS 329

Query: 345 SLCVVHEYFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNICLD 404
           SLCVVH+Y+PQS+SLYETH  +++  P+TQ  LWSYLVQL +A+   H   L+ NNI LD
Sbjct: 330 SLCVVHDYYPQSNSLYETHVANYTVVPVTQKYLWSYLVQLSNALNEVHRHGLSMNNISLD 389

Query: 405 KVIVTGNPGRVKIGDSCVHDILYFQDERDVLKEQKHDFXXXXXXXXXXXXXXVGSQDNTV 464
           KVIVTG+PGR+K+GDS VHDIL F + RD+ KEQ+ D+              +G++D  +
Sbjct: 390 KVIVTGDPGRIKVGDSAVHDILAFDEGRDIAKEQQADYSAVGALLMDLAQRMLGTRDQPL 449

Query: 465 DSLAVDDDFKQVLNYLLDPKSLKTLPELMALFSHKILPIISSLQTFTEYTESILARELEN 524
           DS+ +D  FK+VL YLL  +  KT+ E  ALFSHK+L IISS QT++EY E  L+RELEN
Sbjct: 450 DSMDIDPLFKRVLAYLLSDEK-KTIAEFTALFSHKMLDIISSSQTYSEYIEQHLSRELEN 508

Query: 525 ARLFRLMCKMNFIFGRIESRIDINWSESGEKFPIILFYDYVFHQADETGKPVMDLTHVLR 584
            RLFRLMCK+NFIFGR+ES +DI+WSE+G+KFPIILFYDYVFHQ DE GK VMDLTHVLR
Sbjct: 509 GRLFRLMCKLNFIFGRMESSMDIHWSEAGDKFPIILFYDYVFHQVDENGKSVMDLTHVLR 568

Query: 585 CLNKLDAGIGEKLMLVTPDEMNCIIISYKELKDLI 619
           CLNKLD G+ EK++LVTPDEMNCIIISYKELKD I
Sbjct: 569 CLNKLDTGVSEKIILVTPDEMNCIIISYKELKDSI 603

>KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease singleton, start by similarity
          Length = 656

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/637 (50%), Positives = 413/637 (64%), Gaps = 47/637 (7%)

Query: 24  KDIPCKNITIYGFCKYENEGCIFNHGNANQNTNSA-------------GLKFNAKTASSF 70
           K   C+NI I+G+CK+ENEGC FNHGN+ +                   +KFNAKT+SSF
Sbjct: 17  KGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVPTQRSMTPLNVKFNAKTSSSF 76

Query: 71  TPSKALSTKN---STSTAIXXXXXXXXXXXXXEQPSTSSPLA-----AKSAPFGSSYNPY 122
           TP K+ + ++   S+  A              + P  S  ++     + +  F  S+NPY
Sbjct: 77  TPGKSPAVRSPDFSSLPAFQPGAPVNDQPMLADGPQISGTMSPSLMNSNATAFAPSFNPY 136

Query: 123 AA-NFTPVGSAGXXXXXXXXXXXXX-----------FNPYSAPAGMTTPGEA----PLQP 166
           A+ +FTP  SAG                         NPY   AG+ + G      P+Q 
Sbjct: 137 ASESFTPSVSAGGIPSSQELAGTLHGSNPSIPSPVPSNPYVNSAGLPSGGMLGVGHPMQG 196

Query: 167 GASFIPGSPAPYAQDAPGRYTNFPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPET 226
                P    P         T FP++YPP+HS+LQYHLYAPDPP HLK+PLK NERTPET
Sbjct: 197 LPPPPPPGALPV-----NPITQFPTVYPPTHSVLQYHLYAPDPPPHLKIPLKPNERTPET 251

Query: 227 LFIPNNMREELLKKNHAALQVFPSGGNLPEIVGDYFGLVPLEFHNRVSNKDRYQGHQNSL 286
           LFI N++R+ L+K N  ALQVFP G +LP+IVGDYFGLVP++FHNR S+K RY GH+NSL
Sbjct: 252 LFINNHLRDRLVKNNQTALQVFPRG-SLPDIVGDYFGLVPMDFHNRTSDKKRYNGHKNSL 310

Query: 287 YKVFSNFDGKVYIMRRIHDVKMKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASL 346
           YKVFSN DGK+Y MRRIHDVK+ +S Q+ KPFQ W  + ++N+   KD+F+T AFND+SL
Sbjct: 311 YKVFSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLRSANITVLKDSFVTSAFNDSSL 370

Query: 347 CVVHEYFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNICLDKV 406
           C+V +Y+PQS SLYET+ ++ S   + Q+ LW++LVQL  A+Q  H+  LA N++   KV
Sbjct: 371 CMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKV 430

Query: 407 IVTGNPGRVKIGDSCVHDIL-YFQDERDVLKEQKHDFXXXXXXXXXXXXXXVGSQD--NT 463
           IVTG PGR+K+ D  V+D L Y Q+ R +  EQ+ ++               G+    + 
Sbjct: 431 IVTGEPGRIKVTDIGVYDTLNYHQEGRMLHTEQQQNYLSLAELLLNLVQRLCGASGPLDD 490

Query: 464 VDSLAVDDDFKQVLNYLLD-PKSLKTLPELMALFSHKILPIISSLQTFTEYTESILAREL 522
           V S  +D  FK+ + YL D   + K + +   LFSHK+L +++SLQ  +EY E  L+REL
Sbjct: 491 VKSYHIDPLFKKCIQYLQDTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSEYLEQQLSREL 550

Query: 523 ENARLFRLMCKMNFIFGRIESRIDINWSESGEKFPIILFYDYVFHQADETGKPVMDLTHV 582
           ENARLFRLMCK+N I+GR+ESRIDINW+ESGEKFPIILF+DYVFHQ D+TGK VMDLTHV
Sbjct: 551 ENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFDYVFHQKDDTGKNVMDLTHV 610

Query: 583 LRCLNKLDAGIGEKLMLVTPDEMNCIIISYKELKDLI 619
           LRCLNKLDAG+ E+LMLVTPDEMNCIIISYKELKDLI
Sbjct: 611 LRCLNKLDAGVSERLMLVTPDEMNCIIISYKELKDLI 647

>Scas_685.7
          Length = 645

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/651 (49%), Positives = 412/651 (63%), Gaps = 61/651 (9%)

Query: 15  MDKANAEWAKDIPCKNITIYGFCKYENEGCIFNHGNANQNTN-----------------S 57
           MDK NAEWAKDIPC+N+TIYG+CK   +GC F H   ++                    S
Sbjct: 1   MDKINAEWAKDIPCRNVTIYGYCKKIKDGCPFKHSETDEPAAEIQEPVPVQQSPVAPVPS 60

Query: 58  AGLKFNAKTASSFTPSKALSTKNSTSTAIXXXXXXXXXXXXXEQPST----SSPLAAKSA 113
              KFN K+++SFTP   +S+K     A+                S     +SPLA++S+
Sbjct: 61  FSRKFNPKSSASFTP---MSSKTPELAAVSSFERSSNPSSPAPPASIPKPMNSPLASQSS 117

Query: 114 PFGSSYNPYAANFTPVGSAGXXXXXXXXXXXXXFNPYSAPAGMTTPGEA-PL-QPGASFI 171
              +S+ P      P  S+               N    P G++    A PL Q   + +
Sbjct: 118 --NASFPPQPFYSYPASSSNGTL----------LNNTILPDGISLHDPAFPLTQIDKTML 165

Query: 172 PGSPAPYAQDAPGRYTN----------------------FPSIYPPSHSILQYHLYAPDP 209
              P   + + P ++++                      +PSIYPP HSILQYHLYAPDP
Sbjct: 166 ANDPNLPSANVPLQFSSSPASNIHQQMLNENNINNNNSRYPSIYPPPHSILQYHLYAPDP 225

Query: 210 PLHLKVPLKANERTPETLFIPNNMREELLKKNHAALQVFPSGGNLPEIVGDYFGLVPLEF 269
           P  L++PLK NERTPETLFIPN++RE+L+KKN A+LQ+FPSGG +P+IV DYFGLVPL+F
Sbjct: 226 PPQLRLPLKPNERTPETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIVQDYFGLVPLDF 285

Query: 270 HNRVSNKDRYQGHQNSLYKVFSNFDGKVYIMRRIHDVKMKESVQLFKPFQDWKKVVNSNV 329
           H +   KDRYQGH+NSLYKVFSN DGKVYI+RRIHDV++ +  Q+ KPFQ W  +  + +
Sbjct: 286 HQKEVTKDRYQGHKNSLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPFQKWNNLECNQI 345

Query: 330 VETKDAFITRAFNDASLCVVHEYFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLCSAIQ 389
           V+ +D F+T  F D+SLC+V++++PQ++SLYE HF +F   PITQD LW+YLVQL +AI 
Sbjct: 346 VKLRDLFLTTKFGDSSLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLWTYLVQLTNAIN 405

Query: 390 AAHTRNLAFNNICLDKVIVTGNPGRVKIGDSCVHDILYFQDERDVLKEQKHDFXXXXXXX 449
             H++      I  DK+IVTG+PGR+K+      D+L   +E D+  +Q+ DF       
Sbjct: 406 VVHSKGFYIGLIDWDKIIVTGDPGRIKLSGCGAIDVLGANEELDLHSKQQMDFENLGQLL 465

Query: 450 XXXXXXXVGSQDNTVDSLAVDDDFKQVLNYLL-DPKSLKTLPELMALFSHKILPIISSLQ 508
                    + +  +D L+VDD FK VL YLL D    KT+ EL  LF  KIL  + S Q
Sbjct: 466 FKLASKIGNNANAKIDELSVDDQFKTVLQYLLNDTNDRKTINELSQLFIDKILSNVESSQ 525

Query: 509 TFTEYTESILARELENARLFRLMCKMNFIFGRIESRIDINWSESGEKFPIILFYDYVFHQ 568
            + EYTE IL+RELEN RLFRL+CK+NFIFG+IESR+DINWSESGEKFPIILFYD+VFHQ
Sbjct: 526 GYAEYTEGILSRELENGRLFRLICKLNFIFGKIESRVDINWSESGEKFPIILFYDFVFHQ 585

Query: 569 ADETGKPVMDLTHVLRCLNKLDAGIGEKLMLVTPDEMNCIIISYKELKDLI 619
            DETGK VMDLTHVLRCLNKLDAG  EKL+L TPDEMNCIIISYKELKDLI
Sbjct: 586 VDETGKSVMDLTHVLRCLNKLDAGAPEKLILATPDEMNCIIISYKELKDLI 636

>CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease, start by similarity
          Length = 717

 Score =  462 bits (1190), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 228/445 (51%), Positives = 314/445 (70%), Gaps = 16/445 (3%)

Query: 189 FPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPETLFIPNNMREELLKKNHAALQVF 248
           +P+IYPP+HSILQYHLYAPDPP  L++ LK NERTP  LFIPN++REEL+K+N A+LQ+F
Sbjct: 266 YPTIYPPTHSILQYHLYAPDPPPQLEIALKENERTPRMLFIPNDLREELVKRNLASLQLF 325

Query: 249 PSGGNLPEIVGDYFGLVPLEFHNRVSNKDRYQGHQNSLYKVFSNFDGKVYIMRRIHDVKM 308
           PSGGNLP IV DYFGLVPL+FH R S KDRY+ H+NSLYKVFSN DG++Y++RRIHDV +
Sbjct: 326 PSGGNLPHIVKDYFGLVPLDFHQRSSVKDRYKKHKNSLYKVFSNVDGRIYLLRRIHDVNI 385

Query: 309 KESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCVVHEYFPQSSSLYETHFVSFS 368
            +   + K FQ W K+ +SNVV  KD F+T AF D+SL +V++Y+P ++SLYE HFV++ 
Sbjct: 386 SDPTIISKTFQKWSKIDSSNVVALKDLFLTTAFGDSSLGIVYDYYPNATSLYEAHFVNYP 445

Query: 369 PTPITQDLLWSYLVQLCSAIQAAHTRN-LAFNNICLDKVIVTGNPGRVKIGDSCVHDILY 427
              +T+DLLWSY VQ+ + ++  H  N +   ++  DK+I+TG  GR+KI     +DI+ 
Sbjct: 446 TVEVTEDLLWSYAVQILNGLREIHNTNGVNIGDLDCDKIILTGK-GRIKISAGAEYDIMN 504

Query: 428 F------QDERDVLKEQKHDFXXXXXXXXXXXXXXVGSQDNTVDSLA-VDDDFKQVLNYL 480
                  +D+ +  K +K +F                     V +LA V +  K ++  L
Sbjct: 505 MCCPEDNEDDDNEEKLRKRNFVDLGEILFKLASKMCNCHGKDVANLAQVSEKLKNLIKSL 564

Query: 481 L-----DPKSLKTLPELMALFSHKILPIISSLQTFTEYTESILARELENARLFRLMCKMN 535
                 D  ++ T+ E   +    +  ++ + QT++EY E++L+RELEN RLFRL+CK+N
Sbjct: 565 AFEQLHDYVNVATIIE-KYIGLDVVFKVMEAQQTYSEYAENVLSRELENGRLFRLICKLN 623

Query: 536 FIFGRIESRIDINWSESGEKFPIILFYDYVFHQAD-ETGKPVMDLTHVLRCLNKLDAGIG 594
           FIFGR+E+R+DINWSE G+KF I+LFYDYVFHQ D  TGKPV DLTHVLRCLNKLDAG+ 
Sbjct: 624 FIFGRVENRLDINWSEPGDKFVIVLFYDYVFHQIDPNTGKPVTDLTHVLRCLNKLDAGVE 683

Query: 595 EKLMLVTPDEMNCIIISYKELKDLI 619
           E ++LVTPDE+N  ++SYK++K+L+
Sbjct: 684 ENILLVTPDELNTAVVSYKKVKELV 708

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 92/219 (42%), Gaps = 43/219 (19%)

Query: 15  MDKANAEWAKDIPCKNITIYGFCKYENEGCIFNHGNANQNTNSAGLKFNAKTASSFTPSK 74
           MDK N +WA+D+PC+N+ IYGFCK + EGC F H + +  T ++  K  A T  +  PS 
Sbjct: 1   MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKV-ADTVPA--PSG 57

Query: 75  ALSTKNSTSTAIXXXXXXXXXXXXXEQPSTSSPLAAKSAPFGSSYNPYAANFTPVGSAGX 134
            +   +  S +               QPS+++P +A +A   +        F    SA  
Sbjct: 58  VIQQPSKISVS--------SLPSLNSQPSSTAPTSAPNATAHTGSKSQVPKFNAKASAS- 108

Query: 135 XXXXXXXXXXXXFNPYSAPAGMTTPGEAPLQPGASFIPGSPAPYAQDAPGRYTNFPSIYP 194
                       F P S  A  T   +AP     S + GSP P  +   G   +F     
Sbjct: 109 ------------FTPMSKAADGTQETQAPYL--ESPVAGSPGPILK--AGTPVSF----- 147

Query: 195 PSHSILQYHLYAPDPPLHLKVPLKANERTPETLFIPNNM 233
                +Q ++Y+  P     VP  A+   P  +  PN+M
Sbjct: 148 -----MQPNIYSTTP-----VPSPASMAMPNVVMPPNDM 176

>YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component of
           Pab1p-stimulated poly(A) ribonuclease [2040 bp, 679 aa]
          Length = 679

 Score =  402 bits (1034), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 268/698 (38%), Positives = 365/698 (52%), Gaps = 121/698 (17%)

Query: 15  MDKANAEWAKDIPCKNITIYGFCKYENEGCIFNH------------------GNANQNTN 56
           MDK N +WAKDIPC+NITIYG+CK E EGC F H                  G A   T 
Sbjct: 1   MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTATTINDVPPPIDVGEATTPTM 60

Query: 57  SAGLKFNAKTASSFTP----SKALSTKNSTSTAIXXXXXXXXXXXXXEQPSTSSPLAAKS 112
           ++  KFNAK ++SFTP    S +L+T  +T++A                 ST +P+    
Sbjct: 61  TSVPKFNAKVSASFTPMTVGSDSLTTVTNTTSAATNATGNIAMAATSATASTVNPM---- 116

Query: 113 APFGSSYNPYAANFTPVGSAGXXXXXXXXXXXXXFNPYSAPAGMTTPGEAPLQPGASFIP 172
                          P+ ++                P +A +    P  AP+     F P
Sbjct: 117 -------------INPIVNSSLVNNNNNNSNISISIPTTASSSNYDPFNAPI-----FTP 158

Query: 173 GSPAPYAQDAPGRYTNFPSIYPPS------------------------------HSILQY 202
            S +    +A      FPSI                                   S L+Y
Sbjct: 159 SSTSSIHTNANAHSFPFPSIANSGGININATDDNSNNMSMANNVPPPMQPPPIESSNLKY 218

Query: 203 HLYAPDPPLHLKVPLKANER--TPETLFIPN----------NMREELLKKNHAAL-QVFP 249
               P P   L+  L A E+  + ++L  PN          N   E L K + ++ QVFP
Sbjct: 219 PRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQVFP 278

Query: 250 SGGN-LPEIVGDYFGLVPLEFHNRVSNKDRYQGHQNSLYKVFSNFDGKVYIMRRIHDV-K 307
           S G  +P IV DYF LVP      ++  +    ++ +L+KVFSN+DGK Y+++R+ ++ K
Sbjct: 279 SSGKVIPSIVQDYFNLVP------LNFNNNDFLNKTTLFKVFSNYDGKAYVLKRLPNIDK 332

Query: 308 MKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCVVHEYFPQSSSLYETHFVSF 367
                ++ K +Q W K+  +N+++ +D F T  F D S+C+V +Y+P S SLY+ HFV+F
Sbjct: 333 SMNPNKISKIYQIWSKINCTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYHFVNF 392

Query: 368 SPTPITQDLLWSYLVQLCSAIQAAHTRNLAF-NNICLDKVIVTGNPGRVKIGDSCVHDIL 426
              PIT + LW YLVQL + I + H++NL+  N +   KV++TG+PGR+K+      D+L
Sbjct: 393 PKFPITNNYLWIYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNFMDLL 452

Query: 427 YFQDERDVLK--------EQKHDFXXXXXXXXXXXXXXVGSQDNTV-------------- 464
           +  D   V+         +Q+ D+                S +NT               
Sbjct: 453 FNDDTDTVVSSGGSTIEGQQQLDYKYLGELLFNLSINIENSNNNTAPKEYRLEEITPQSI 512

Query: 465 -DSLAVDDDFKQVLNYLL--DPKSLKTLPELMALFSHKILPIISSLQTFTEYTESILARE 521
            D   +DD FK VL YL+  +  S K++ +L + F  K+  ++ S QT+TEY ES+L+RE
Sbjct: 513 DDMRQIDDKFKDVLKYLISDNGDSKKSIHDLTSHFYDKMFMVLESSQTYTEYMESVLSRE 572

Query: 522 LENARLFRLMCKMNFIFGRIESRIDINWSESGEKFPIILFYDYVFHQADETGKPVMDLTH 581
           LEN RLFRL+ K+N IFGRIESRIDINWSESG KFPIILFYDYVFHQ D  GKP+MDLTH
Sbjct: 573 LENGRLFRLVNKLNCIFGRIESRIDINWSESGTKFPIILFYDYVFHQVDSNGKPIMDLTH 632

Query: 582 VLRCLNKLDAGIGEKLMLVTPDEMNCIIISYKELKDLI 619
           VLRCLNKLDAGI EKLMLVTPDE+NCIIISYKELKDLI
Sbjct: 633 VLRCLNKLDAGIQEKLMLVTPDELNCIIISYKELKDLI 670

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 62/136 (45%), Gaps = 16/136 (11%)

Query: 289 VFSNFDGKVYIMRRIHDVKMKESVQLFK-----PFQDWKKVVNSNVVETKDAFITRAFND 343
           V  + DG+++ ++R      +E+++ +       F     + + N++ET D         
Sbjct: 280 VIKSTDGQLFAVKRFRPRAPRETLKEYSRKVTSEFCTGSTLRHQNIIETLDMLQEGEL-- 337

Query: 344 ASLCVVHEYFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNICL 403
               VV EY P     Y+   +  S   +T+  +W Y  Q+C  +   H++ LA  ++ L
Sbjct: 338 --FLVVMEYCP-----YDFFNLVMS-NQMTKHEVWCYFKQICRGVDYLHSQGLAHRDLKL 389

Query: 404 DKVIVTGNPGRVKIGD 419
           D  +VT + G +K+ D
Sbjct: 390 DNCVVTAD-GILKLID 404

>CAGL0K01661g complement(146952..148400) some similarities with
           tr|Q12100 Saccharomyces cerevisiae YDL025c, hypothetical
           start
          Length = 482

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 11/111 (9%)

Query: 326 NSNVVETKDAFITRAFNDASLCVVHEYFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLC 385
           ++NV+ET D  I R  N  SL +V EY P     Y+   +  + T ++ D +  Y  QLC
Sbjct: 239 HANVIETFD--IIREGN--SLLMVMEYAP-----YDFFDLVMTNT-MSPDEISCYFKQLC 288

Query: 386 SAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGDSCVHDILYFQDERDVLK 436
             +   H   +A  ++ LD  +VT N G +K+ D     I  +  ER+++K
Sbjct: 289 HGVNYLHAMGIAHRDLKLDNCVVT-NDGILKLIDFGSAVIFQYPYERNIVK 338

>Sklu_2099.2 , Contig c2099 975-2237 reverse complement
          Length = 420

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 12/110 (10%)

Query: 323 KVVNSNVVETKDAFITRAFNDASLCVVHEYFPQSSSLYETHFVSFSPTPITQDLLWSYLV 382
           +V N N+V+  +       ++ +  +V E+ P   SLY    ++ S TP T++   SY  
Sbjct: 193 RVGNRNIVKVIE------LHNKTNSLVMEFVP--FSLY--RIMTLSLTPSTEERK-SYFK 241

Query: 383 QLCSAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGDSCVHDILYFQDER 432
           Q+C AIQ  H   +   ++ L+ ++V    G VKI D     IL  QD +
Sbjct: 242 QICLAIQFLHGEGIVHRDLKLENIMV-DYEGCVKIIDFGSAVILASQDAK 290

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 75/171 (43%), Gaps = 21/171 (12%)

Query: 272 RVSNKDRYQGH---QNSLYKVFSNFD--GKVYIMRRIHDVKMKESV---QLFKPFQDWKK 323
           +   KD ++GH   +    + F   D  G+++  + +    +K      +L    Q  K 
Sbjct: 76  KTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKS 135

Query: 324 VVNSNVVETKDAFITRAFNDASLCVVHEYFPQSS--SLYETHFVSFSPTPITQDLLWSYL 381
           + + N+V+  D F     +D+++ ++ E  P  S   L +   V      +T+  +  + 
Sbjct: 136 MSHPNIVQFIDCF----EDDSNVYILLEICPNGSLMELLKRRKV------LTEPEVRFFT 185

Query: 382 VQLCSAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGDSCVHDILYFQDER 432
            Q+C AI+  H+R +   ++ L  +    N   +KIGD  +  +L  + ER
Sbjct: 186 TQICGAIKYMHSRRVIHRDLKLGNIFFDSNYN-LKIGDFGLAAVLANESER 235

>Kwal_33.14192
          Length = 577

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 66/148 (44%), Gaps = 16/148 (10%)

Query: 294 DGKVYIMRRIHDVKMKESV-----QLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCV 348
           DGK++ ++R      +ES      ++   F     + + N++ET D          +  V
Sbjct: 242 DGKMFAVKRFRARGSRESQIEYSKKVTSEFCIGSTLHHCNIIETLDMLQ----EGTNFLV 297

Query: 349 VHEYFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNICLDKVIV 408
           V EY P     Y+   +  S   ++++ +  Y  Q+C+ +   H   LA  ++ LD  +V
Sbjct: 298 VMEYCP-----YDFFNLVMSDL-MSKNEISCYFKQICNGVDYLHRMGLAHRDLKLDNCVV 351

Query: 409 TGNPGRVKIGDSCVHDILYFQDERDVLK 436
           T   G +K+ D     +  +  E+++L+
Sbjct: 352 TKQ-GILKLIDFGSAVVFQYPYEKEILR 378

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 11/94 (11%)

Query: 326 NSNVVETKDAFITRAFNDASLCVVHEYFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLC 385
           + N+VET D        D  L V+ EY P     Y+   +  S   +TQD +  Y  QLC
Sbjct: 366 HENIVETLDMLTE---GDTYLLVM-EYAP-----YDFFNLVMS-NLMTQDEVNCYFKQLC 415

Query: 386 SAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGD 419
             +   H+  LA  ++ LD  +VT + G +K+ D
Sbjct: 416 HGVNYLHSMGLAHRDLKLDNCVVTKD-GILKLID 448

>Scas_653.25
          Length = 666

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 14/95 (14%)

Query: 328 NVVETKDAFITRAFNDASLCVVHEYFPQ---SSSLYETHFVSFSPTPITQDLLWSYLVQL 384
           N++ET D F   +     +  + E+ P    +  +  TH ++   T       + Y  QL
Sbjct: 330 NIIETLDIFYNPS---GQISEIMEWCPHDFFNIVMSRTHLLTRRET-------FCYFKQL 379

Query: 385 CSAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGD 419
           C+ ++  HT  +A  ++ LD  ++T N G +K+ D
Sbjct: 380 CNGVRYLHTLGIAHRDLKLDNCVITYN-GILKLID 413

>Sklu_2396.3 YLR136C, Contig c2396 8035-8892 reverse complement
          Length = 285

 Score = 32.7 bits (73), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 2   NNPKAQSKIATTDMDKANAEWAKDIPCKNITIYGFCKYENEGCIFNHG 49
           NNP   +       +K N    K   C++ T  G+CKY N+ C F HG
Sbjct: 160 NNPSPAAATQPVSNEKVNRSLYKTELCESFTTKGYCKYGNK-CQFAHG 206

>CAGL0J04972g 472984..474003 some similarities with tr|Q12100
           Saccharomyces cerevisiae YDL025c, hypothetical start
          Length = 339

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 10/40 (25%), Positives = 25/40 (62%)

Query: 380 YLVQLCSAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGD 419
           Y +Q+C A+Q  H+R +   ++ L+ +++  +  ++K+ D
Sbjct: 146 YFLQICEAVQYLHSRGIVHRDLKLENIMLCADACQIKLID 185

>KLLA0A02717g 245082..246380 some similarities with sp|P53233
           Saccharomyces cerevisiae YGR052w, hypothetical start
          Length = 432

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 379 SYLVQLCSAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGD 419
           S + QLCSA++  HT  +A  +   + ++VT N G++K+ D
Sbjct: 130 SLMFQLCSALKYCHTLGIAHRDFKPENILVT-NTGKIKLTD 169

>Kwal_55.21088
          Length = 1455

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 47/98 (47%), Gaps = 15/98 (15%)

Query: 230 PNNMREELLKKNHAALQVFPSGGNLP-EIVGDYFGLVPLEFHNRVSNKDRYQGHQNSLYK 288
           P  + E+LL+ + A LQVF S   L  E V  Y+ L        ++N  + +       K
Sbjct: 532 PKEIIEKLLESSGADLQVFSSNHKLALETVQKYYSL-------EIANNPKVRE------K 578

Query: 289 VFSNFDGKVYIMRRIHDVKMKESVQLFKPFQDWKKVVN 326
           V ++F  K YI   +  +K K+ +Q   P++D K  +N
Sbjct: 579 VRADF-YKYYIADVVLSIKGKKEIQRGSPYEDIKYAIN 615

>YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine
           protein kinase of unknown function [1110 bp, 369 aa]
          Length = 369

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 368 SPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGD 419
           SP+ I  D+    + QLCSAI  AH+  +A  +I  + +++T N G +K+ D
Sbjct: 102 SPSLIQIDMQ-KIIKQLCSAISFAHSLGIAHRDIKPENILLTIN-GDIKLAD 151

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 28/41 (68%), Gaps = 1/41 (2%)

Query: 379 SYLVQLCSAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGD 419
           S+L QLCSAI   H+++++  +I  + V++  + G+VK+ D
Sbjct: 115 SFLFQLCSAISYCHSKDVSHRDIKPENVLMD-DRGQVKLTD 154

>Sklu_1585.2 YNL191W, Contig c1585 1282-1998
          Length = 238

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 7/73 (9%)

Query: 304 HDVKMKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCVVHEYFP----QSSSL 359
           H V  K  ++  +  +DW K  N N V  + + +  A  D S  VV  Y      +++SL
Sbjct: 61  HTVLRKALLKTIEYIKDWTKEANKNEVNAEPSLLNFAVTDGSTVVVSRYVTSKTDEAASL 120

Query: 360 Y---ETHFVSFSP 369
           +    + FV ++P
Sbjct: 121 HFSCGSSFVEYAP 133

>YOR129C (YOR129C) [4931] chr15 complement(566877..569558) Protein
           of unknown function [2682 bp, 893 aa]
          Length = 893

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 181 DAPGRYTNFPSIYPPSHSILQYHL--YAPD--PPLHLKVPLKANERTPETLFIPNNMREE 236
           D   +Y N  + +     ++QYH   + P   PP  LK+PL+ N    E ++I N+  E 
Sbjct: 291 DTKDKYGNIVTFH---DQLIQYHFTRFQPKTLPPFLLKIPLQFNMIRREPIYIENDYNEL 347

Query: 237 LLK 239
           +LK
Sbjct: 348 VLK 350

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 64/146 (43%), Gaps = 22/146 (15%)

Query: 295 GKVYIMRRIHDVKMKESV---QLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCVVHE 351
           GK++  + +  + +K      +L    Q  K + ++N+V+  D F     ++ ++ ++ E
Sbjct: 103 GKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHTNIVQFIDCF----EDNVNVYILLE 158

Query: 352 YFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHT-----RNLAFNNICLDKV 406
             P  S +     +    T IT+  +  ++ Q+C  IQ  H+     R+L   NI  D+ 
Sbjct: 159 ICPNGSLM---ELIKKRKT-ITEPEVRFFMTQICGGIQYMHSNRVIHRDLKLGNIFFDEH 214

Query: 407 IVTGNPGRVKIGDSCVHDILYFQDER 432
                   +KIGD  +  +L    ER
Sbjct: 215 Y------NLKIGDFGLAAVLANDRER 234

>Scas_649.21
          Length = 294

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 1/22 (4%)

Query: 28  CKNITIYGFCKYENEGCIFNHG 49
           C+  T+ G+CKYE++ C F HG
Sbjct: 187 CETFTVKGYCKYESK-CQFAHG 207

>YDR151C (CTH1) [995] chr4 complement(764172..765149) Protein
           containing two CCCH-type zinc finger domains, which bind
           DNA or RNA, has a region of high similarity to a region
           of mouse Zfp36l2, which is an apoptosis activator that
           may destabilize transcripts containing an AU-rich
           elements [978 bp, 325 aa]
          Length = 325

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%), Gaps = 1/22 (4%)

Query: 28  CKNITIYGFCKYENEGCIFNHG 49
           C++ TI G+CKY N+ C F HG
Sbjct: 210 CESFTIKGYCKYGNK-CQFAHG 230

>Kwal_14.1273
          Length = 415

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 381 LVQLCSAIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGD 419
           ++QLCSAI+ AH+  +A  +I  + V++  + G VK+ D
Sbjct: 114 VLQLCSAIEYAHSCGIAHRDIKPENVLL-DSAGNVKLAD 151

>YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of the
            COPII coat of secretory pathway vesicles involved in
            endoplasmic reticulum to Golgi transport, associated with
            Sec13p, member of WD (WD-40) repeat family [3822 bp, 1273
            aa]
          Length = 1273

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 44/116 (37%), Gaps = 12/116 (10%)

Query: 108  LAAKSAPFGSSYNPYA----ANFTPVGSAGXXXXXXXXXXXXXFNPYSAPAGMTTPGEAP 163
            +A   +P  S  NPYA    +   P+G+                NPY+ P     P +  
Sbjct: 994  VATSESPRASISNPYAPPQSSQQFPIGTISTANQTSNTAQVASSNPYAPP-----PQQRV 1048

Query: 164  LQPGASFIPGSPAPYAQD--APGRYTN-FPSIYPPSHSILQYHLYAPDPPLHLKVP 216
              P +  +P +P P A +  AP   T    S YPP+      H     PP+  K P
Sbjct: 1049 ATPLSGGVPPAPLPKASNPYAPTATTQPNGSSYPPTGPYTNNHTMTSPPPVFNKPP 1104

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,721,032
Number of extensions: 916886
Number of successful extensions: 2771
Number of sequences better than 10.0: 47
Number of HSP's gapped: 2710
Number of HSP's successfully gapped: 61
Length of query: 619
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 511
Effective length of database: 12,857,365
Effective search space: 6570113515
Effective search space used: 6570113515
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)