Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.85457056228280.0
Sklu_2380.257256522570.0
CAGL0D02662g56456220630.0
CAGL0D02640g56456220630.0
YMR011W (HXT2)54153020420.0
CAGL0I00286g55554520200.0
Sklu_2362.157256619680.0
YFL011W (HXT10)54653119080.0
Scas_715.5055951018910.0
Sklu_2415.257153918820.0
Sklu_2376.557952318720.0
YDR342C (HXT7)57055018700.0
YDR343C (HXT6)57055018700.0
AFL207C53950718620.0
Scas_658.2457055418520.0
Kwal_55.2007557156718490.0
YLR081W (GAL2)57454818220.0
YHR092C (HXT4)56055418140.0
Scas_541.657355618120.0
YJL219W (HXT9)56755917950.0
YOL156W (HXT11)56755417890.0
CAGL0A02211g55255417850.0
CAGL0A01826g53350517780.0
AFL205C54655217780.0
CAGL0A02233g54955017710.0
CAGL0A01782g56855817620.0
Scas_628.759353217630.0
CAGL0A00737g54954117580.0
KLLA0D13310g56756417570.0
Scas_541.759156017520.0
YHR096C (HXT5)59256417480.0
YJL214W (HXT8)56950317430.0
Sklu_2304.657156017350.0
Scas_550.957456417250.0
Scas_687.461055117110.0
CAGL0A02321g55654517010.0
Scas_509.256855816980.0
YDR345C (HXT3)56755716940.0
Kwal_26.668656954816920.0
Kwal_55.1958256756116760.0
YHR094C (HXT1)57055816700.0
Scas_658.2356855716700.0
Scas_712.155854016640.0
Kwal_56.2228556756116640.0
AFL204C53553516500.0
Scas_552.257254816190.0
Scas_657.2056955416180.0
CAGL0A01804g56354316140.0
Scas_685.556055615980.0
Scas_455.2*53550815590.0
YEL069C (HXT13)56455115340.0
YNR072W (HXT17)56455215220.0
YDL245C (HXT15)56756115180.0
YJR158W (HXT16)56756115100.0
YIL170W (HXT12)45744614820.0
Scas_634.1647144913920.0
Kwal_26.668041640313141e-179
Scas_600.12932829211e-121
KLLA0E21021g5284909001e-115
AFR602W5585288911e-113
Scas_716.535235368531e-108
Kwal_55.200682672578201e-106
YNL318C (HXT14)5404858251e-103
Kwal_56.248415114868171e-102
CAGL0M04103g5315268071e-101
Kwal_27.96785135017901e-98
Kwal_55.200642382117112e-90
Scas_624.57984996573e-76
CAGL0J09020g8565316322e-72
YDL194W (SNF3)8845406307e-72
CAGL0I03872g7624886221e-71
Kwal_56.244697095046165e-71
YDL138W (RGT2)7635506002e-68
KLLA0F05181g7875585774e-65
ADR091W6645005715e-65
Scas_701.448764825648e-63
Kwal_34.162613272175135e-60
Scas_637.96075754413e-47
Kwal_34.161905565064369e-47
AEL042C5475004296e-46
KLLA0A11110g5514994243e-45
Kwal_33.149115705094221e-44
ADR139C5584944201e-44
Scas_581.65876004202e-44
KLLA0F26246g5834974202e-44
AFR343C5715184183e-44
Sklu_2439.205715054174e-44
YDR536W (STL1)5695074122e-43
Kwal_56.227245783664113e-43
Sklu_2313.35784204097e-43
KLLA0C12309g5694214062e-42
YDR497C (ITR1)5843974052e-42
YOL103W (ITR2)6094874062e-42
KLLA0E00264g5114624004e-42
CAGL0I07447g5705273921e-40
Kwal_27.116387235143881e-39
CAGL0M01672g5475053344e-33
Sklu_2427.85785283347e-33
KLLA0A03223g6775033287e-32
Scas_632.145535263249e-32
Scas_552.0d112952853e-30
KLLA0E02970g5405593053e-29
KLLA0B00264g5765483029e-29
ABR223C6244403021e-28
KLLA0D00253g5845483011e-28
YDR387C5554112973e-28
Kwal_34.162661581572736e-28
KLLA0F06853g5285202939e-28
KLLA0D00374g5564842921e-27
Kwal_27.128111811762686e-27
AFL034W4744762847e-27
KLLA0E25025g5565482869e-27
Kwal_55.212895375562813e-26
KLLA0E14696g4774242732e-25
KLLA0E08987g5664822733e-25
Kwal_14.11055224752707e-25
Kwal_27.128151982002442e-23
YBR241C4883982582e-23
Kwal_33.129505664882583e-23
Kwal_27.106646535382541e-22
Kwal_14.16255064272511e-22
YJR160C (MPH3)6025872503e-22
YDL247W (MPH2)6095612485e-22
KLLA0B14861g5875332477e-22
Sklu_2144.65274632432e-21
YIL171W (HXT12)109932212e-21
Sklu_2375.16135572423e-21
YGL104C (VPS73)4864812395e-21
KLLA0D05379g4964942352e-20
KLLA0E01782g5724062301e-19
Sklu_2080.45234582291e-19
YBR298C (MAL31)6145912272e-19
KLLA0E06743g6674172263e-19
CAGL0C01771g4854702244e-19
CAGL0K12716g4844302218e-19
YGR289C (MAL11)6163962183e-18
AGL277W6714732103e-17
Scas_597.54893982075e-17
Kwal_27.110796134952032e-16
Scas_652.124783691985e-16
KLLA0C19481g3903341958e-16
YFL040W5405061881e-14
Scas_105.156441511e-12
Kwal_27.113852222081092e-05
YDL199C6874701094e-05
Sklu_1567.2569971086e-05
Kwal_26.66695901361061e-04
KLLA0E03729g6093051032e-04
CAGL0B02475g5802881023e-04
KLLA0F13684g5711141014e-04
Sklu_2405.65961651005e-04
YML123C (PHO84)5872491005e-04
Kwal_27.12173567171996e-04
Scas_694.19581162997e-04
Scas_626.1570242980.001
AGR076C68690960.002
ADL258W534243930.003
YIL120W (QDR1)563254930.003
Kwal_56.23754589140930.004
AFR322C592183910.006
Kwal_47.18919640202910.007
YDR119W768145910.007
Sklu_2348.1565150900.007
Sklu_2304.556599900.007
Sklu_1959.3531237900.008
CAGL0I10384g630237900.008
KLLA0E14652g639191900.008
CAGL0J01375g56486880.015
KLLA0A04631g57969880.016
YBR180W (DTR1)572117870.020
Scas_705.26614295870.020
YNL065W (AQR1)586180870.020
KLLA0F10043g528168860.020
Scas_692.8625327860.022
CAGL0B02079g624307860.024
KLLA0E24156g575309860.024
Sklu_2253.3523149860.026
Kwal_23.4824553176850.032
Scas_660.356886840.037
Scas_721.15530111840.038
CAGL0M06281g542164840.042
YPR156C (TPO3)622200840.046
YIL121W542252830.054
Scas_713.30630133820.069
YPR198W (SGE1)54391820.074
Kwal_14.728568147800.13
Scas_712.56620202800.13
Sklu_1110.165790800.14
Kwal_47.18976534142790.15
Sklu_2289.2528173790.17
YMR088C56286780.19
Scas_676.25634202790.19
KLLA0F17776g55386780.22
YGR138C (TPO2)614200770.26
KLLA0C19459g149139730.30
Kwal_26.7984612103770.30
AGR195W619166770.30
YEL065W (SIT1)628202760.39
Kwal_23.485360361760.40
Sklu_2348.2600177760.41
YKR105C582138750.52
KLLA0F18106g589181740.58
YHR048W514206740.59
YCR023C611107740.60
AGL069C59489740.61
CAGL0I09702g521111730.82
KLLA0C00220g62484730.86
Kwal_14.158557069721.1
Sklu_2394.9533230721.1
KLLA0A10439g63468721.2
KLLA0E14520g25175701.2
YJL163C55584711.5
Kwal_23.279461975711.5
Sklu_2083.159838711.6
Kwal_14.722611105701.8
CAGL0J09944g592182701.8
Kwal_56.2229861069692.4
YER051W49263682.9
Scas_663.28*620169692.9
Kwal_23.524159161683.5
Sklu_2183.3504289683.5
YHL047C (ARN2)63775683.8
YML116W (ATR1)542112673.9
Scas_680.736464674.4
KLLA0F03311g542160674.4
YKR106W61593674.5
ADR336C56895674.6
YGR224W (AZR1)613124674.6
YHL040C (ARN1)62734674.6
YCL073C61593674.7
CAGL0L02519g529203674.8
KLLA0E09856g630110665.5
KLLA0A01694g56850665.9
KLLA0C10692g52032666.4
CAGL0I09086g61890657.2
Sklu_2143.162098657.7
AEL057C557122649.0
Kwal_33.1426856962649.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.854
         (562 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.854                                                          1093   0.0  
Sklu_2380.2 YMR011W, Contig c2380 4381-6099 reverse complement        874   0.0  
CAGL0D02662g complement(278099..279793) highly similar to sp|P23...   799   0.0  
CAGL0D02640g 274285..275979 highly similar to sp|P23585 Saccharo...   799   0.0  
YMR011W (HXT2) [3975] chr13 (288078..289703) High-affinity hexos...   791   0.0  
CAGL0I00286g complement(20521..22188) highly similar to sp|P2358...   782   0.0  
Sklu_2362.1 YDR342C, Contig c2362 924-2642                            762   0.0  
YFL011W (HXT10) [1671] chr6 (112339..113979) Member of the hexos...   739   0.0  
Scas_715.50                                                           733   0.0  
Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement        729   0.0  
Sklu_2376.5 , Contig c2376 9071-10810 reverse complement              725   0.0  
YDR342C (HXT7) [1170] chr4 complement(1154206..1155918) High-aff...   724   0.0  
YDR343C (HXT6) [1171] chr4 complement(1159598..1161310) High-aff...   724   0.0  
AFL207C [2988] [Homologous to ScAFL207C] (44349..45968) [1620 bp...   721   0.0  
Scas_658.24                                                           717   0.0  
Kwal_55.20075                                                         716   0.0  
YLR081W (GAL2) [3496] chr12 (290213..291937) Galactose and gluco...   706   0.0  
YHR092C (HXT4) [2382] chr8 complement(287131..288813) Moderate- ...   703   0.0  
Scas_541.6                                                            702   0.0  
YJL219W (HXT9) [2711] chr10 (19497..21200) Member of the hexose ...   696   0.0  
YOL156W (HXT11) [4669] chr15 (25272..26975) Low-affinity glucose...   693   0.0  
CAGL0A02211g complement(224864..226522) highly similar to sp|P39...   692   0.0  
CAGL0A01826g complement(179321..180922) highly similar to sp|P38...   689   0.0  
AFL205C [2990] [Homologous to ScYHR094C - SH] (49039..50679) [16...   689   0.0  
CAGL0A02233g complement(231128..232777) highly similar to sp|P39...   686   0.0  
CAGL0A01782g complement(170326..172032) highly similar to sp|P39...   683   0.0  
Scas_628.7                                                            683   0.0  
CAGL0A00737g 74767..76416 highly similar to sp|P39003 Saccharomy...   681   0.0  
KLLA0D13310g complement(1143027..1144730) gi|131828|sp|P18631|RA...   681   0.0  
Scas_541.7                                                            679   0.0  
YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of ...   677   0.0  
YJL214W (HXT8) [2715] chr10 (26887..28596) Member of the hexose ...   676   0.0  
Sklu_2304.6 , Contig c2304 11341-13056 reverse complement             672   0.0  
Scas_550.9                                                            669   0.0  
Scas_687.4                                                            663   0.0  
CAGL0A02321g complement(247500..249170) highly similar to sp|P32...   659   0.0  
Scas_509.2                                                            658   0.0  
YDR345C (HXT3) [1172] chr4 complement(1162947..1164650) Low-affi...   657   0.0  
Kwal_26.6686                                                          656   0.0  
Kwal_55.19582                                                         650   0.0  
YHR094C (HXT1) [2383] chr8 complement(290915..292627) Low-affini...   647   0.0  
Scas_658.23                                                           647   0.0  
Scas_712.1                                                            645   0.0  
Kwal_56.22285                                                         645   0.0  
AFL204C [2991] [Homologous to ScAFL204C] (51587..53194) [1608 bp...   640   0.0  
Scas_552.2                                                            628   0.0  
Scas_657.20                                                           627   0.0  
CAGL0A01804g complement(175488..177179) highly similar to sp|P32...   626   0.0  
Scas_685.5                                                            620   0.0  
Scas_455.2*                                                           605   0.0  
YEL069C (HXT13) [1361] chr5 complement(21537..23231) Member of t...   595   0.0  
YNR072W (HXT17) [4655] chr14 (772654..774348) Member of the hexo...   590   0.0  
YDL245C (HXT15) [632] chr4 complement(11657..13360) Member of th...   589   0.0  
YJR158W (HXT16) [3048] chr10 (732355..734058) Member of the hexo...   586   0.0  
YIL170W (HXT12) [2508] chr9 (19847..21220) Protein of unknown fu...   575   0.0  
Scas_634.16                                                           540   0.0  
Kwal_26.6680                                                          510   e-179
Scas_600.1                                                            359   e-121
KLLA0E21021g 1870154..1871740 gi|32400014|emb|CAE00632.1 Kluyver...   351   e-115
AFR602W [3794] [Homologous to ScYNL318C (HXT14 ) - NSH] compleme...   347   e-113
Scas_716.53                                                           333   e-108
Kwal_55.20068                                                         320   e-106
YNL318C (HXT14) [4295] chr14 complement(38706..40328) Member of ...   322   e-103
Kwal_56.24841                                                         319   e-102
CAGL0M04103g 452677..454272 similar to sp|P42833 Saccharomyces c...   315   e-101
Kwal_27.9678                                                          308   1e-98
Kwal_55.20064                                                         278   2e-90
Scas_624.5                                                            257   3e-76
CAGL0J09020g 887145..889715 highly similar to sp|P10870 Saccharo...   248   2e-72
YDL194W (SNF3) [679] chr4 (111581..114235) High-affinity glucose...   247   7e-72
CAGL0I03872g 337985..340273 some similarities with sp|Q12300 Sac...   244   1e-71
Kwal_56.24469                                                         241   5e-71
YDL138W (RGT2) [730] chr4 (213352..215643) Low-affinity glucose ...   235   2e-68
KLLA0F05181g 510384..512747 gi|2440082|emb|CAA75114.1 Kluyveromy...   226   4e-65
ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W (...   224   5e-65
Scas_701.44                                                           221   8e-63
Kwal_34.16261                                                         202   5e-60
Scas_637.9                                                            174   3e-47
Kwal_34.16190                                                         172   9e-47
AEL042C [2464] [Homologous to ScYOL156W (HXT11) - SH] (557191..5...   169   6e-46
KLLA0A11110g 964084..965739 gi|1346290|sp|P49374|HGT1_KLULA Kluy...   167   3e-45
Kwal_33.14911                                                         167   1e-44
ADR139C [1880] [Homologous to ScYDR536W (STL1) - NSH] (950171..9...   166   1e-44
Scas_581.6                                                            166   2e-44
KLLA0F26246g 2432209..2433960 similar to sp|P39932 Saccharomyces...   166   2e-44
AFR343C [3535] [Homologous to ScYOL103W (ITR2) - SH; ScYDR497C (...   165   3e-44
Sklu_2439.20 YDR536W, Contig c2439 31933-33648                        165   4e-44
YDR536W (STL1) [1346] chr4 (1507992..1509701) Member of the hexo...   163   2e-43
Kwal_56.22724                                                         162   3e-43
Sklu_2313.3 YDR497C, Contig c2313 3640-5376 reverse complement        162   7e-43
KLLA0C12309g 1046848..1048557 highly similar to sp|P30606 Saccha...   160   2e-42
YDR497C (ITR1) [1312] chr4 complement(1443701..1445455) Myo-inos...   160   2e-42
YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permea...   160   2e-42
KLLA0E00264g 15302..16837 weakly similar to sp|P54854 Saccharomy...   158   4e-42
CAGL0I07447g 716104..717816 highly similar to sp|P30606 Saccharo...   155   1e-40
Kwal_27.11638                                                         154   1e-39
CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces c...   133   4e-33
Sklu_2427.8 , Contig c2427 19304-21040                                133   7e-33
KLLA0A03223g 290002..292035 some similarities with sp|P39932 Sac...   130   7e-32
Scas_632.14                                                           129   9e-32
Scas_552.0d                                                           114   3e-30
KLLA0E02970g complement(278965..280587) similar to sgd|S0002795 ...   122   3e-29
KLLA0B00264g 12844..14574 gi|5441459|emb|CAB46745.1 Kluyveromyce...   120   9e-29
ABR223C [817] [Homologous to ScYFL040W - SH] (820632..822506) [1...   120   1e-28
KLLA0D00253g <12780..14534 gi|5441459|emb|CAB46745.1 Kluyveromyc...   120   1e-28
YDR387C (YDR387C) [1215] chr4 complement(1248142..1249809) Membe...   119   3e-28
Kwal_34.16266                                                         109   6e-28
KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromy...   117   9e-28
KLLA0D00374g 30962..32632 weakly similar to sp|Q9P8X7 Aspergillu...   117   1e-27
Kwal_27.12811                                                         107   6e-27
AFL034W [3159] [Homologous to ScYBR241C - SH; ScYGL104C - SH] co...   114   7e-27
KLLA0E25025g complement(2219051..2220721) weakly similar to sp|P...   114   9e-27
Kwal_55.21289                                                         112   3e-26
KLLA0E14696g 1309427..1310860 weakly similar to sp|Q9P8X7 Asperg...   109   2e-25
KLLA0E08987g 804915..806615 gi|22293246|emb|CAC79614.1 Kluyverom...   109   3e-25
Kwal_14.1105                                                          108   7e-25
Kwal_27.12815                                                          99   2e-23
YBR241C (YBR241C) [420] chr2 complement(702546..704012) Member o...   103   2e-23
Kwal_33.12950                                                         103   3e-23
Kwal_27.10664                                                         102   1e-22
Kwal_14.1625                                                          101   1e-22
YJR160C (MPH3) [3050] chr10 complement(737923..739731) Protein w...   100   3e-22
YDL247W (MPH2) [630] chr4 (5985..7814) Protein with maltose perm...   100   5e-22
KLLA0B14861g complement(1305927..1307690) gi|125935|sp|P07921|LA...   100   7e-22
Sklu_2144.6 YFL040W, Contig c2144 7747-9330 reverse complement         98   2e-21
YIL171W (HXT12) [2507] chr9 (19515..19844) Member of the hexose ...    90   2e-21
Sklu_2375.1 YGR289C, Contig c2375 1376-3217 reverse complement         98   3e-21
YGL104C (VPS73) [1880] chr7 complement(308714..310174) Putative ...    97   5e-21
KLLA0D05379g complement(464200..465690) weakly similar to sp|P43...    95   2e-20
KLLA0E01782g 171319..173037 weakly similar to ca|CA5798|IPF4181 ...    93   1e-19
Sklu_2080.4 YBR241C, Contig c2080 4658-6229                            93   1e-19
YBR298C (MAL31) [475] chr2 complement(802587..804431) Maltose pe...    92   2e-19
KLLA0E06743g complement(612941..614944) similar to ca|CA5798|IPF...    92   3e-19
CAGL0C01771g 187030..188487 similar to sp|P38142 Saccharomyces c...    91   4e-19
CAGL0K12716g complement(1260169..1261623) similar to sp|P43562 S...    90   8e-19
YGR289C (MAL11) [2234] chr7 complement(1073968..1075818) Maltose...    89   3e-18
AGL277W [4035] [Homologous to NOHBY] complement(185070..187085) ...    86   3e-17
Scas_597.5                                                             84   5e-17
Kwal_27.11079                                                          83   2e-16
Scas_652.12                                                            81   5e-16
KLLA0C19481g 1747623..1748795 similar to ca|CA3241|IPF7493 Candi...    80   8e-16
YFL040W (YFL040W) [1643] chr6 (51350..52972) Putative hexose tra...    77   1e-14
Scas_105.1                                                             63   1e-12
Kwal_27.11385                                                          47   2e-05
YDL199C (YDL199C) [675] chr4 complement(101291..103354) Member o...    47   4e-05
Sklu_1567.2 YPR198W, Contig c1567 1150-2859                            46   6e-05
Kwal_26.6669                                                           45   1e-04
KLLA0E03729g 349784..351613 similar to sgd|S0006360 Saccharomyce...    44   2e-04
CAGL0B02475g 236029..237771 highly similar to sp|P25297 Saccharo...    44   3e-04
KLLA0F13684g complement(1267367..1269082) similar to sp|Q04301 S...    44   4e-04
Sklu_2405.6 YBR180W, Contig c2405 11289-13079 reverse complement       43   5e-04
YML123C (PHO84) [3849] chr13 complement(24038..25801) High-affin...    43   5e-04
Kwal_27.12173                                                          43   6e-04
Scas_694.19                                                            43   7e-04
Scas_626.1                                                             42   0.001
AGR076C [4386] [Homologous to ScYDR119W - SH] (871570..873630) [...    42   0.002
ADL258W [1483] [Homologous to ScYNL065W (AQR1) - SH; ScYIL121W -...    40   0.003
YIL120W (QDR1) [2556] chr9 (134414..136105) Member of the multid...    40   0.003
Kwal_56.23754                                                          40   0.004
AFR322C [3514] [Homologous to ScYGR138C (TPO2) - SH; ScYPR156C (...    40   0.006
Kwal_47.18919                                                          40   0.007
YDR119W (YDR119W) [966] chr4 (688221..690527) Member of the 14-s...    40   0.007
Sklu_2348.1 YNL065W, Contig c2348 581-2278 reverse complement          39   0.007
Sklu_2304.5 , Contig c2304 8691-10388                                  39   0.007
Sklu_1959.3 , Contig c1959 3851-5446 reverse complement                39   0.008
CAGL0I10384g 1016935..1018827 highly similar to sp|P53283 Saccha...    39   0.008
KLLA0E14652g 1302073..1303992 similar to sp|P38724 Saccharomyces...    39   0.008
CAGL0J01375g 127843..129537 similar to sp|Q04301 Saccharomyces c...    39   0.015
KLLA0A04631g complement(415070..416809) similar to ca|CA1324|IPF...    39   0.016
YBR180W (DTR1) [364] chr2 (589698..591416) Dityrosine transporte...    38   0.020
Scas_705.26                                                            38   0.020
YNL065W (AQR1) [4525] chr14 (503723..505483) Member of the multi...    38   0.020
KLLA0F10043g complement(928691..930277) weakly similar to sp|P36...    38   0.020
Scas_692.8                                                             38   0.022
CAGL0B02079g complement(191736..193610) similar to sp|P50080 Sac...    38   0.024
KLLA0E24156g complement(2148115..2149842) similar to sp|P38125 S...    38   0.024
Sklu_2253.3 , Contig c2253 3254-4825 reverse complement                38   0.026
Kwal_23.4824                                                           37   0.032
Scas_660.3                                                             37   0.037
Scas_721.15                                                            37   0.038
CAGL0M06281g 651932..653560 similar to sp|P38125 Saccharomyces c...    37   0.042
YPR156C (TPO3) [5571] chr16 complement(837903..839771) Polyamine...    37   0.046
YIL121W (YIL121W) [2555] chr9 (132241..133869) Member of the mul...    37   0.054
Scas_713.30                                                            36   0.069
YPR198W (SGE1) [5610] chr16 (934028..935659) Crystal violet resi...    36   0.074
Kwal_14.728                                                            35   0.13 
Scas_712.56                                                            35   0.13 
Sklu_1110.1 YDR119W, Contig c1110 22-1995                              35   0.14 
Kwal_47.18976                                                          35   0.15 
Sklu_2289.2 , Contig c2289 5004-6585                                   35   0.17 
YMR088C (YMR088C) [4046] chr13 complement(443413..445101) Member...    35   0.19 
Scas_676.25                                                            35   0.19 
KLLA0F17776g complement(1627198..1628859) similar to ca|CA1324|I...    35   0.22 
YGR138C (TPO2) [2094] chr7 complement(763765..765609) Polyamine ...    34   0.26 
KLLA0C19459g 1746987..1747436 some similarities with ca|CA3241|I...    33   0.30 
Kwal_26.7984                                                           34   0.30 
AGR195W [4506] [Homologous to ScYBR180W (DTR1) - SH] complement(...    34   0.30 
YEL065W (SIT1) [1363] chr5 (27657..29543) Ferrioxamine B permeas...    34   0.39 
Kwal_23.4853                                                           34   0.40 
Sklu_2348.2 YIL121W, Contig c2348 2640-4442 reverse complement         34   0.41 
YKR105C (YKR105C) [3356] chr11 complement(658352..660100) Member...    33   0.52 
KLLA0F18106g 1657556..1659325 similar to sgd|S0003951 Saccharomy...    33   0.58 
YHR048W (YHR048W) [2336] chr8 (204599..206143) Member of the mul...    33   0.59 
YCR023C (YCR023C) [557] chr3 complement(158533..160368) Member o...    33   0.60 
AGL069C [4242] [Homologous to ScYNR055C (HOL1) - NSH] (578235..5...    33   0.61 
CAGL0I09702g complement(925113..926678) similar to tr|Q08777 Sac...    33   0.82 
KLLA0C00220g 13632..15506 similar to sp|P38724 Saccharomyces cer...    33   0.86 
Kwal_14.1585                                                           32   1.1  
Sklu_2394.9 YHR048W, Contig c2394 13885-15486                          32   1.1  
KLLA0A10439g complement(913342..915246) similar to sp|P38731 Sac...    32   1.2  
KLLA0E14520g complement(1279788..1280543) similar to sp|P38724 S...    32   1.2  
YJL163C (YJL163C) [2758] chr10 complement(111661..113328) Protei...    32   1.5  
Kwal_23.2794                                                           32   1.5  
Sklu_2083.1 YKL217W, Contig c2083 424-2220                             32   1.6  
Kwal_14.722                                                            32   1.8  
CAGL0J09944g 974150..975928 similar to sp|P53943 Saccharomyces c...    32   1.8  
Kwal_56.22298                                                          31   2.4  
YER051W (YER051W) [1479] chr5 (254655..256133) Protein containin...    31   2.9  
Scas_663.28*                                                           31   2.9  
Kwal_23.5241                                                           31   3.5  
Sklu_2183.3 YCR098C, Contig c2183 6694-8208                            31   3.5  
YHL047C (ARN2) [2242] chr8 complement(8298..10211) Triacetylfusa...    31   3.8  
YML116W (ATR1) [3855] chr13 (38196..39824) Membrane transporter ...    30   3.9  
Scas_680.7                                                             30   4.4  
KLLA0F03311g 311639..313267 similar to sp|P53943 Saccharomyces c...    30   4.4  
YKR106W (YKR106W) [3357] chr11 (661078..662925) Member of the ye...    30   4.5  
ADR336C [2077] [Homologous to ScYNR055C (HOL1) - NSH] (1299396.....    30   4.6  
YGR224W (AZR1) [2173] chr7 (942807..944648) Protein involved in ...    30   4.6  
YHL040C (ARN1) [2247] chr8 complement(19085..20968) Protein invo...    30   4.6  
YCL073C (YCL073C) [479] chr3 complement(6479..8326) Member of th...    30   4.7  
CAGL0L02519g complement(295558..297147) similar to tr|Q08902 Sac...    30   4.8  
KLLA0E09856g complement(874102..875994) similar to sp|P36172 Sac...    30   5.5  
KLLA0A01694g complement(149587..151293) similar to ca|CA1136|CaI...    30   5.9  
KLLA0C10692g complement(916718..918280) weakly similar to sp|P21...    30   6.4  
CAGL0I09086g complement(878737..880593) similar to sp|P53918 Sac...    30   7.2  
Sklu_2143.1 YHL047C, Contig c2143 1127-2989                            30   7.7  
AEL057C [2449] [Homologous to ScYCR023C - SH] (528384..530057) [...    29   9.0  
Kwal_33.14268                                                          29   9.7  

>Kwal_14.854
          Length = 570

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/562 (95%), Positives = 538/562 (95%)

Query: 1   MSSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKP 60
           MSSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKP
Sbjct: 1   MSSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKP 60

Query: 61  LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGL 120
           LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGL
Sbjct: 61  LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGL 120

Query: 121 IVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVS 180
           IVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVS
Sbjct: 121 IVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVS 180

Query: 181 GLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKL 240
           GLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKL
Sbjct: 181 GLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKL 240

Query: 241 PLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELIN 300
           PLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELIN
Sbjct: 241 PLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELIN 300

Query: 301 AGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMK 360
           AGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMK
Sbjct: 301 AGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMK 360

Query: 361 DSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGK 420
           DSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGK
Sbjct: 361 DSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGK 420

Query: 421 DMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGF 480
           DMPSSKSAGNAMI             WAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGF
Sbjct: 421 DMPSSKSAGNAMIFFTCLFIFFFATTWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGF 480

Query: 481 AIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKS 540
           AIGFGTPFITSAIGFYYGYVFMGCL           CETKGLTLEEVNEMYQEGVLPWKS
Sbjct: 481 AIGFGTPFITSAIGFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYQEGVLPWKS 540

Query: 541 ETWVPALRRNESYDVNETQEDS 562
           ETWVPALRRNESYDVNETQEDS
Sbjct: 541 ETWVPALRRNESYDVNETQEDS 562

>Sklu_2380.2 YMR011W, Contig c2380 4381-6099 reverse complement
          Length = 572

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/565 (75%), Positives = 477/565 (84%), Gaps = 4/565 (0%)

Query: 1   MSSSATPMNDRSNSNTELAAV---SSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIP 57
           MS+S TP+++RS ++ ++ A     S    + Q+ TPSNK S D F  K  +     EIP
Sbjct: 1   MSTSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENE-HFPEIP 59

Query: 58  QKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVR 117
           QK LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGN+   E  Y LS+VR
Sbjct: 60  QKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVR 119

Query: 118 TGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGR 177
           TGLIV+IFNIGCA GGLTLGRLGD+YGRRLGLM V+ VYVVGIIIQIA+ +KWYQYFIGR
Sbjct: 120 TGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCVVCVYVVGIIIQIATGDKWYQYFIGR 179

Query: 178 IVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQ 237
           I+SGLGVGGIAVLSPTLISETAPKHLRGTCV+FYQLMITLGIF+GYCTNYGTKTY+N+VQ
Sbjct: 180 IISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQ 239

Query: 238 WKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVE 297
           W++PLG+CF WAIFMIAGM+ VPESPR+LIEKG FEEA+RSIAKSNKLTVED GV AEVE
Sbjct: 240 WRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVE 299

Query: 298 LINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAV 357
           LINAGVEAEKLAG+A+WGELFS KGKILQRVIMG +IQSLQQLTGNNYFFYYGTTIF AV
Sbjct: 300 LINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAV 359

Query: 358 GMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYP 417
           GM DSFQTSIVLG+VNFASTFVGL+TVE++GRRKCLLWGSA+M+ CFVVFASVGVT+L+P
Sbjct: 360 GMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWP 419

Query: 418 NGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWI 477
           NG+D PSSK AGN MI             WAPIAYVIVSE+YPLRVKNRAMA++VGSNWI
Sbjct: 420 NGQDQPSSKGAGNCMIVFTCFFIFCFATTWAPIAYVIVSESYPLRVKNRAMAISVGSNWI 479

Query: 478 WGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLP 537
           WGF IGF TPFITSAI FYYGYVFMGCL           CETKGLTLEEVNEMY+EGVLP
Sbjct: 480 WGFLIGFFTPFITSAINFYYGYVFMGCLVFSYFYVFFFVCETKGLTLEEVNEMYEEGVLP 539

Query: 538 WKSETWVPALRRNESYDVNETQEDS 562
           WKS++W+PA RR   Y+  E   D 
Sbjct: 540 WKSDSWLPAGRRGTDYNTEEAHTDD 564

>CAGL0D02662g complement(278099..279793) highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 high-affinity
           hexose transporter, start by similarity
          Length = 564

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/562 (69%), Positives = 442/562 (78%), Gaps = 6/562 (1%)

Query: 1   MSSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKP 60
           MS + +     S  N+ +  V+    F         K + D       SP    E P KP
Sbjct: 1   MSQAQSLSPSESAENSPVREVNVANSFKDDDFILEQKQTAD---VSAMSP--EAEAPPKP 55

Query: 61  LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGL 120
           +S Y  V+CLCLM+AFGGFVFGWDTGTISGFV  TDFKRRFG     +  Y LSDVRTGL
Sbjct: 56  ISAYFTVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQ-QAADGSYYLSDVRTGL 114

Query: 121 IVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVS 180
           IV+IFNIGCAIGGLTLGRLGDMYGRRLGLMAVI VYVVGI+IQI+S+  WYQYF+GRIVS
Sbjct: 115 IVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTTWYQYFVGRIVS 174

Query: 181 GLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKL 240
           GLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIF+GYCTNYGTKT++N++QW++
Sbjct: 175 GLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKTHTNSIQWRV 234

Query: 241 PLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELIN 300
           PLGLCF WA+FM+ GM  VPESPR+L+EKG FEEA+RS+A+SNK++++D  V AE+E I+
Sbjct: 235 PLGLCFAWALFMLVGMSMVPESPRFLVEKGRFEEARRSLARSNKVSMDDPIVTAEIENIS 294

Query: 301 AGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMK 360
           AGVEAEK AGNASWGELFS KGKILQRV+MG +IQSLQQLTG NYFFYYGTTIF AVG++
Sbjct: 295 AGVEAEKSAGNASWGELFSTKGKILQRVVMGIMIQSLQQLTGCNYFFYYGTTIFKAVGLE 354

Query: 361 DSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGK 420
           DSFQTSI+LG+VNFASTFV LY V+R+GRRKCLLWGS+ M+VC V+FASVGV  LYPNGK
Sbjct: 355 DSFQTSIILGIVNFASTFVALYVVDRFGRRKCLLWGSSTMAVCMVIFASVGVKSLYPNGK 414

Query: 421 DMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGF 480
           D PSS +AGN MI             WAP AYVIV+ETYPLRVKNRAMA+AVG NWIWGF
Sbjct: 415 DQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVAETYPLRVKNRAMAIAVGFNWIWGF 474

Query: 481 AIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKS 540
            IGF TPFIT+AI FYYGYVFMGCL           CETKGLTLEEVNEMY+EGVLPWKS
Sbjct: 475 LIGFFTPFITTAINFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYEEGVLPWKS 534

Query: 541 ETWVPALRRNESYDVNETQEDS 562
             W+P  +R   YDV+    D 
Sbjct: 535 AQWLPTTKRTSGYDVDAALHDD 556

>CAGL0D02640g 274285..275979 highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 high-affinity
           hexose transporter, start by similarity
          Length = 564

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/562 (69%), Positives = 442/562 (78%), Gaps = 6/562 (1%)

Query: 1   MSSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKP 60
           MS + +     S  N+ +  V+    F         K + D       SP    E P KP
Sbjct: 1   MSQAQSLSPSESAENSPVREVNVANSFKDDDFILEQKQTAD---VSAMSP--EAEAPPKP 55

Query: 61  LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGL 120
           +S Y  V+CLCLM+AFGGFVFGWDTGTISGFV  TDFKRRFG     +  Y LSDVRTGL
Sbjct: 56  ISAYFTVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQ-QAADGSYYLSDVRTGL 114

Query: 121 IVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVS 180
           IV+IFNIGCAIGGLTLGRLGDMYGRRLGLMAVI VYVVGI+IQI+S+  WYQYF+GRIVS
Sbjct: 115 IVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTTWYQYFVGRIVS 174

Query: 181 GLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKL 240
           GLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIF+GYCTNYGTKT++N++QW++
Sbjct: 175 GLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKTHTNSIQWRV 234

Query: 241 PLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELIN 300
           PLGLCF WA+FM+ GM  VPESPR+L+EKG FEEA+RS+A+SNK++++D  V AE+E I+
Sbjct: 235 PLGLCFAWALFMLVGMSMVPESPRFLVEKGRFEEARRSLARSNKVSMDDPIVTAEIENIS 294

Query: 301 AGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMK 360
           AGVEAEK AGNASWGELFS KGKILQRV+MG +IQSLQQLTG NYFFYYGTTIF AVG++
Sbjct: 295 AGVEAEKSAGNASWGELFSTKGKILQRVVMGIMIQSLQQLTGCNYFFYYGTTIFKAVGLE 354

Query: 361 DSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGK 420
           DSFQTSI+LG+VNFASTFV LY V+R+GRRKCLLWGS+ M+VC V+FASVGV  LYPNGK
Sbjct: 355 DSFQTSIILGIVNFASTFVALYVVDRFGRRKCLLWGSSTMAVCMVIFASVGVKSLYPNGK 414

Query: 421 DMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGF 480
           D PSS +AGN MI             WAP AYVIV+ETYPLRVKNRAMA+AVG NWIWGF
Sbjct: 415 DQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVAETYPLRVKNRAMAIAVGFNWIWGF 474

Query: 481 AIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKS 540
            IGF TPFIT+AI FYYGYVFMGCL           CETKGLTLEEVNEMY+EGVLPWKS
Sbjct: 475 LIGFFTPFITTAINFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYEEGVLPWKS 534

Query: 541 ETWVPALRRNESYDVNETQEDS 562
             W+P  +R   YDV+    D 
Sbjct: 535 AQWLPTTKRTSGYDVDAALHDD 556

>YMR011W (HXT2) [3975] chr13 (288078..289703) High-affinity hexose
           transporter, member of the hexose transport family of
           the major facilitator superfamily (MFS) [1626 bp, 541
           aa]
          Length = 541

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/530 (72%), Positives = 439/530 (82%), Gaps = 2/530 (0%)

Query: 21  VSSPTDFDSQSRTP-SNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGGF 79
           V S +   S   TP   KL  D    +T S   N E+P KP++ Y  V+CLCLM+AFGGF
Sbjct: 9   VESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGF 68

Query: 80  VFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRL 139
           VFGWDTGTISGFVN TDFKRRFG     +  Y LSDVRTGLIV IFNIGCA GGLTLGRL
Sbjct: 69  VFGWDTGTISGFVNQTDFKRRFGQMK-SDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRL 127

Query: 140 GDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETA 199
           GDMYGRR+GLM V+LVY+VGI+IQIASS+KWYQYFIGRI+SG+GVGGIAVLSPTLISETA
Sbjct: 128 GDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETA 187

Query: 200 PKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFV 259
           PKH+RGTCVSFYQLMITLGIF+GYCTNYGTK YSN+VQW++PLGL F +AIFMIAGM+ V
Sbjct: 188 PKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMV 247

Query: 260 PESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFS 319
           PESPR+L+EKG +E+AKRS+AKSNK+T+ED  ++AE++ I A VE E+LAGNASWGELFS
Sbjct: 248 PESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFS 307

Query: 320 PKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFV 379
            KG IL RVIMG +IQSLQQLTGNNYFFYYGTTIF+AVGMKDSFQTSIVLG+VNFASTFV
Sbjct: 308 NKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFV 367

Query: 380 GLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXX 439
            LYTV+++GRRKCLL GSA+M++CFV+F++VGVT LYPNGKD PSSK+AGN MI      
Sbjct: 368 ALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLF 427

Query: 440 XXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGY 499
                  WAPIAYVIV+E+YPLRVKNRAMA+AVG+NWIWGF IGF TPFITSAIGF YGY
Sbjct: 428 IFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGY 487

Query: 500 VFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRR 549
           VFMGCL           CETKGLTLEEVNEMY EGV PWKS +W+   +R
Sbjct: 488 VFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYVEGVKPWKSGSWISKEKR 537

>CAGL0I00286g complement(20521..22188) highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 or sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 555

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/545 (71%), Positives = 445/545 (81%), Gaps = 2/545 (0%)

Query: 19  AAVSSPTDFDSQSRTPSNKLSEDGFATKTT-SPLENNEIPQKPLSEYILVMCLCLMVAFG 77
           +A+SS +  D + +TP  KL  + F  K   + ++  EIP+KPL  Y  VMCLCLM+AFG
Sbjct: 4   SAISSTSATDPERQTPETKLEGEDFQLKADEASIQGAEIPRKPLGAYWTVMCLCLMIAFG 63

Query: 78  GFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLG 137
           GFVFGWDTGTISGFV  TDFKRRFG     +  Y LS+VRTGLIV+IFNIGCA GGLTLG
Sbjct: 64  GFVFGWDTGTISGFVAQTDFKRRFGQRH-SDGTYYLSNVRTGLIVAIFNIGCAFGGLTLG 122

Query: 138 RLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISE 197
           R GD+YGR+ GL+ V+ VYVVGIIIQIAS +KWYQYFIGRI+SGLGVGGIAVLSPTLISE
Sbjct: 123 RTGDLYGRKKGLVIVVSVYVVGIIIQIASVDKWYQYFIGRIISGLGVGGIAVLSPTLISE 182

Query: 198 TAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMI 257
           TAPKHLRGTCVSFYQLMITLGIF+GYCTNYGTK YSN+VQW++PLGLCF WA+FMI GM 
Sbjct: 183 TAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMS 242

Query: 258 FVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGEL 317
            VPESPR+L+EKG  EEA+RSIA SNKL+++D GV  E++ I+AGVEAE+LAG+ASWGEL
Sbjct: 243 MVPESPRFLVEKGRLEEARRSIAISNKLSMDDPGVTFELDTISAGVEAERLAGSASWGEL 302

Query: 318 FSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFAST 377
           FS KGKIL RVIMG +IQSLQQLTGNNYFFYYGTTIF AVG++DSFQTSIVLG+VNFAST
Sbjct: 303 FSNKGKILPRVIMGVMIQSLQQLTGNNYFFYYGTTIFKAVGLEDSFQTSIVLGIVNFAST 362

Query: 378 FVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXX 437
           FVGL+TVER+GRR+CLLWGSA M+ CFV+FASVGV  LYP+G+D  SSK AGN MI    
Sbjct: 363 FVGLWTVERFGRRRCLLWGSATMAACFVIFASVGVKSLYPHGRDHASSKGAGNCMIVFTC 422

Query: 438 XXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYY 497
                    WAPIAYVIVSETYPLRVKNRAMA+AVGSNWIWGF IGF TPFITSAI F Y
Sbjct: 423 FFIFCFATTWAPIAYVIVSETYPLRVKNRAMAIAVGSNWIWGFLIGFFTPFITSAINFSY 482

Query: 498 GYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYDVNE 557
           GYVFMGCL           CETKGLTLEEVN+MY+EGVLPWKS  WVP  RR+ SYD++ 
Sbjct: 483 GYVFMGCLVFSYFYVFFFVCETKGLTLEEVNDMYEEGVLPWKSPNWVPPSRRDASYDIDA 542

Query: 558 TQEDS 562
              D 
Sbjct: 543 MMHDD 547

>Sklu_2362.1 YDR342C, Contig c2362 924-2642
          Length = 572

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/566 (65%), Positives = 440/566 (77%), Gaps = 13/566 (2%)

Query: 8   MNDRSNSNTELAAVSSPTDFDS------QSRTPSNKLSEDG-----FATKTTSPLENNEI 56
           M+ ++    E A   +P D  S      Q  TPSNK S D      F  + T  +  NEI
Sbjct: 1   MSTQAALELEAAGQDTPVDLHSNLSEVSQLSTPSNKASRDDLKDVRFPEEATEKV--NEI 58

Query: 57  PQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDV 116
           P KP S YI V  LCL VAFGGFVFGWDTGTISGFVN TDFKRRFG  +     Y LS+V
Sbjct: 59  PAKPTSAYITVCLLCLCVAFGGFVFGWDTGTISGFVNQTDFKRRFGQHNHKTGGYYLSNV 118

Query: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG 176
           RTGL+V IFNIGCAIGG+ L ++GD+YGRR+GLM+VILVYVV +II IA+S+KWYQYFIG
Sbjct: 119 RTGLLVGIFNIGCAIGGIILSKIGDLYGRRIGLMSVILVYVVSVIISIAASDKWYQYFIG 178

Query: 177 RIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAV 236
           RI+SGLGVGGIAVL+P LISETAPKHLRGT VS YQLMIT GIF+GYCTNYGTK Y N+V
Sbjct: 179 RIISGLGVGGIAVLAPMLISETAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKNYDNSV 238

Query: 237 QWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEV 296
           QW++PLGL F WA+F+IAGM+FVPESPRYL+E G  EEA+RS+A+SNK+T+ED GV AEV
Sbjct: 239 QWRVPLGLGFAWALFVIAGMMFVPESPRYLVEVGKIEEARRSVARSNKVTIEDPGVQAEV 298

Query: 297 ELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDA 356
           +LI AGVEAEKL+G+ASW ELFS K K+LQR+IMG ++Q LQQLTGNNYFFYYGTTIF +
Sbjct: 299 DLITAGVEAEKLSGSASWSELFSTKTKVLQRLIMGAMLQCLQQLTGNNYFFYYGTTIFKS 358

Query: 357 VGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLY 416
           VG+ DSFQTSIV+GVVNFASTFVG+Y VE++GRRKCLLWG+A+M VC VV+ASVGVT+L+
Sbjct: 359 VGLTDSFQTSIVIGVVNFASTFVGIYVVEKFGRRKCLLWGAASMMVCMVVYASVGVTRLW 418

Query: 417 PNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNW 476
           PNG+D PSSK AGN MI             WAPIA+V+ +E++PLRVK++ MA+A  SNW
Sbjct: 419 PNGEDQPSSKGAGNCMIVFTCFYIFCYATTWAPIAWVVTAESFPLRVKSKCMAIASASNW 478

Query: 477 IWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVL 536
           IWGF I F TPFITSAI FYYGYVFMGCL            ETKGLTLEE+ E+++EGVL
Sbjct: 479 IWGFLIAFFTPFITSAINFYYGYVFMGCLVFMYFYVFFFVPETKGLTLEEIQELWEEGVL 538

Query: 537 PWKSETWVPALRRNESYDVNETQEDS 562
           PWKS +WVP  +R++ YDV   Q D 
Sbjct: 539 PWKSASWVPPSKRDKGYDVEALQHDD 564

>YFL011W (HXT10) [1671] chr6 (112339..113979) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1641 bp, 546 aa]
          Length = 546

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/531 (69%), Positives = 427/531 (80%), Gaps = 2/531 (0%)

Query: 21  VSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENN-EIPQKPLSEYILVMCLCLMVAFGGF 79
           VSS       S   S  LS       T    E + +IP KP+  Y  VM LCLM+AFGGF
Sbjct: 2   VSSSVSILGTSAKASTSLSRKDEIKLTPETREASLDIPYKPIIAYWTVMGLCLMIAFGGF 61

Query: 80  VFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRL 139
           +FGWDTGTISGF+N TDFKRRFG     +  + LSDVRTGLIV IFNIGCA+GGLTLGRL
Sbjct: 62  IFGWDTGTISGFINQTDFKRRFGELQ-RDGSFQLSDVRTGLIVGIFNIGCALGGLTLGRL 120

Query: 140 GDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETA 199
           GD+YGR++GLM VILVYVVGI+IQIASS+KWYQYFIGRIVSG+GVGG+AVLSPTLISE +
Sbjct: 121 GDIYGRKIGLMCVILVYVVGIVIQIASSDKWYQYFIGRIVSGMGVGGVAVLSPTLISEIS 180

Query: 200 PKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFV 259
           PKHLRGTCVSFYQLMITLGIF+GYCTNYGTK YSN++QW++PLGLCF WAIFM+ GM+ V
Sbjct: 181 PKHLRGTCVSFYQLMITLGIFLGYCTNYGTKKYSNSIQWRVPLGLCFAWAIFMVIGMVMV 240

Query: 260 PESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFS 319
           PESPRYL+EKG +EEA+RS+AKSNK+TV D GV+ E + I A +E E+  GNASW ELFS
Sbjct: 241 PESPRYLVEKGKYEEARRSLAKSNKVTVTDPGVVFEFDTIVANMELERAVGNASWHELFS 300

Query: 320 PKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFV 379
            KG IL RVIMG VIQSLQQLTG NYFFYYGTTIF+AVGM+DSF+TSIVLG VNFASTFV
Sbjct: 301 NKGAILPRVIMGIVIQSLQQLTGCNYFFYYGTTIFNAVGMQDSFETSIVLGAVNFASTFV 360

Query: 380 GLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXX 439
            LY V+++GRRKCLLWGSA+M++CFV+FA+VGVT+L+P GKD PSS+SAGN MI      
Sbjct: 361 ALYIVDKFGRRKCLLWGSASMAICFVIFATVGVTRLWPQGKDQPSSQSAGNVMIVFTCFF 420

Query: 440 XXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGY 499
                  WAPIAYVIV+ETYPLRVKNRAMA+AVG+NW+WGF IGF TPFIT +IGF YGY
Sbjct: 421 IFSFAITWAPIAYVIVAETYPLRVKNRAMAIAVGANWMWGFLIGFFTPFITRSIGFSYGY 480

Query: 500 VFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRN 550
           VFMGCL           CETKGLTLEEVNEMY+E + PWKS  W+P+ RR 
Sbjct: 481 VFMGCLIFSYFYVFFFVCETKGLTLEEVNEMYEERIKPWKSGGWIPSSRRT 531

>Scas_715.50
          Length = 559

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/510 (69%), Positives = 415/510 (81%), Gaps = 1/510 (0%)

Query: 53  NNEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYV 112
            NE   KP+S Y  V+CLCLM+AFGGF+FGWD GTI GFV  TDFKRRFG  +  E +Y 
Sbjct: 40  ENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELN-DEGEYY 98

Query: 113 LSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQ 172
           LSDVRTGLIV  FN+GCA GG+ LGRLGD YGR++GL+ V+ VYVVG++IQI+S+N W Q
Sbjct: 99  LSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLVCVVSVYVVGVVIQISSTNNWIQ 158

Query: 173 YFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTY 232
           YFIGRIVSGLGVGGIAVLSPTLISE APKHLRG C+S YQLMIT GIF+GYCTNYG+K+Y
Sbjct: 159 YFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSY 218

Query: 233 SNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGV 292
           +N++QW++PLGL F WA+ M+ GM+ VPESPRYLIEKG FEEAKRS+AKSNK TV+D  V
Sbjct: 219 TNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIV 278

Query: 293 LAEVELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTT 352
           L E ++INAGVEAE+  GNASW ELFS KGK+LQRVIMG ++QSLQQLTG NYFFYYGTT
Sbjct: 279 LREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTT 338

Query: 353 IFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGV 412
           IF AVGM DS+ TSIVLGVVNF+STF+ L++VER+GRRKCLLWGSA+M+ CFVVFAS+GV
Sbjct: 339 IFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGV 398

Query: 413 TKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAV 472
           TKLYPNG D P+SKSAGN MI             WAPIA+V+V+E+YP R+K RAMA+AV
Sbjct: 399 TKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAV 458

Query: 473 GSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQ 532
            +NWIW FAIGF TPFITSAI FYYG+VF GCL           CETKGL+LEE NEMY+
Sbjct: 459 AANWIWNFAIGFCTPFITSAINFYYGFVFFGCLIFSFFYIFFFVCETKGLSLEEFNEMYE 518

Query: 533 EGVLPWKSETWVPALRRNESYDVNETQEDS 562
           EG LPWKS+TW+P+ RR   YDV+ TQ D 
Sbjct: 519 EGTLPWKSDTWIPSSRRGADYDVHATQNDD 548

>Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement
          Length = 571

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/539 (64%), Positives = 424/539 (78%), Gaps = 7/539 (1%)

Query: 28  DSQSRTPSNK-----LSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGGFVFG 82
           DS   TPSNK     L E  F  + T  +   EIP+KP S YI V  +CL VAFGGFV G
Sbjct: 26  DSHLSTPSNKASRADLDELKFQAEETEIVA--EIPKKPASAYITVSIMCLCVAFGGFVVG 83

Query: 83  WDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDM 142
           WDTGTISGFVN TDFKRRFG +   + +Y LS+VR GLIVSIFN+GCA+GGL L +LGD+
Sbjct: 84  WDTGTISGFVNQTDFKRRFGEYSHSKDEYYLSNVRVGLIVSIFNVGCAVGGLVLSKLGDI 143

Query: 143 YGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKH 202
           YGR +GLMAV +VYVVGI+IQI+S +KWYQYFIGRIVSGLGVGG+ VL+P LISETAPKH
Sbjct: 144 YGRCIGLMAVTIVYVVGIVIQISSVDKWYQYFIGRIVSGLGVGGVCVLAPMLISETAPKH 203

Query: 203 LRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPES 262
           LRGT ++ +QLM+T  IF+GYC NYGTK+Y N+VQW++PLGLCF WAI M+ GM FVPES
Sbjct: 204 LRGTLLACWQLMVTFAIFLGYCANYGTKSYDNSVQWRVPLGLCFAWAIIMVVGMCFVPES 263

Query: 263 PRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPKG 322
           PR+L++ G  E+AKRS+AKSNK++VED  V AEV+LI AGVE EKLAG++SWGELFS K 
Sbjct: 264 PRFLVKVGRVEDAKRSVAKSNKISVEDPAVQAEVDLIAAGVEVEKLAGSSSWGELFSKKT 323

Query: 323 KILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLY 382
           K+ QR++M  +I SLQQL+G+NYFFYYGTTIF +VGM+DSF+TSIV+G++NFASTF+ LY
Sbjct: 324 KVFQRLVMSVMINSLQQLSGDNYFFYYGTTIFKSVGMEDSFETSIVIGIINFASTFLSLY 383

Query: 383 TVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXX 442
           T+++ GRR+ LLWG+A M+VC +++ASVGVT+LYP+GKD PSSK AGN MI         
Sbjct: 384 TLDKLGRRRSLLWGAAIMTVCMLIYASVGVTRLYPDGKDQPSSKPAGNCMIVFTCLYIFF 443

Query: 443 XXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFM 502
               W P  YVI+SE++PLRVK++ M++A G+N++WGF IGF TPFITSAI FYYGYVFM
Sbjct: 444 FANTWGPTCYVIISESFPLRVKSKCMSVATGANYLWGFLIGFFTPFITSAINFYYGYVFM 503

Query: 503 GCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYDVNETQED 561
           GCL            ETKGLTLEEV EM+ EGVLPWKSE+WVP+ RR+ +YD  + Q D
Sbjct: 504 GCLVFSYFYVFFFVPETKGLTLEEVEEMWHEGVLPWKSESWVPSSRRDVNYDAEKLQHD 562

>Sklu_2376.5 , Contig c2376 9071-10810 reverse complement
          Length = 579

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/523 (67%), Positives = 424/523 (81%), Gaps = 2/523 (0%)

Query: 39  SEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFK 98
            ED F     +  E  ++ +K  SEY+ V   C+MVAFGGFVFGWDTGTISGFVNM+DFK
Sbjct: 50  DEDEFDELQKAAEE--QLAKKGTSEYLFVSICCVMVAFGGFVFGWDTGTISGFVNMSDFK 107

Query: 99  RRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVV 158
           RRFG +      Y LSDVR GLIV+IFNIGCAIGG+ L ++G++YGRR+GLMAV+++Y++
Sbjct: 108 RRFGQYKHSTGTYYLSDVRVGLIVAIFNIGCAIGGVVLSKIGEVYGRRIGLMAVVVIYII 167

Query: 159 GIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLG 218
           GIIIQIAS +KWYQYFIGRI+SGLGVGGI VLSP LISETAPKHLRGT ++ YQLMIT G
Sbjct: 168 GIIIQIASIDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLIASYQLMITAG 227

Query: 219 IFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRS 278
           IF+GYCTNYGTK Y N+VQW++PLGLCF WAIFMI GM+FVPESPRYL+E G  EEAKRS
Sbjct: 228 IFLGYCTNYGTKNYENSVQWRVPLGLCFAWAIFMITGMLFVPESPRYLVEAGKIEEAKRS 287

Query: 279 IAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQ 338
           IA+SNK+T+ED  V  EV++I AGVEAEKLAG+ASW ELFS K K+LQR+IMG +IQSLQ
Sbjct: 288 IARSNKVTIEDPAVQTEVDMICAGVEAEKLAGSASWSELFSAKTKVLQRLIMGIMIQSLQ 347

Query: 339 QLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSA 398
           QLTG+NYFFYYGTTIF +VGM+DSF+TSIV+G+VNFASTF  LYTV+++GRRKC+LWG++
Sbjct: 348 QLTGDNYFFYYGTTIFKSVGMEDSFETSIVIGIVNFASTFFSLYTVDKFGRRKCMLWGAS 407

Query: 399 AMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSET 458
            M  CFVVFASVGVT+L+PNG+D PSSK AGN MI             WAPIAYVIV+E+
Sbjct: 408 TMVACFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVFTCFYIFCFATTWAPIAYVIVAES 467

Query: 459 YPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCE 518
           +PLRVK++ MA+A  SNW+WGF IGF TPFITSAI FYYGYVFMGCL            E
Sbjct: 468 FPLRVKSKGMAIATASNWLWGFLIGFFTPFITSAINFYYGYVFMGCLVFAYFYVFFFVPE 527

Query: 519 TKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYDVNETQED 561
           TKGLTLEEVNEM++EGVLPWKS +W+P+ RR   Y+ ++ Q D
Sbjct: 528 TKGLTLEEVNEMWEEGVLPWKSSSWIPSSRRGADYNADDLQHD 570

>YDR342C (HXT7) [1170] chr4 complement(1154206..1155918)
           High-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), nearly identical to Hxt6p [1713 bp, 570 aa]
          Length = 570

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/550 (67%), Positives = 428/550 (77%), Gaps = 9/550 (1%)

Query: 17  ELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNE----IPQKPLSEYILVMCLCL 72
            L+AV S +   S   TPSNK   D    K     E +E    IP++P S Y+ V  +C+
Sbjct: 15  HLSAVDSASH--SVLSTPSNKAERD--EIKAYGEGEEHEPVVEIPKRPASAYVTVSIMCI 70

Query: 73  MVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIG 132
           M+AFGGFVFGWDTGTISGF+N TDF RRFG        Y LS VRTGLIVSIFNIGCAIG
Sbjct: 71  MIAFGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNY-LSKVRTGLIVSIFNIGCAIG 129

Query: 133 GLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSP 192
           G+ L +LGDMYGR++GL+ V+++Y++GIIIQIAS NKWYQYFIGRI+SGLGVGGIAVLSP
Sbjct: 130 GIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSP 189

Query: 193 TLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFM 252
            LISE +PKHLRGT VS YQLMIT GIF+GYCTN+GTK YSN+VQW++PLGLCF WA+FM
Sbjct: 190 MLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFM 249

Query: 253 IAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNA 312
           I GM FVPESPRYL E G  EEAKRSIA SNK+ V+D  VLAEVE + AGVEAEKLAGNA
Sbjct: 250 IGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGVEAEKLAGNA 309

Query: 313 SWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVV 372
           SWGELFS K K+LQR+IMG +IQSLQQLTG+NYFFYYGTTIF AVG+ DSF+TSIVLG+V
Sbjct: 310 SWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLGIV 369

Query: 373 NFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAM 432
           NFASTFVG+Y VERYGRR CLLWG+A+M+ C VV+ASVGVT+L+PNG+D PSSK AGN M
Sbjct: 370 NFASTFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQDQPSSKGAGNCM 429

Query: 433 IXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSA 492
           I             WAPI YV+VSET+PLRVK++AM++A  +NW+WGF IGF TPFIT A
Sbjct: 430 IVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGA 489

Query: 493 IGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNES 552
           I FYYGYVFMGCL            ETKGLTLEEVN M++EGVLPWKS +WVP  RR  +
Sbjct: 490 INFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRGAN 549

Query: 553 YDVNETQEDS 562
           YD  E   D 
Sbjct: 550 YDAEEMTHDD 559

>YDR343C (HXT6) [1171] chr4 complement(1159598..1161310)
           High-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), nearly identical to Hxt7p [1713 bp, 570 aa]
          Length = 570

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/550 (67%), Positives = 428/550 (77%), Gaps = 9/550 (1%)

Query: 17  ELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNE----IPQKPLSEYILVMCLCL 72
            L+AV S +   S   TPSNK   D    K     E +E    IP++P S Y+ V  +C+
Sbjct: 15  HLSAVDSASH--SVLSTPSNKAERD--EIKAYGEGEEHEPVVEIPKRPASAYVTVSIMCI 70

Query: 73  MVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIG 132
           M+AFGGFVFGWDTGTISGF+N TDF RRFG        Y LS VRTGLIVSIFNIGCAIG
Sbjct: 71  MIAFGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNY-LSKVRTGLIVSIFNIGCAIG 129

Query: 133 GLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSP 192
           G+ L +LGDMYGR++GL+ V+++Y++GIIIQIAS NKWYQYFIGRI+SGLGVGGIAVLSP
Sbjct: 130 GIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSP 189

Query: 193 TLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFM 252
            LISE +PKHLRGT VS YQLMIT GIF+GYCTN+GTK YSN+VQW++PLGLCF WA+FM
Sbjct: 190 MLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFM 249

Query: 253 IAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNA 312
           I GM FVPESPRYL E G  EEAKRSIA SNK+ V+D  VLAEVE + AGVEAEKLAGNA
Sbjct: 250 IGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGVEAEKLAGNA 309

Query: 313 SWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVV 372
           SWGELFS K K+LQR+IMG +IQSLQQLTG+NYFFYYGTTIF AVG+ DSF+TSIVLG+V
Sbjct: 310 SWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLGIV 369

Query: 373 NFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAM 432
           NFASTFVG+Y VERYGRR CLLWG+A+M+ C VV+ASVGVT+L+PNG+D PSSK AGN M
Sbjct: 370 NFASTFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQDQPSSKGAGNCM 429

Query: 433 IXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSA 492
           I             WAPI YV+VSET+PLRVK++AM++A  +NW+WGF IGF TPFIT A
Sbjct: 430 IVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGA 489

Query: 493 IGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNES 552
           I FYYGYVFMGCL            ETKGLTLEEVN M++EGVLPWKS +WVP  RR  +
Sbjct: 490 INFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRGAN 549

Query: 553 YDVNETQEDS 562
           YD  E   D 
Sbjct: 550 YDAEEMAHDD 559

>AFL207C [2988] [Homologous to ScAFL207C] (44349..45968) [1620 bp,
           539 aa]
          Length = 539

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/507 (68%), Positives = 409/507 (80%), Gaps = 2/507 (0%)

Query: 52  ENNEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKY 111
           E  +IP KP + YI V  LC+ VAFGGF+FGWDTGTISGFVN TDF+RRF   +  E  Y
Sbjct: 29  ETVDIPTKPATAYITVCLLCVFVAFGGFIFGWDTGTISGFVNQTDFRRRFAQVN-DEGGY 87

Query: 112 VLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWY 171
             S+ R GLIV+IFNIGCA+GG+ L RLGDMYGRR+GLM V L+YVVGIIIQI+S+ KWY
Sbjct: 88  YWSNARVGLIVAIFNIGCAVGGIILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKWY 147

Query: 172 QYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKT 231
           QY IGR++SGLGVGGIAVLSP LISET+PKHLRGT VS YQLMIT GI +GYC NYGTK+
Sbjct: 148 QYCIGRVISGLGVGGIAVLSPMLISETSPKHLRGTLVSCYQLMITAGILLGYCANYGTKS 207

Query: 232 -YSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDS 290
            Y ++ QW++PLGLCFLWAIFMI GM FVPESPRYLIEK   EEAKRS+A SNK+ V+D 
Sbjct: 208 RYDDSRQWRIPLGLCFLWAIFMITGMAFVPESPRYLIEKDKIEEAKRSLATSNKVPVDDP 267

Query: 291 GVLAEVELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYG 350
            +LAEV  I AGVE E++AG+ASWGELF+ + KILQRVIMG +IQSLQQLTGNNYFFYYG
Sbjct: 268 AILAEVNNIQAGVELERMAGSASWGELFTVRTKILQRVIMGAMIQSLQQLTGNNYFFYYG 327

Query: 351 TTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASV 410
           TTIFD+VG++D+F+TSI+LG VNF STFV +YTV+R+GRRKCLL+G+AAM+VC V+FASV
Sbjct: 328 TTIFDSVGLEDAFKTSIILGAVNFGSTFVAMYTVDRFGRRKCLLYGAAAMAVCMVIFASV 387

Query: 411 GVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAM 470
           GVT+L+PNG D PSS+ AGNAMI             WAPIAYVIVSET+PLRVK + MA+
Sbjct: 388 GVTRLWPNGPDQPSSRPAGNAMIVFTCLYIFFFATTWAPIAYVIVSETFPLRVKAKGMAI 447

Query: 471 AVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEM 530
           A  +NWIWGF I F TP+IT+AI FYYGYVFMGCL            ETKGLTLEEV EM
Sbjct: 448 ATAANWIWGFLIAFFTPYITNAIRFYYGYVFMGCLIFAFFYIFFFVPETKGLTLEEVEEM 507

Query: 531 YQEGVLPWKSETWVPALRRNESYDVNE 557
           +QEGV+PW+SE+WVP+ RR+  Y  ++
Sbjct: 508 WQEGVVPWRSESWVPSARRHAPYSSDK 534

>Scas_658.24
          Length = 570

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/554 (63%), Positives = 415/554 (74%), Gaps = 10/554 (1%)

Query: 17  ELAAVSSPTDFDSQSR----TPSNKLSEDG--FATKTTSPLENNE---IPQKPLSEYILV 67
           E   +   T  +S +     TPSNK   D   + +       N E   IP++P S Y+ V
Sbjct: 6   EQTPIEQETPIESATHSVISTPSNKAERDDEKYGSDDIDAEVNPEVVEIPKRPASAYVTV 65

Query: 68  MCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNI 127
             +C+M+AFGGFVFGWDTGTISGFV  TDF RRFG        Y LS VR GL+VSIFNI
Sbjct: 66  SIMCIMIAFGGFVFGWDTGTISGFVAQTDFLRRFGQKHHNGTHY-LSKVRMGLMVSIFNI 124

Query: 128 GCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGI 187
           GCA GG+ L + GD+YGR++GL+ V+ +Y+VGI+IQIAS   WYQYFIGRI+SGLGVGGI
Sbjct: 125 GCAFGGIILAKSGDIYGRKMGLIIVVCIYIVGIVIQIASVKAWYQYFIGRIISGLGVGGI 184

Query: 188 AVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFL 247
           AVLSP LISE +PKH+RGT VS YQLMIT GIF+GYCTNYGTK YSN+VQW++PLGLCF 
Sbjct: 185 AVLSPMLISEVSPKHMRGTLVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCFA 244

Query: 248 WAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEK 307
           WA+FMI GM FVPESPRYL+E G  EEAKRSIA SNK++ +D  VLAEV+ + AGVEAEK
Sbjct: 245 WALFMIGGMTFVPESPRYLVEVGKIEEAKRSIALSNKISADDPAVLAEVDNVQAGVEAEK 304

Query: 308 LAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSI 367
           LAGNASWGELF  K KI QR++MGC+IQ LQQLTG+NYFFYYGT +F +VG++DSFQTSI
Sbjct: 305 LAGNASWGELFQTKNKIFQRLVMGCMIQCLQQLTGDNYFFYYGTIVFKSVGLEDSFQTSI 364

Query: 368 VLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKS 427
           V+GVVNF STF  LYTV+R+GRR+CLLWG+A  +VCFV++ASVGVT+LYPNGKD PSSK 
Sbjct: 365 VIGVVNFFSTFFALYTVDRFGRRRCLLWGAATTTVCFVIYASVGVTRLYPNGKDQPSSKG 424

Query: 428 AGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTP 487
           AGN MI             WAPI +VI SET+PLRVK++ M++A G NW+WGF I F TP
Sbjct: 425 AGNCMIVFTCFYIFCFATTWAPIPFVINSETFPLRVKSKCMSLAQGCNWLWGFLISFFTP 484

Query: 488 FITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPAL 547
           FIT AI FYYGYVFMGCL            ETKGLTLEEVN M++EGVLPWKS  WVP  
Sbjct: 485 FITGAINFYYGYVFMGCLCFSFFYVFFFVPETKGLTLEEVNTMWEEGVLPWKSTEWVPPS 544

Query: 548 RRNESYDVNETQED 561
           RR   Y+V+   +D
Sbjct: 545 RRGADYNVDGLTKD 558

>Kwal_55.20075
          Length = 571

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/567 (64%), Positives = 445/567 (78%), Gaps = 20/567 (3%)

Query: 2   SSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNE----IP 57
           +++ATP+  RS       AVS      SQ  TPSNK S D    K     E+ E    IP
Sbjct: 11  AATATPVEVRS-------AVSQ----GSQLSTPSNKASRDDL--KDAQFYEDAEKEVIIP 57

Query: 58  QKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVR 117
           +KP S YI V+ LCL VAFGGFVFGWDTGTISGFV  +DFKRRFG  +   Q Y LS+VR
Sbjct: 58  KKPASAYITVVILCLCVAFGGFVFGWDTGTISGFVAQSDFKRRFGQTNSKGQHY-LSNVR 116

Query: 118 TGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGR 177
           TGLIVSIFNIGCA GG+ L ++GD++GRR+GLMAV++VYVVGIIIQIAS +KWYQYFIGR
Sbjct: 117 TGLIVSIFNIGCAFGGILLSKIGDVWGRRIGLMAVVVVYVVGIIIQIASQDKWYQYFIGR 176

Query: 178 IVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQ 237
           I+SGLGVGGIAVLSP LISETAPKHLRGT V+ YQLMIT GIF+GYCTNYG K YSN++Q
Sbjct: 177 IISGLGVGGIAVLSPMLISETAPKHLRGTLVACYQLMITCGIFLGYCTNYGVKNYSNSIQ 236

Query: 238 WKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVE 297
           W++PLGLCF WA+FMI GM+FVPESPRYL+EKG  E+AK SIA+SNK++VED  V  EV+
Sbjct: 237 WRVPLGLCFAWALFMIGGMMFVPESPRYLVEKGRIEDAKVSIARSNKISVEDPSVQVEVD 296

Query: 298 LINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAV 357
           LI+AGVEAEKLAG+AS+ ELFS K K+LQR+IMG ++QSLQQLTG+NYFFYYGT IF +V
Sbjct: 297 LISAGVEAEKLAGSASFKELFSAKTKVLQRLIMGIMLQSLQQLTGDNYFFYYGTIIFKSV 356

Query: 358 GMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYP 417
           G+ DSFQTSI++G+VNFASTFVG++TVE++GRR+CLLWG+A+M VCFV++ASVGVT+LYP
Sbjct: 357 GLNDSFQTSIIIGIVNFASTFVGIFTVEKFGRRRCLLWGAASMVVCFVIYASVGVTRLYP 416

Query: 418 NGKDMP--SSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSN 475
           +G + P  S+K AGN MI             WAPIAYV+VSE++PLRVK++AMA+A  +N
Sbjct: 417 DGANHPQNSNKGAGNCMIVFTCFYIFCFATTWAPIAYVVVSESFPLRVKSKAMALATAAN 476

Query: 476 WIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGV 535
           W+WGF I F TPFITSAI FYYGYVFMGCL            ETKGLTLEEV E+++EGV
Sbjct: 477 WLWGFLIAFFTPFITSAIHFYYGYVFMGCLVFAYFYVFFFVPETKGLTLEEVQELWEEGV 536

Query: 536 LPWKSETWVPALRRNESYDVNETQEDS 562
           LPWKS +WVP+  R  +Y+  + + D 
Sbjct: 537 LPWKSTSWVPSSSRGVNYNAEDLKHDD 563

>YLR081W (GAL2) [3496] chr12 (290213..291937) Galactose and glucose
           permease (facilitated diffusion transporter), member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1725 bp, 574 aa]
          Length = 574

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/548 (62%), Positives = 415/548 (75%), Gaps = 7/548 (1%)

Query: 18  LAAVSSPTDFDSQSRTPSN---KLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMV 74
           ++++S  +   +QS+  SN   K  E G     + P+E   IP+KP+SEY+ V  LCL V
Sbjct: 22  ISSLSKDSHLSAQSQKYSNDELKAGESGSEGSQSVPIE---IPKKPMSEYVTVSLLCLCV 78

Query: 75  AFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGL 134
           AFGGF+FGWDTGTISGFV  TDF RRFG     +  + LS+VRTGLIV+IFNIGCA GG+
Sbjct: 79  AFGGFMFGWDTGTISGFVVQTDFLRRFG-MKHKDGTHYLSNVRTGLIVAIFNIGCAFGGI 137

Query: 135 TLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTL 194
            L + GDMYGR+ GL  V+ VY+VGIIIQIAS NKWYQYFIGRI+SGLGVGGIAVL P L
Sbjct: 138 ILSKGGDMYGRKKGLSIVVSVYIVGIIIQIASINKWYQYFIGRIISGLGVGGIAVLCPML 197

Query: 195 ISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIA 254
           ISE APKHLRGT VS YQLMIT GIF+GYCTNYGTK+YSN+VQW++PLGLCF W++FMI 
Sbjct: 198 ISEIAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKSYSNSVQWRVPLGLCFAWSLFMIG 257

Query: 255 GMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASW 314
            +  VPESPRYL E    E+AKRSIAKSNK++ ED  V AE++LI AG+EAEKLAGNASW
Sbjct: 258 ALTLVPESPRYLCEVNKVEDAKRSIAKSNKVSPEDPAVQAELDLIMAGIEAEKLAGNASW 317

Query: 315 GELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNF 374
           GELFS K K+ QR++MG  +Q  QQLTGNNYFFYYGT IF +VG+ DSF+TSIV+GVVNF
Sbjct: 318 GELFSTKTKVFQRLLMGVFVQMFQQLTGNNYFFYYGTVIFKSVGLDDSFETSIVIGVVNF 377

Query: 375 ASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIX 434
           ASTF  L+TVE  G RKCLL G+A M  C V++ASVGVT+LYP+GK  PSSK AGN MI 
Sbjct: 378 ASTFFSLWTVENLGHRKCLLLGAATMMACMVIYASVGVTRLYPHGKSQPSSKGAGNCMIV 437

Query: 435 XXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIG 494
                       WAP+A+VI +E++PLRVK++ MA+A  SNW+WGF I F TPFITSAI 
Sbjct: 438 FTCFYIFCYATTWAPVAWVITAESFPLRVKSKCMALASASNWVWGFLIAFFTPFITSAIN 497

Query: 495 FYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYD 554
           FYYGYVFMGCL            ETKGL+LEE+ E+++EGVLPWKSE W+P+ RR  +YD
Sbjct: 498 FYYGYVFMGCLVAMFFYVFFFVPETKGLSLEEIQELWEEGVLPWKSEGWIPSSRRGNNYD 557

Query: 555 VNETQEDS 562
           + + Q D 
Sbjct: 558 LEDLQHDD 565

>YHR092C (HXT4) [2382] chr8 complement(287131..288813) Moderate- to
           low-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1683 bp, 560 aa]
          Length = 560

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/554 (65%), Positives = 426/554 (76%), Gaps = 7/554 (1%)

Query: 1   MSSSATPMNDRSNSNTELAAVSSPTDFDSQS--RTPSNKLSEDGFATKTTSPLENN---E 55
           MS  A    D +  NT   A+S P + DS S   TPSNK   D       +  E+N   E
Sbjct: 1   MSEEAAYQEDTAVQNTPADALS-PVESDSNSALSTPSNKAERDDMKDFDENHEESNNYVE 59

Query: 56  IPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSD 115
           IP+KP S Y+ V   CLMVAFGGFVFGWDTGTISGFV  TDF RRFG     +  Y LS 
Sbjct: 60  IPKKPASAYVTVSICCLMVAFGGFVFGWDTGTISGFVAQTDFIRRFG-MKHHDGTYYLSK 118

Query: 116 VRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFI 175
           VRTGLIVSIFNIGCAIGG+ L +LGDMYGR++GL+ V+++Y++GIIIQIAS NKWYQYFI
Sbjct: 119 VRTGLIVSIFNIGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFI 178

Query: 176 GRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNA 235
           GRI+SGLGVGGIAVLSP LISE +PKH+RGT VS YQLMITLGIF+GYCTNYGTKTY+N+
Sbjct: 179 GRIISGLGVGGIAVLSPMLISEVSPKHIRGTLVSCYQLMITLGIFLGYCTNYGTKTYTNS 238

Query: 236 VQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAE 295
           VQW++PLGL F WA+FMI GM FVPESPRYL+E G  EEAKRSIA SNK++ +D  V+AE
Sbjct: 239 VQWRVPLGLGFAWALFMIGGMTFVPESPRYLVEVGKIEEAKRSIALSNKVSADDPAVMAE 298

Query: 296 VELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFD 355
           VE++ A VEAEKLAGNASWGE+FS K K+ QR+IMG +IQSLQQLTG+NYFFYYGTT+F 
Sbjct: 299 VEVVQATVEAEKLAGNASWGEIFSTKTKVFQRLIMGAMIQSLQQLTGDNYFFYYGTTVFT 358

Query: 356 AVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKL 415
           AVG++DSF+TSIVLG+VNFASTFVG++ VERYGRR+CLLWG+A+M+ C VVFASVGVT+L
Sbjct: 359 AVGLEDSFETSIVLGIVNFASTFVGIFLVERYGRRRCLLWGAASMTACMVVFASVGVTRL 418

Query: 416 YPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSN 475
           +PNGK   SSK AGN MI             WAPI +V+ SET+PLRVK++ MA+A   N
Sbjct: 419 WPNGKKNGSSKGAGNCMIVFTCFYLFCFATTWAPIPFVVNSETFPLRVKSKCMAIAQACN 478

Query: 476 WIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGV 535
           WIWGF IGF TPFI+ AI FYYGYVFMGCL            ETKGLTLEEVN +++EGV
Sbjct: 479 WIWGFLIGFFTPFISGAIDFYYGYVFMGCLVFSYFYVFFFVPETKGLTLEEVNTLWEEGV 538

Query: 536 LPWKSETWVPALRR 549
           LPWKS +W    R 
Sbjct: 539 LPWKSPSWFHQTRE 552

>Scas_541.6
          Length = 573

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/556 (64%), Positives = 425/556 (76%), Gaps = 5/556 (0%)

Query: 10  DRSNSNTELAAVSSPTDFDSQS--RTPSNKLSEDGFATKTT-SPLENNEIPQKPLSEYIL 66
           D +  NT +  +S P +  S S   TPSNK   D         P    EIP+KP S Y+ 
Sbjct: 9   DTAAENTPVGDLS-PVESISNSGMSTPSNKDDRDDVKEYVEEDPQIIAEIPKKPASAYVT 67

Query: 67  VMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFN 126
           V  +C+M+AFGGFVFGWDTGTISGFV  TDF +RFG      + Y LS VR GLIVSIFN
Sbjct: 68  VSIMCVMIAFGGFVFGWDTGTISGFVAQTDFLQRFGQHHSNGKHY-LSKVRMGLIVSIFN 126

Query: 127 IGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGG 186
           IGCA+GG+ L +LGD+YGR++GL+ V+++YV+GIIIQIAS   WYQYFIGRI+SGLGVGG
Sbjct: 127 IGCAVGGIILSKLGDIYGRKIGLITVVVIYVIGIIIQIASVKAWYQYFIGRIISGLGVGG 186

Query: 187 IAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCF 246
           IAVLSP LISE +PKHLRGT VS YQLMIT GIF+GYCTNYGTK YSN+VQW++PLGLCF
Sbjct: 187 IAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCF 246

Query: 247 LWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAE 306
            WA+FMI GM FVPESPR+L+E G  +EAKRS+A SNK++V+D  VL E+E + AGVEAE
Sbjct: 247 AWALFMIGGMTFVPESPRFLVEVGRIDEAKRSVAMSNKVSVDDPAVLGELETLQAGVEAE 306

Query: 307 KLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTS 366
           KLAGNASWGE+F  K K+LQR+IMG +IQSLQQLTG+NYFFYYGTT+F +VGM+DSF+TS
Sbjct: 307 KLAGNASWGEIFQTKTKVLQRLIMGSMIQSLQQLTGDNYFFYYGTTVFTSVGMQDSFETS 366

Query: 367 IVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSK 426
           IVLG+VNFASTFVG++ VERYGRR CLLWG+A M+ C VVFASVGVT+L+PNGKD  +SK
Sbjct: 367 IVLGIVNFASTFVGIFLVERYGRRTCLLWGAATMTSCMVVFASVGVTRLWPNGKDGEASK 426

Query: 427 SAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGT 486
            AGN MI             WAPI +V+ SET+PLRVK++ M++  G NW+WGF IGF T
Sbjct: 427 GAGNCMICFTCFYLFCFATTWAPIPFVVNSETFPLRVKSKCMSITQGCNWLWGFLIGFFT 486

Query: 487 PFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPA 546
           PFIT AI FYYGYVFMGCL            ETKGLTLEEVN M++EGVLPWKS  WVP 
Sbjct: 487 PFITGAIDFYYGYVFMGCLCFSYFYVFFFVPETKGLTLEEVNTMWEEGVLPWKSAEWVPP 546

Query: 547 LRRNESYDVNETQEDS 562
            RR E+YDV E  +D 
Sbjct: 547 SRRGENYDVAEMAKDD 562

>YJL219W (HXT9) [2711] chr10 (19497..21200) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), may play a role in drug uptake [1704 bp, 567 aa]
          Length = 567

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/559 (61%), Positives = 410/559 (73%), Gaps = 10/559 (1%)

Query: 6   TPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYI 65
           T  ND S + +   +V++     ++     N L+ D     T  P++   +PQKPLS Y 
Sbjct: 7   TSANDLSTTESNSNSVANAPSVKTEHNDSKNSLNLDA----TEPPID---LPQKPLSAYT 59

Query: 66  LVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIF 125
            V  LCLM+AFGGF+FGWDTGTISGFVN++DF RRFG  +  +  Y LS VR GLIVSIF
Sbjct: 60  TVAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKN-DKGTYYLSKVRMGLIVSIF 118

Query: 126 NIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVG 185
           NIGCAIGG+ L ++GD+YGRR+GL+ V  +YVVGI+IQI S NKWYQYFIGRI+SGLGVG
Sbjct: 119 NIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVG 178

Query: 186 GIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLC 245
           GIAVLSP LISE APK +RGT V  YQLM T+GIF+GYCTNYGTK Y NA QW++ LGLC
Sbjct: 179 GIAVLSPMLISEVAPKQIRGTLVQLYQLMCTMGIFLGYCTNYGTKNYHNATQWRVGLGLC 238

Query: 246 FLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEA 305
           F W  FM++GM+FVPESPRYLIE G  EEAKRS++KSNK++V+D  +LAE + I AG+E 
Sbjct: 239 FAWTTFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALLAEYDTIKAGIEL 298

Query: 306 EKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQT 365
           EKLAGNASW EL S K K+ QRV+MG +IQSLQQLTG+NYFFYYGTTIF +VG+KDSFQT
Sbjct: 299 EKLAGNASWSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQT 358

Query: 366 SIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMP-- 423
           SI++GVVNF S+F+ +YT+ER+GRR CLLWG+A+M  CF VFASVGVTKL+P G      
Sbjct: 359 SIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDI 418

Query: 424 SSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIG 483
           +S+ AGN MI             WA   YVIVSET+PLRVK+R MA+A  +NW+WGF I 
Sbjct: 419 TSQGAGNCMIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLIS 478

Query: 484 FGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETW 543
           F TPFIT AI FYYGYVF+GCL            ETKGLTLEEVN M+ EGV  WKS +W
Sbjct: 479 FFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASW 538

Query: 544 VPALRRNESYDVNETQEDS 562
           VP  RR   YD +    D 
Sbjct: 539 VPPERRTADYDADAIDHDD 557

>YOL156W (HXT11) [4669] chr15 (25272..26975) Low-affinity glucose
           permease, member of the hexose transporter family of the
           major facilitator superfamily (MFS), may be involved in
           uptake of drugs [1704 bp, 567 aa]
          Length = 567

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/554 (62%), Positives = 412/554 (74%), Gaps = 16/554 (2%)

Query: 12  SNSNTELAAVSSPTDF-DSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCL 70
           SNSN+ + A S  T+  DS+     N L+ D        P++   +PQKPLS Y  V  L
Sbjct: 17  SNSNSAVGAPSVKTEHGDSK-----NSLNLDA----NEPPID---LPQKPLSAYTTVAIL 64

Query: 71  CLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCA 130
           CLM+AFGGF+FGWDTGTISGFVN++DF RRFG  +  +  Y LS VR GLIVSIFNIGCA
Sbjct: 65  CLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKN-DKGTYYLSKVRMGLIVSIFNIGCA 123

Query: 131 IGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVL 190
           IGG+ L ++GD+YGRR+GL+ V  +YVVGI+IQI S NKWYQYFIGRI+SGLGVGGIAVL
Sbjct: 124 IGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGIAVL 183

Query: 191 SPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAI 250
           SP LISE APKH+RGT V  YQLM T+GIF+GYCTNYGTK Y NA QW++ LGLCF WA 
Sbjct: 184 SPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFAWAT 243

Query: 251 FMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAG 310
           FM++GM+FVPESPRYLIE G  EEAKRS++KSNK++V+D  +L E + I AG+E EKLAG
Sbjct: 244 FMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALLVEYDTIKAGIELEKLAG 303

Query: 311 NASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLG 370
           NASW EL S K K+ QRV+MG +IQSLQQLTG+NYFFYYGTTIF +VG+KDSFQTSI++G
Sbjct: 304 NASWSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSIIIG 363

Query: 371 VVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMP--SSKSA 428
           VVNF S+F+ +YT+ER+GRR CLLWG+A+M  CF VFASVGVTKL+P G      +S+ A
Sbjct: 364 VVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITSQGA 423

Query: 429 GNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPF 488
           GN MI             WA   YVIVSET+PLRVK+R MA+A  +NW+WGF I F TPF
Sbjct: 424 GNCMIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLISFFTPF 483

Query: 489 ITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALR 548
           IT AI FYYGYVF+GCL            ETKGLTLEEVN M+ EGV  WKS +WVP  R
Sbjct: 484 ITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWVPPER 543

Query: 549 RNESYDVNETQEDS 562
           R   YD +    D+
Sbjct: 544 RTADYDADAIDHDN 557

>CAGL0A02211g complement(224864..226522) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 552

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/554 (62%), Positives = 423/554 (76%), Gaps = 12/554 (2%)

Query: 9   NDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVM 68
           +  S S + L+A +S  D + + +     + E+G       P+   EIP+KP S Y+ + 
Sbjct: 3   DQESRSQSVLSASNSKADREDEFKA---YVDEEG------QPMV--EIPKKPASAYVSIS 51

Query: 69  CLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIG 128
             CL +AFGGFVFGWDTGTISGFV  TDF RR G        Y LS VRTGL+VSIFNIG
Sbjct: 52  IFCLFIAFGGFVFGWDTGTISGFVAQTDFIRRLGQTRANGTHY-LSKVRTGLVVSIFNIG 110

Query: 129 CAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIA 188
           CAIGG+ L +LGDMYGR++GL++V+++Y+VGI+IQIA+ +KWYQYFIGRI+SGLGVGGIA
Sbjct: 111 CAIGGIVLSKLGDMYGRKIGLISVVVIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGIA 170

Query: 189 VLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLW 248
           VLSP LISE +PKH+RG+ VS YQLMIT GIF+GYCTNYGTK YSN+VQW++PLGLCF W
Sbjct: 171 VLSPMLISEVSPKHMRGSLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAW 230

Query: 249 AIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKL 308
           A+FMI GM FVPESPRYLIE G  EEA+RSIA SNK++ +D  V  EVE + A VEAE+L
Sbjct: 231 ALFMIGGMTFVPESPRYLIEVGRVEEARRSIAISNKVSPDDPAVTFEVENVQAAVEAERL 290

Query: 309 AGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIV 368
           AG+ASWGELFS K K+ QR+IMG +IQSLQQLTG+NYFFYYGTT+F AVG++DSF+TSIV
Sbjct: 291 AGSASWGELFSTKTKVFQRLIMGIMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFETSIV 350

Query: 369 LGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSA 428
           +G+VNFASTFV LY V+R+GRR+CLLWG+AAM+ C VVFASVGVT+L+PNG+D PSSK A
Sbjct: 351 IGIVNFASTFVALYVVDRFGRRRCLLWGAAAMTACMVVFASVGVTRLWPNGQDQPSSKGA 410

Query: 429 GNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPF 488
           GN MI             WAPI +V+ SET+PLRVK + MA+A  SNWIWGF I F TPF
Sbjct: 411 GNCMIVFTCFYIFCFATTWAPIPFVVNSETFPLRVKAKCMAIAQASNWIWGFLIAFFTPF 470

Query: 489 ITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALR 548
           IT+AI FYYGYVFMGCL            ETKGLTLEEVN +++EGVLPWKS  WVP  +
Sbjct: 471 ITNAINFYYGYVFMGCLCFSYFYVFFFIPETKGLTLEEVNTLWEEGVLPWKSPNWVPPSK 530

Query: 549 RNESYDVNETQEDS 562
           R+ SYD +    D 
Sbjct: 531 RDASYDADAMMHDD 544

>CAGL0A01826g complement(179321..180922) highly similar to sp|P38695
           Saccharomyces cerevisiae YHR096c HXT5, hypothetical
           start
          Length = 533

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/505 (66%), Positives = 397/505 (78%), Gaps = 1/505 (0%)

Query: 58  QKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVR 117
            K  S+ I V   C+MVAFGGFVFGWDTGTISGFVN TDF RRFG     +  Y LS+VR
Sbjct: 19  HKKKSDLIFVSLCCIMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQ-QRSDGTYYLSNVR 77

Query: 118 TGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGR 177
           TGLIV+IFNIGCAIGG+TL +LGD++GRRLGL+ V++VY +GI+IQIAS +KWYQYFIGR
Sbjct: 78  TGLIVAIFNIGCAIGGITLSKLGDIWGRRLGLVTVVVVYTIGIVIQIASIDKWYQYFIGR 137

Query: 178 IVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQ 237
           I+SGLGVGGIAVLSP LISE +PK LRGT VS YQLMIT GIF+GYCTNYGTK YSN+VQ
Sbjct: 138 IISGLGVGGIAVLSPMLISEVSPKQLRGTLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQ 197

Query: 238 WKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVE 297
           W++PLGLCF WA+FMI G++ VPESPRYL+E G  EEAKRS+A++NK TV+   VL E++
Sbjct: 198 WRVPLGLCFAWALFMIFGVMCVPESPRYLVEVGKLEEAKRSLARANKTTVDSPIVLLELD 257

Query: 298 LINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAV 357
              A VEAE+LAG+ASWGEL + K ++L+R IMG +IQSLQQLTG NYFFYYGTTIF AV
Sbjct: 258 KYQASVEAERLAGSASWGELVTGKPQMLRRTIMGMMIQSLQQLTGANYFFYYGTTIFRAV 317

Query: 358 GMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYP 417
           G+ DSFQT+IVLGVVNF STF  LYTV+ YGRR CL+WG   M  C+VV+ASVGVT+L+P
Sbjct: 318 GLDDSFQTAIVLGVVNFVSTFYALYTVDHYGRRNCLMWGCVGMVCCYVVYASVGVTRLWP 377

Query: 418 NGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWI 477
           NG+   SSK AGN MI             WAPIAYVIVSE+YPLR++ +AM++A+ +NWI
Sbjct: 378 NGEGNGSSKGAGNCMIVFACFFIFCFATTWAPIAYVIVSESYPLRIRGKAMSIAIAANWI 437

Query: 478 WGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLP 537
           WGF I F TPFITSAI FYYGYVFMGC+            ETKGLTLEEVN+MY+EGVLP
Sbjct: 438 WGFLIAFFTPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNQMYEEGVLP 497

Query: 538 WKSETWVPALRRNESYDVNETQEDS 562
           WKS +WVP  RR   Y++++   D 
Sbjct: 498 WKSSSWVPPDRRTAEYNLDDYSHDD 522

>AFL205C [2990] [Homologous to ScYHR094C - SH] (49039..50679) [1641
           bp, 546 aa]
          Length = 546

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/552 (61%), Positives = 417/552 (75%), Gaps = 21/552 (3%)

Query: 19  AAVSSPTD---FDSQSRTPSNKLSEDGFATKTTSPLENNE-----IPQKPLSEYILVMCL 70
           AA++ P +     + S T SNK S++          EN E     IP KP S YI V  L
Sbjct: 3   AAIAQPDNRSVMSTHSSTASNKPSKE----------ENKESGLVEIPVKPASAYITVSLL 52

Query: 71  CLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCA 130
           C++VAFGGF+FGWDTGTISGFVN +D+K RFG  +     Y LSD RTGLIV+IFNIGCA
Sbjct: 53  CILVAFGGFIFGWDTGTISGFVNQSDYKNRFGELN-ESGDYYLSDNRTGLIVAIFNIGCA 111

Query: 131 IGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVL 190
           +GG+ L +  DMYGRR+GLM V LVYV+GI++QI+S++KWYQY IGR++SGLGVGGIAVL
Sbjct: 112 VGGIFLSKFADMYGRRIGLMIVTLVYVIGIVVQISSTDKWYQYCIGRVISGLGVGGIAVL 171

Query: 191 SPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKT-YSNAVQWKLPLGLCFLWA 249
           SP LISET+PKHLRG  VS YQLMIT GIF+GYC NYGTK  Y ++ QW++PLGL F WA
Sbjct: 172 SPMLISETSPKHLRGMLVSCYQLMITAGIFVGYCANYGTKAKYEDSKQWRIPLGLSFAWA 231

Query: 250 IFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLA 309
           I MI GM+ VPESPRYL+E   +E+AKRS+A+SNK+ V+D  + AE + I+AG+E E++A
Sbjct: 232 ILMIGGMVLVPESPRYLVEVNKYEDAKRSLARSNKVPVDDPSIQAEFDNIHAGIELERMA 291

Query: 310 GNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVL 369
           G+ASWGELFS K KILQRVIMG +IQSLQQLTGNNYFFYYGTTIF +VG++DSFQTSI+L
Sbjct: 292 GSASWGELFSTKSKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFKSVGLEDSFQTSIIL 351

Query: 370 GVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAG 429
           G VNF STFV ++ V ++GRR+ +L G+AAM+VC V+FAS+GVTKL+PNG+D PSSK AG
Sbjct: 352 GAVNFGSTFVAVWAVGKFGRRRLMLAGAAAMTVCMVIFASIGVTKLWPNGEDQPSSKPAG 411

Query: 430 NAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFI 489
           N MI             WAPI +VIVSET+PLRVK + MA+A  +NWIWGF I F TP I
Sbjct: 412 NVMIVFTCIYIFCFATTWAPIPFVIVSETFPLRVKAKGMAIATAANWIWGFLIAFFTPKI 471

Query: 490 TSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRR 549
           T+AI F YGYVFMGCL            ETKGLTLEEV EM+QEGV+PWKSE+W P+ +R
Sbjct: 472 TNAIKFNYGYVFMGCLIFAFFYMFFFVPETKGLTLEEVEEMWQEGVVPWKSESWTPSYKR 531

Query: 550 NESYDVNETQED 561
           N +Y+  E + +
Sbjct: 532 N-AYETEEVKPE 542

>CAGL0A02233g complement(231128..232777) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 549

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/550 (63%), Positives = 420/550 (76%), Gaps = 12/550 (2%)

Query: 13  NSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCL 72
            S + L+A +S  + + + +  ++   EDG       P+   EIP+KP S Y+ +   CL
Sbjct: 4   ESQSALSASNSKVEREDEFKAYTD---EDG------QPMV--EIPKKPASAYVAISIFCL 52

Query: 73  MVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIG 132
            +AFGGFVFGWDTGTISGFV  TDF RR G        Y LS VRTGLIVSIFNIGCAIG
Sbjct: 53  FIAFGGFVFGWDTGTISGFVAQTDFIRRMGQTRANGTHY-LSKVRTGLIVSIFNIGCAIG 111

Query: 133 GLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSP 192
           G+ L +LGD+YGR++GL++V+++Y+VGI+IQIA+ +KWYQYFIGRI+SGLGVGGIAVLSP
Sbjct: 112 GVVLSKLGDVYGRKIGLISVVVIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGIAVLSP 171

Query: 193 TLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFM 252
            LISE +PKH+RG+ VS YQLMIT GIF+GYCTNYGTK YSN+VQW++PLGLCF WA+FM
Sbjct: 172 MLISEVSPKHMRGSLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFM 231

Query: 253 IAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNA 312
           I GM FVPESPRYLIE G  EEA+RSIA SNK++ +D  V  EVE + AGVEAE+LAG+A
Sbjct: 232 IGGMTFVPESPRYLIEVGRVEEARRSIAISNKVSPDDPAVTFEVENVQAGVEAERLAGSA 291

Query: 313 SWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVV 372
           SWGELFS K KI QR+IMG +IQSLQQLTG+NYFFYYGTT+F AVG++DSF+TSIV+G+V
Sbjct: 292 SWGELFSTKTKIFQRLIMGIMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFETSIVIGIV 351

Query: 373 NFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAM 432
           NFASTFV LY V+R+GRR+CLLWG+AAM+ C VVFASVGVT+LYP+G   PSSK AGN M
Sbjct: 352 NFASTFVALYVVDRFGRRRCLLWGAAAMTACMVVFASVGVTRLYPHGMKQPSSKGAGNCM 411

Query: 433 IXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSA 492
           I             WAPI +V+ SET+PLRVK + MA+A  SNWIWGF I F TPFIT+A
Sbjct: 412 IVFTCFYIFCFATTWAPIPFVVNSETFPLRVKAKCMAIAQASNWIWGFLIAFFTPFITNA 471

Query: 493 IGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNES 552
           I FYYGYVFMGCL            ETKGLTLEEVN M++EGVL WKS  WVP  +R+ S
Sbjct: 472 INFYYGYVFMGCLCFSYFYVFFFIPETKGLTLEEVNTMWEEGVLAWKSPNWVPPSKRDAS 531

Query: 553 YDVNETQEDS 562
           YD +    D 
Sbjct: 532 YDADALMHDD 541

>CAGL0A01782g complement(170326..172032) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 568

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/558 (62%), Positives = 419/558 (75%), Gaps = 13/558 (2%)

Query: 5   ATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEY 64
           A+P ND S S ++  + +SP + D +      KL E+   T         +IP+KP S Y
Sbjct: 16  ASPENDFSPSLSQQDSSASPYENDVK------KLEEEAEQTPIV------DIPKKPASAY 63

Query: 65  ILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSI 124
           + V   CL +AFGGFVFGWDTGTISGFV  TDF RR G        Y LS VRTGL+VSI
Sbjct: 64  VTVSIFCLFIAFGGFVFGWDTGTISGFVAQTDFIRRLGQKRANGTHY-LSKVRTGLVVSI 122

Query: 125 FNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGV 184
           FNIGCAIGG+ L +LGD+YGR+ GL+ V+++YVVGIIIQIA+ +KWYQYFIGRI+SGLGV
Sbjct: 123 FNIGCAIGGVILSKLGDVYGRKPGLIIVVVIYVVGIIIQIATIDKWYQYFIGRIISGLGV 182

Query: 185 GGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGL 244
           GGIAVLSP LISE +PKHLR T V+ YQLMITLGIF+GYCTN+GTK YSN+VQW++PLGL
Sbjct: 183 GGIAVLSPMLISEVSPKHLRATLVACYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGL 242

Query: 245 CFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVE 304
           CF WAIFMI+GM FVPESPR+L+EKG  E+AKRSIA SNK++V+D  V+AEV+ + A VE
Sbjct: 243 CFAWAIFMISGMTFVPESPRFLVEKGRIEDAKRSIASSNKVSVDDPAVVAEVDSVQAAVE 302

Query: 305 AEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQ 364
           AE+LAG+ASWGELFS K KI QR++MG +IQSLQQLTG+NYFFYYGT +F AVG++DSF+
Sbjct: 303 AERLAGSASWGELFSTKTKIFQRLVMGIMIQSLQQLTGDNYFFYYGTIVFKAVGLEDSFE 362

Query: 365 TSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPS 424
           TSIV+GVVNF STFVG++ V R+GRR CLLWG+A M+ C VVFASVGVT+L+P+GK   S
Sbjct: 363 TSIVIGVVNFFSTFVGIFLVGRFGRRTCLLWGAATMTACMVVFASVGVTRLWPHGKGNGS 422

Query: 425 SKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGF 484
           SK AGN MI             WAP+A+VI SET+PLRVK + MA+A  SNWIWGF I F
Sbjct: 423 SKGAGNCMIVFTCFYIFCFATTWAPLAFVICSETFPLRVKAKCMALAQASNWIWGFLISF 482

Query: 485 GTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWV 544
            TPFIT AI F YGYVFMGCL            ETKGLTLEEVN M++EGVLPWK+  WV
Sbjct: 483 FTPFITDAINFNYGYVFMGCLCFSYFYVFFFVPETKGLTLEEVNTMWEEGVLPWKASQWV 542

Query: 545 PALRRNESYDVNETQEDS 562
           P  RR   YD +    D 
Sbjct: 543 PPSRRGADYDADALMHDD 560

>Scas_628.7
          Length = 593

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/532 (64%), Positives = 398/532 (74%), Gaps = 3/532 (0%)

Query: 31  SRTPSNKLSEDGFATKTTSPLENNEIPQ--KPLSEYILVMCLCLMVAFGGFVFGWDTGTI 88
           + T ++  SED    +       +  P   KP + Y  V+ LCL++AFGGF+FGWDTGTI
Sbjct: 5   TETTTSPPSEDSAQIEPKEEFIMDTEPSIAKPAASYFTVIILCLLIAFGGFIFGWDTGTI 64

Query: 89  SGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLG 148
           SGFV  TDF +RFG     +  + LSDVR GL+V IFNIGC +GGL L   GD +GR+ G
Sbjct: 65  SGFVAQTDFIKRFGT-QQSDGSFALSDVRKGLMVGIFNIGCLLGGLFLAGAGDKWGRKPG 123

Query: 149 LMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCV 208
           LM V  VYVVGIIIQI SS KWYQYF+GRIVSG+GVGGIAVLSPTLISE APK LRGTC+
Sbjct: 124 LMLVAAVYVVGIIIQITSSTKWYQYFVGRIVSGMGVGGIAVLSPTLISEIAPKQLRGTCI 183

Query: 209 SFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIE 268
           S YQLMIT GIF+GYC N+GTK Y+NAVQW+LPLGL F WA FMI G++FVPESPRYL +
Sbjct: 184 SLYQLMITGGIFLGYCANFGTKRYNNAVQWRLPLGLGFAWAFFMIIGLLFVPESPRYLFK 243

Query: 269 KGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPKGKILQRV 328
           KG    AK S+AKSNK TV+D  VL+E++ I AG+EAE  AGNASW ELFS K KI QRV
Sbjct: 244 KGKISAAKHSLAKSNKTTVDDILVLSELDNIRAGIEAENNAGNASWKELFSLKNKIFQRV 303

Query: 329 IMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYG 388
            MG +IQSLQQLTG NYFFYYGTTIF AVGM DSF TSIVLGVVNFASTF+ L  VE  G
Sbjct: 304 FMGVMIQSLQQLTGCNYFFYYGTTIFQAVGMDDSFVTSIVLGVVNFASTFIALGIVEWLG 363

Query: 389 RRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWA 448
           RRKCLL GSA+M+ CFV+FASVGVT+L+PNGKD P+SK AG+ MI             WA
Sbjct: 364 RRKCLLLGSASMACCFVIFASVGVTRLWPNGKDQPTSKGAGDCMIVFTCIFIFCFATTWA 423

Query: 449 PIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXX 508
           PI +VIV+E+YPLRVK RAMA+A+G+NWIWGF IGF TPFITSAI FYYG+VFMGCL   
Sbjct: 424 PIGFVIVAESYPLRVKQRAMAIAIGANWIWGFLIGFFTPFITSAINFYYGFVFMGCLIFS 483

Query: 509 XXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYDVNETQE 560
                    ETKGLTLEEV+EMY E + PWKS +W P  RR+ +YD + T +
Sbjct: 484 FFYVFFFVRETKGLTLEEVDEMYLENIKPWKSASWSPRNRRDGAYDNDITSD 535

>CAGL0A00737g 74767..76416 highly similar to sp|P39003 Saccharomyces
           cerevisiae YDR343c HXT6 or sp|P39004 Saccharomyces
           cerevisiae YDR342c HXT7, hypothetical start
          Length = 549

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/541 (63%), Positives = 410/541 (75%), Gaps = 3/541 (0%)

Query: 22  SSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGGFVF 81
            S + F + +     +     +A +   P+   EIP+KP S Y L+  LCL +AFGGFVF
Sbjct: 4   ESQSAFSASNSKVEREEDFKAYADEDGQPMV--EIPKKPASAYTLIFILCLFIAFGGFVF 61

Query: 82  GWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGD 141
           GWDTGTISGFV   DF +R G        Y LS VRTGLIVSIFNIGCAIGG+ L + GD
Sbjct: 62  GWDTGTISGFVAEEDFIKRLGQ-RRANNTYYLSKVRTGLIVSIFNIGCAIGGVVLSKFGD 120

Query: 142 MYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPK 201
           MYGR++GL+ VI+VY+VGI+IQIA+ +KWYQYFIGRIVSGLGVGGIAVLSP LISE +PK
Sbjct: 121 MYGRKIGLIIVIVVYIVGIVIQIATIDKWYQYFIGRIVSGLGVGGIAVLSPMLISEVSPK 180

Query: 202 HLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPE 261
           H+RGT VS YQLM+T GIF+GYCTNYGTK Y N+VQW++PLGLCF WA+FMI GM+ VPE
Sbjct: 181 HMRGTLVSCYQLMVTCGIFLGYCTNYGTKNYPNSVQWRVPLGLCFAWALFMIGGMLCVPE 240

Query: 262 SPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPK 321
           SPRYL+E G FEEA+RSIA SNKLT ED  V  E+E + AGVEAE+LAG+ASWGELFS K
Sbjct: 241 SPRYLVEVGKFEEARRSIAISNKLTPEDPAVTFELENVQAGVEAERLAGSASWGELFSTK 300

Query: 322 GKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGL 381
            K+LQR+IMG ++Q LQQLTG+NYFFYYGTT+F AVG++DSFQTSIV+G+VNFASTFV L
Sbjct: 301 TKVLQRLIMGIMLQCLQQLTGDNYFFYYGTTVFKAVGLEDSFQTSIVIGIVNFASTFVAL 360

Query: 382 YTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXX 441
           Y V+R+GRRKCLLWG+A+M+ C VVFASVGVT+LYPNG D PSSK AGN MI        
Sbjct: 361 YVVDRFGRRKCLLWGAASMTACMVVFASVGVTRLYPNGMDQPSSKGAGNCMIVFTCFYIF 420

Query: 442 XXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVF 501
                WAP  +VI SET+PLRVK + MA+   +NWIWGF I F TPFIT AI FYYGYVF
Sbjct: 421 CFATTWAPTPWVINSETFPLRVKAKCMAICQAANWIWGFLIAFFTPFITGAINFYYGYVF 480

Query: 502 MGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYDVNETQED 561
           MGCL            ETKGLTLEEVN M++EGVLPWKS  W+P  +R+ +YD +    D
Sbjct: 481 MGCLCFSYFYVFFFIPETKGLTLEEVNTMWEEGVLPWKSPDWIPPSKRDATYDADAMMHD 540

Query: 562 S 562
            
Sbjct: 541 D 541

>KLLA0D13310g complement(1143027..1144730)
           gi|131828|sp|P18631|RAG1_KLULA Kluyveromyces lactis
           Low-affinity glucose transporter, start by similarity
          Length = 567

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/564 (62%), Positives = 418/564 (74%), Gaps = 15/564 (2%)

Query: 2   SSSATPMNDRS-NSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKP 60
           S+SA    + S ++NT L A  SP D         N L +    T          + QKP
Sbjct: 8   STSAGSGTEHSVDTNTALKA-GSPNDLKVSHEEDLNDLEKTAEET----------LQQKP 56

Query: 61  LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGL 120
             EYI V   C+MVAFGGFVFGWDTGTISGFVN TDF RRFG  +  +  + LS+VRTGL
Sbjct: 57  AKEYIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQ-EKADGSHYLSNVRTGL 115

Query: 121 IVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVS 180
           IVSIFNIGCA+GG+ L  +GD +GRR+GL+ VI++YV+GIIIQIAS +KWYQYFIGRI+S
Sbjct: 116 IVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIIS 175

Query: 181 GLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKL 240
           GLGVGGI VLSP LISETAPKHLRGT VS YQLMIT GIF+GYCTNYGTK YSN+VQW++
Sbjct: 176 GLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRV 235

Query: 241 PLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELIN 300
           PLGLCF WAIFM+ GM+FVPES R+L+E    EEA++S+AK+NK++++D  V  E+  I 
Sbjct: 236 PLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQ 295

Query: 301 AGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMK 360
           + +E EK AGNASWGEL + K  + +R +MG +IQSLQQLTG+NYFFYYGTTIF +VGM 
Sbjct: 296 SSIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMD 355

Query: 361 DSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGK 420
           DSF+TSIVLG+VNFASTF  LYTV+ +GRR CLL+G   M  C+VV+ASVGVT+L+P+G 
Sbjct: 356 DSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGP 415

Query: 421 DMP--SSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIW 478
           D P  SSK AGN MI             WAPIAYV++SE+YPLRVK +AMA+A  SNWIW
Sbjct: 416 DHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIW 475

Query: 479 GFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPW 538
           GF IGF TPFITSAI FYYGYVFMGC+            ETKGLTLEEVNEMY EGVLPW
Sbjct: 476 GFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPW 535

Query: 539 KSETWVPALRRNESYDVNETQEDS 562
           KS +WVP+ RR   YDV+  Q D 
Sbjct: 536 KSSSWVPSSRRGAEYDVDALQHDD 559

>Scas_541.7
          Length = 591

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/560 (59%), Positives = 406/560 (72%), Gaps = 8/560 (1%)

Query: 8   MNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLE-----NNEIPQKPLS 62
           +N+  + N +  A + P      S  P ++ + + F TK     E     ++++  KP  
Sbjct: 24  LNNSFSINEKTDAQTIP--ITQGSSVPRSQGTSNSFTTKEDQMSELQKEADSQLESKPRK 81

Query: 63  EYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIV 122
           +   V   C+MV+FGGF+FGWDTGTISGF+  TDF RRFG        Y LS VRTGLIV
Sbjct: 82  DLFFVCLCCIMVSFGGFIFGWDTGTISGFIRQTDFIRRFGQTRANGTHY-LSTVRTGLIV 140

Query: 123 SIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGL 182
           SIFNIG AIGG+TL + GDM+GRRLGL+ VI +Y+VGI+IQI S NKWYQYFIGRI+SGL
Sbjct: 141 SIFNIGAAIGGITLSKTGDMWGRRLGLITVIGIYIVGILIQITSFNKWYQYFIGRIISGL 200

Query: 183 GVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPL 242
           GVGGI VL+P LISE APK LRGT VS YQLMITLGIF+GYCTN+GTK YSN+VQW++PL
Sbjct: 201 GVGGITVLAPMLISEVAPKKLRGTMVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPL 260

Query: 243 GLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAG 302
           GLCF WA+FMI+GM  VPESPRYL+E G   EA+R +A+ NK++ +   V  E+E   + 
Sbjct: 261 GLCFAWALFMISGMTLVPESPRYLVEVGKIAEARRGLARVNKVSEDSPLVQLELEKYESS 320

Query: 303 VEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDS 362
           VEAE+LAGNASWGEL + K  +L+R IMG +IQSLQQLTG NYFFYYGTTIF AVG+ DS
Sbjct: 321 VEAERLAGNASWGELVTGKPAMLRRTIMGMMIQSLQQLTGANYFFYYGTTIFQAVGLSDS 380

Query: 363 FQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDM 422
           F+T+IVLGVVNF STF  LY V+ YGRR CLLWG   M  C+VV+ASVGVT+L+PNG + 
Sbjct: 381 FETAIVLGVVNFVSTFFALYFVDHYGRRLCLLWGCVGMVCCYVVYASVGVTRLHPNGMNN 440

Query: 423 PSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAI 482
           P+SK AGN MI             WAPIAYV+ SETYPLRV+ +AM++A   NWIWGF I
Sbjct: 441 PTSKGAGNCMIVFACFFIFCFATTWAPIAYVVTSETYPLRVRGKAMSIASACNWIWGFLI 500

Query: 483 GFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSET 542
            F TPFITSAI F YGYVFMGC+            ETKGLTLEEVNEMY+EGVLPWKS +
Sbjct: 501 SFFTPFITSAINFSYGYVFMGCMVFAFFFVFFFVPETKGLTLEEVNEMYEEGVLPWKSSS 560

Query: 543 WVPALRRNESYDVNETQEDS 562
           WVP  +R   YD++  Q+D+
Sbjct: 561 WVPPSKRTADYDIDALQQDT 580

>YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1779 bp, 592 aa]
          Length = 592

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/564 (60%), Positives = 422/564 (74%), Gaps = 5/564 (0%)

Query: 1   MSSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLE---NNEIP 57
           +S+++   N++S  N+     +   D  +Q++  S+ +S +G        L+   + ++ 
Sbjct: 18  VSTNSNSYNEKSG-NSTAPGTAGYNDNLAQAKPVSSYISHEGPPKDELEELQKEVDKQLE 76

Query: 58  QKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVR 117
           +K  S+ + V   CLMVAFGGFVFGWDTGTISGFV  TDF RRFG+       Y LSDVR
Sbjct: 77  KKSKSDLLFVSVCCLMVAFGGFVFGWDTGTISGFVRQTDFIRRFGSTRANGTTY-LSDVR 135

Query: 118 TGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGR 177
           TGL+VSIFNIGCAIGG+ L +LGDMYGR++GLM V+++Y +GIIIQIAS +KWYQYFIGR
Sbjct: 136 TGLMVSIFNIGCAIGGIVLSKLGDMYGRKIGLMTVVVIYSIGIIIQIASIDKWYQYFIGR 195

Query: 178 IVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQ 237
           I+SGLGVGGI VL+P LISE +PK LRGT VS YQLMIT GIF+GYCTN+GTK YSN+VQ
Sbjct: 196 IISGLGVGGITVLAPMLISEVSPKQLRGTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQ 255

Query: 238 WKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVE 297
           W++PLGLCF W+IFMI GM FVPESPRYL+E G  EEAKRS+A++NK T +   V  E+E
Sbjct: 256 WRVPLGLCFAWSIFMIVGMTFVPESPRYLVEVGKIEEAKRSLARANKTTEDSPLVTLEME 315

Query: 298 LINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAV 357
              + +EAE+LAG+ASWGEL + K ++ +R +MG +IQSLQQLTG+NYFFYYGTTIF AV
Sbjct: 316 NYQSSIEAERLAGSASWGELVTGKPQMFRRTLMGMMIQSLQQLTGDNYFFYYGTTIFQAV 375

Query: 358 GMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYP 417
           G++DSF+T+IVLGVVNF STF  LYTV+R+GRR CLLWG   M  C+VV+ASVGVT+L+P
Sbjct: 376 GLEDSFETAIVLGVVNFVSTFFSLYTVDRFGRRNCLLWGCVGMICCYVVYASVGVTRLWP 435

Query: 418 NGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWI 477
           NG+D PSSK AGN MI             WAP+AYV++SE+YPLRV+ +AM++A   NWI
Sbjct: 436 NGQDQPSSKGAGNCMIVFACFYIFCFATTWAPVAYVLISESYPLRVRGKAMSIASACNWI 495

Query: 478 WGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLP 537
           WGF I F TPFITSAI FYYGYVFMGC+            ETKGLTLEEVNEMY+E VLP
Sbjct: 496 WGFLISFFTPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNEMYEENVLP 555

Query: 538 WKSETWVPALRRNESYDVNETQED 561
           WKS  W+P  RR   YD++ T+ D
Sbjct: 556 WKSTKWIPPSRRTTDYDLDATRND 579

>YJL214W (HXT8) [2715] chr10 (26887..28596) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1710 bp, 569 aa]
          Length = 569

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/503 (63%), Positives = 393/503 (78%)

Query: 59  KPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRT 118
           KP S Y  V  +CL +AFGGF+ GWDTGTISGFVN TDF RRFGN+   +  Y LS+VRT
Sbjct: 58  KPASAYATVSIMCLCMAFGGFMSGWDTGTISGFVNQTDFLRRFGNYSHSKNTYYLSNVRT 117

Query: 119 GLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRI 178
           GLIVSIFN+G AIG L L +LGD+YGR +GL+ VI+VY+VGI+IQIAS +KWYQYFIGRI
Sbjct: 118 GLIVSIFNVGSAIGCLFLSKLGDIYGRCMGLIIVIVVYMVGIVIQIASIDKWYQYFIGRI 177

Query: 179 VSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQW 238
           ++G+G G I+VL+P LISETAPKH+RGT ++ +QLM+T  IF+GYCTNYGTKTYSN+VQW
Sbjct: 178 IAGIGAGSISVLAPMLISETAPKHIRGTLLACWQLMVTFAIFLGYCTNYGTKTYSNSVQW 237

Query: 239 KLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVEL 298
           ++PLGLCF WAI MI GM FVPESPR+L++ G  E+AK S AKSNKL+V+D  V+AE++L
Sbjct: 238 RVPLGLCFAWAIIMIGGMTFVPESPRFLVQVGKIEQAKASFAKSNKLSVDDPAVVAEIDL 297

Query: 299 INAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVG 358
           + AGVEAE+  G ASW ELFS K K+ QR+ M  +I SLQQLTG+NYFFYYGTTIF +VG
Sbjct: 298 LVAGVEAEEAMGTASWKELFSRKTKVFQRLTMTVMINSLQQLTGDNYFFYYGTTIFKSVG 357

Query: 359 MKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPN 418
           M DSF+TSIVLG+VNFAS F  LY+V++ GRR+CLL G+A M+ C V++ASVGVT+LYPN
Sbjct: 358 MNDSFETSIVLGIVNFASCFFSLYSVDKLGRRRCLLLGAATMTACMVIYASVGVTRLYPN 417

Query: 419 GKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIW 478
           GK  PSSK AGN  I             W P+ YVI+SET+PLRV+++ M++A  +N +W
Sbjct: 418 GKSEPSSKGAGNCTIVFTCFYIFCFSCTWGPVCYVIISETFPLRVRSKCMSVATAANLLW 477

Query: 479 GFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPW 538
           GF IGF TPFITSAI FYYGYVFMGCL            ETKGLTLEEV+EM+ +GVLPW
Sbjct: 478 GFLIGFFTPFITSAINFYYGYVFMGCLAFSYFYVFFFVPETKGLTLEEVDEMWMDGVLPW 537

Query: 539 KSETWVPALRRNESYDVNETQED 561
           KSE+WVPA RR+  YD  + Q D
Sbjct: 538 KSESWVPASRRDGDYDNEKLQHD 560

>Sklu_2304.6 , Contig c2304 11341-13056 reverse complement
          Length = 571

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/560 (60%), Positives = 420/560 (75%), Gaps = 8/560 (1%)

Query: 2   SSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPL 61
           S+  TP++  S + T  + +S+P++    +R   + L     AT+ T+ +     PQKP 
Sbjct: 11  SAQDTPVDSHSLA-TATSHLSTPSN--KAARDDLDDLKFQNEATELTTVM-----PQKPA 62

Query: 62  SEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLI 121
           S YI V  LC+ VAFGGFV GWD GTISGFVN TDFKRRFG +   + +Y LS+VR GLI
Sbjct: 63  SAYITVCILCMCVAFGGFVSGWDVGTISGFVNQTDFKRRFGEYSHSKDEYYLSNVRVGLI 122

Query: 122 VSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSG 181
           VSIF+IG A+G L L +LGD+YGR +GLMAVILVYVVGI+IQI+S +KWYQYFIGRIV+G
Sbjct: 123 VSIFSIGNAVGALVLSKLGDVYGRCMGLMAVILVYVVGIVIQISSDDKWYQYFIGRIVAG 182

Query: 182 LGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLP 241
           LG GG+ VL+  LISETAPKHLRGT ++ +Q+M+   I +GYCTNYGTK YSN++QW++P
Sbjct: 183 LGGGGVGVLAQMLISETAPKHLRGTLLASWQVMVNCAILLGYCTNYGTKNYSNSIQWRVP 242

Query: 242 LGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINA 301
           LGLCF WAI MIAGM FVPESPRYLI+ G  EEAKRS+A+SNKLTVED  V  EV+LI A
Sbjct: 243 LGLCFAWAIIMIAGMCFVPESPRYLIQVGKIEEAKRSLARSNKLTVEDPAVQCEVDLIAA 302

Query: 302 GVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKD 361
           G+E EKLAG++SWG+L S K K+ QR++M   I SLQQLTG  YFFYYGTTIF +VGM+D
Sbjct: 303 GIELEKLAGSSSWGDLLSKKTKVFQRLVMSITINSLQQLTGCGYFFYYGTTIFKSVGMED 362

Query: 362 SFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKD 421
           SF+TSIV+GVVNF STFV LY ++R GRRKCLL G+A M+VC V++A+VGVT LYP+G+D
Sbjct: 363 SFETSIVIGVVNFVSTFVSLYILDRLGRRKCLLMGAAVMTVCMVIYATVGVTSLYPDGED 422

Query: 422 MPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFA 481
            PSSK+AGN MI             W P  +V++SE++PLRVK++ M++A  +N +WGF 
Sbjct: 423 QPSSKAAGNCMIVFTCFYIFFFANTWGPGCFVVISESFPLRVKSKCMSVATAANGLWGFL 482

Query: 482 IGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSE 541
           +GF TPFITSAI FYYGYVFMGCL            ETKGLTLEEV EM+ EGVLPWKS 
Sbjct: 483 VGFFTPFITSAINFYYGYVFMGCLVVSYFYVFFFVPETKGLTLEEVEEMWHEGVLPWKSG 542

Query: 542 TWVPALRRNESYDVNETQED 561
           +WVP+ RR  +YD  + Q D
Sbjct: 543 SWVPSSRRGTNYDAEKLQHD 562

>Scas_550.9
          Length = 574

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/564 (58%), Positives = 409/564 (72%), Gaps = 10/564 (1%)

Query: 8   MNDRSNSNTELAAVSSP---TDFDSQSRTPSNKLSEDGFATKTTSPLENN---EIPQKPL 61
           M+D + +  E A  SSP       SQS    N +  +  + K  S   N+   EIP+KP 
Sbjct: 1   MSDVAENTPETAENSSPEVPQTSGSQSVLSDNSIKAENESFKENSEDANDVVVEIPKKPA 60

Query: 62  SEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLI 121
           S Y+ +   C M+AFGGF+ GWDTGTI GF+   D+ RRFG        Y  S+VRTGL+
Sbjct: 61  SAYVTISIFCCMIAFGGFLSGWDTGTIGGFLAHPDYLRRFGQHHKDGTHY-FSNVRTGLV 119

Query: 122 VSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSG 181
           VSIFNIG  IG L LG L +  GR++ L+AV+++++VG+IIQIAS NKWYQYFIGRI+SG
Sbjct: 120 VSIFNIGGLIGCLVLGDLANRIGRKMALVAVVIIFMVGLIIQIASINKWYQYFIGRIISG 179

Query: 182 LGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLP 241
           LGVG I++ SP L+SE APKHLRGT  S YQLM+T+GIF+G CTNYGTK YSN+VQW++P
Sbjct: 180 LGVGAISIFSPMLLSEVAPKHLRGTLGSMYQLMVTMGIFLGDCTNYGTKKYSNSVQWRVP 239

Query: 242 LGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINA 301
           LGL F W +FMIA M FVPESPRYL+E G  EEAKRSIA SN+++++D  V AEV+LI++
Sbjct: 240 LGLSFAWCLFMIAAMFFVPESPRYLVEVGKVEEAKRSIATSNQVSIDDPAVQAEVDLISS 299

Query: 302 GVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKD 361
           GVEAE+LAGNASW ELFS KGK +QR+ M C++Q LQQLTG NYFFYYGT IF AVGMKD
Sbjct: 300 GVEAERLAGNASWVELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKD 359

Query: 362 SFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNG-- 419
           S+QT+IV G+VNFASTFV LY V+R+GRRKCL+WG+AAM  C+VV+ASVGVT+LYP+G  
Sbjct: 360 SYQTAIVFGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIK 419

Query: 420 -KDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIW 478
            KD  SSK AGN MI             WAPI +V+VSE++PLR+K + MA+A G NW W
Sbjct: 420 HKDTNSSKGAGNCMICFSCFFIFCFACTWAPICWVVVSESFPLRIKPKGMALANGCNWFW 479

Query: 479 GFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPW 538
            F I F TPFIT AI FYYGYVFMGC+            E KGLTLEEVNE++++GVLPW
Sbjct: 480 NFLISFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEDGVLPW 539

Query: 539 KSETWVPALRRNESYDVNETQEDS 562
           KS  WVP+ RR    D++  Q+D 
Sbjct: 540 KSPDWVPSSRRGADVDMDAFQKDD 563

>Scas_687.4
          Length = 610

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/551 (58%), Positives = 399/551 (72%), Gaps = 7/551 (1%)

Query: 18  LAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENN---EIPQKPLSEYILVMCLCLMV 74
           +A+   P    SQS    N +  +  + K  S   N    EIP+KP S Y+ +   C M+
Sbjct: 50  IASPEVPQTSGSQSVLSDNSVKAENESFKENSEDANEVVVEIPKKPASAYVTISIFCCMI 109

Query: 75  AFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGL 134
            FGGF+ GWDTGTI GF+   D+ RRFG        Y  S+VRTGL+VSIFNIG   G L
Sbjct: 110 GFGGFISGWDTGTIGGFLAHPDYLRRFGQHHKNGTHY-FSNVRTGLVVSIFNIGGLFGCL 168

Query: 135 TLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTL 194
            LG L +  GR++ L+AV+++++VGIIIQIAS +KWYQYFIGRI+SGLGVG I++ SP L
Sbjct: 169 ILGDLANRIGRKMALVAVVVIFMVGIIIQIASIDKWYQYFIGRIISGLGVGAISIFSPML 228

Query: 195 ISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIA 254
           +SE APKHLRGT  S YQLM+T GIF+G CTNYGTK Y N+VQW++PLGL F W +FMIA
Sbjct: 229 LSEVAPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGLSFAWCLFMIA 288

Query: 255 GMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASW 314
            M FVPESPRYL+E G  EEAKRSIA SNK++++D  V AEV+LI++GVEAE+LAGNASW
Sbjct: 289 AMFFVPESPRYLVEVGKIEEAKRSIATSNKVSMDDPAVQAEVDLISSGVEAERLAGNASW 348

Query: 315 GELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNF 374
           GELFS KGK +QR+ M C++Q LQQLTG NYFFYYGT IF AVGMKDS+QT+IV G+VNF
Sbjct: 349 GELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIVFGIVNF 408

Query: 375 ASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNG---KDMPSSKSAGNA 431
           ASTFV LY V+R+GRRKCL+WG+AAM  C+VV+ASVGVT+LYP+G   KD  SSK AGN 
Sbjct: 409 ASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSSKGAGNC 468

Query: 432 MIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITS 491
           MI             WAPI +V+VSE++PLR+K + MA+A G NW W F I F TPFIT 
Sbjct: 469 MICFSCFFIFSFACTWAPICWVVVSESFPLRIKPKGMALANGCNWFWNFLISFFTPFITG 528

Query: 492 AIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNE 551
           AI FYYGYVFMGC+            E KGLTLEEVNE++++GVLPWKS  WVP+ RR  
Sbjct: 529 AINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPDWVPSSRRGA 588

Query: 552 SYDVNETQEDS 562
             D++  Q+D 
Sbjct: 589 DVDMDAFQKDD 599

>CAGL0A02321g complement(247500..249170) highly similar to sp|P32466
           Saccharomyces cerevisiae YDR345c HXT3 or sp|P42833
           Saccharomyces cerevisiae YNL318c HXT14, hypothetical
           start
          Length = 556

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/545 (59%), Positives = 397/545 (72%), Gaps = 6/545 (1%)

Query: 22  SSPTDFDSQSRTPSNKLSEDGFATKTTSP--LENNEIPQKP--LSEYILVMCLCLMVAFG 77
           SS  D +S    PS   S++ +      P  LE     + P   S YI V   C +VAFG
Sbjct: 3   SSNKDSESFENYPSQN-SDNSYKRDDLDPDTLEKEAKIENPNGKSAYIAVSISCALVAFG 61

Query: 78  GFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLG 137
           GF+FGWDTGTISGFVN TDF RR G+       Y LS VRTGL+V IFNIGCAIGG+ L 
Sbjct: 62  GFIFGWDTGTISGFVNQTDFIRRIGSKHADGTSY-LSKVRTGLVVGIFNIGCAIGGVVLS 120

Query: 138 RLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISE 197
           ++GD  GR+ GL+ V+L+Y+VGI+IQIA+ +KWYQYFIGRI+SGLGVGGI+VLSPTLISE
Sbjct: 121 KIGDTKGRKAGLVTVVLIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGISVLSPTLISE 180

Query: 198 TAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMI 257
            APK LRG+ VS YQ+MITLGIF+GYCTNYGTK YSN+VQW++PLGLCF WA+ MI GM 
Sbjct: 181 VAPKELRGSLVSLYQIMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALLMIGGMT 240

Query: 258 FVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGEL 317
           FVPESPRYLIE G+ + A++S+  +NKL  E   +  E  ++ A VE    AG ASW EL
Sbjct: 241 FVPESPRYLIEAGDDDAARKSLCAANKLPAEHPFIEQEFTILKAKVEEANAAGTASWSEL 300

Query: 318 FSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFAST 377
            + K  +L+R IMG +IQSLQQLTG+NYFFYYGTT+F AVG++DSFQTSIV GVVNF ST
Sbjct: 301 ITGKPAMLRRTIMGIMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFQTSIVFGVVNFFST 360

Query: 378 FVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXX 437
           F+ L+TV+R+GRR CLL+G+A M  C+VV+ASVGVT+L+PNG+   SSK AGN MI    
Sbjct: 361 FLSLFTVDRFGRRNCLLYGAAGMVCCYVVYASVGVTRLWPNGQGNGSSKGAGNCMIVFSC 420

Query: 438 XXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYY 497
                    WAPIAYVI+SE++PLR+K +AM++A  SNWIWGF I F TPFIT+AI FYY
Sbjct: 421 FYIFCFATTWAPIAYVIISESFPLRIKTKAMSIASASNWIWGFLIAFFTPFITNAINFYY 480

Query: 498 GYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYDVNE 557
           GYVFMGC+            ET+GLTLEEV+EMY EGVLPWKS  WVP   R++SYD + 
Sbjct: 481 GYVFMGCMVFAYFYVFFFVNETRGLTLEEVDEMYAEGVLPWKSSKWVPESERDDSYDADA 540

Query: 558 TQEDS 562
              D 
Sbjct: 541 LLHDD 545

>Scas_509.2
          Length = 568

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/558 (58%), Positives = 403/558 (72%), Gaps = 13/558 (2%)

Query: 16  TELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENN--------EIPQKPLSEYILV 67
           +E+A  ++  +    S T S  LSE+    +  S  EN+        EIP+KP S Y+ +
Sbjct: 2   SEVAENTATPEVPQTSGTQS-ILSENSIKAENESFKENSDEGNEVVVEIPKKPASAYVTI 60

Query: 68  MCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNI 127
              C M+ FGGF+ GWDTGTI GF+   D+ RRFG        Y  S+VRTGL+VSIFNI
Sbjct: 61  SIFCCMIGFGGFISGWDTGTIGGFLAHPDYLRRFGQHHKNGTHY-FSNVRTGLVVSIFNI 119

Query: 128 GCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGI 187
           G   G L LG L +  GR++ L+AV+++++VGIIIQIAS +KWYQYFIGRI+SGLGVG I
Sbjct: 120 GGLFGCLILGDLANRIGRKMALVAVVVIFMVGIIIQIASIDKWYQYFIGRIISGLGVGAI 179

Query: 188 AVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFL 247
           ++ SP L+SE APKHLRGT  S YQLM+T GIF+G CTNYGTK Y N+VQW++PLGL F 
Sbjct: 180 SIFSPMLLSEVAPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGLSFA 239

Query: 248 WAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEK 307
           W +FMIA M FVPESPRYL+E G  EEAKRSIA SNK++++D  V AEV+LI++GVEAE+
Sbjct: 240 WCLFMIAAMFFVPESPRYLVEVGKIEEAKRSIATSNKVSMDDPAVQAEVDLISSGVEAER 299

Query: 308 LAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSI 367
           LAGNASW ELFS KGK +QR+ M C++Q LQQLTG NYFFYYGT IF AVGMKDS+QT+I
Sbjct: 300 LAGNASWAELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAI 359

Query: 368 VLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNG---KDMPS 424
           V G+VNFASTFV LY V+R+GRRKCL+WG+AAM  C+VV+ASVGVT+LYP+G   KD  S
Sbjct: 360 VFGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNS 419

Query: 425 SKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGF 484
           SK AGN MI             WAPI +V+VSE++PLR+K + MA+A G NW W F I F
Sbjct: 420 SKGAGNCMICFSCFFIFSFACTWAPICWVVVSESFPLRIKPKGMALANGCNWFWNFLISF 479

Query: 485 GTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWV 544
            TPFIT AI FYYGYVFMGC+            E KGLTLEEVNE++++GVLPWKS  WV
Sbjct: 480 FTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPDWV 539

Query: 545 PALRRNESYDVNETQEDS 562
           P+ RR    D++  Q+D 
Sbjct: 540 PSSRRGADVDMDAFQKDD 557

>YDR345C (HXT3) [1172] chr4 complement(1162947..1164650)
           Low-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/557 (60%), Positives = 407/557 (73%), Gaps = 9/557 (1%)

Query: 6   TPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYI 65
           +P     NSN +L     P++       P  K  +D F  +    L N   P      Y+
Sbjct: 9   SPQKSSENSNADL-----PSNSSQVMNMPEEKGVQDDFQAEADQVLTN---PNTGKGAYV 60

Query: 66  LVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIF 125
            V   C+MVAFGGFVFGWDTGTISGFV  TDF RRFG     +  Y LS VRTGLIVSIF
Sbjct: 61  TVSICCVMVAFGGFVFGWDTGTISGFVAQTDFLRRFG-MKHKDGSYYLSKVRTGLIVSIF 119

Query: 126 NIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVG 185
           NIGCAIGG+ L +LGDMYGR++GL+ V+++Y++GIIIQIAS NKWYQYFIGRI+SGLGVG
Sbjct: 120 NIGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVG 179

Query: 186 GIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLC 245
           GIAVLSP LISE APK +RGT VS YQLMITLGIF+GYCTN+GTK YSN+VQW++PLGLC
Sbjct: 180 GIAVLSPMLISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLC 239

Query: 246 FLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEA 305
           F WA+FMI GM FVPESPRYL+E G  +EA+ S++K NK+  +   +  E+E+I A VE 
Sbjct: 240 FAWALFMIGGMTFVPESPRYLVEAGQIDEARASLSKVNKVAPDHPFIQQELEVIEASVEE 299

Query: 306 EKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQT 365
            + AG+ASWGELF+ K  + +R +MG +IQSLQQLTG+NYFFYYGTT+F+AVGM DSF+T
Sbjct: 300 ARAAGSASWGELFTGKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVFNAVGMSDSFET 359

Query: 366 SIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSS 425
           SIV GVVNF ST   LYTV+R+GRR CLL+G+  M  C+VV+ASVGVT+L+PNG+   SS
Sbjct: 360 SIVFGVVNFFSTCCSLYTVDRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPNGEGNGSS 419

Query: 426 KSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFG 485
           K AGN MI             WAPIAYV++SET+PLRVK++AM++A  +NW+WGF IGF 
Sbjct: 420 KGAGNCMIVFACFYIFCFATTWAPIAYVVISETFPLRVKSKAMSIATAANWLWGFLIGFF 479

Query: 486 TPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVP 545
           TPFIT AI FYYGYVFMGC+            ETKGLTLEEVN+MY EGVLPWKS +WVP
Sbjct: 480 TPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYAEGVLPWKSASWVP 539

Query: 546 ALRRNESYDVNETQEDS 562
             +R  +YD +    D 
Sbjct: 540 TSQRGANYDADALMHDD 556

>Kwal_26.6686
          Length = 569

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/548 (57%), Positives = 406/548 (74%), Gaps = 2/548 (0%)

Query: 4   SATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKL-SEDGFATKTTSPLENNEIPQKPLS 62
           S  P    S +  +   V + +  DS + T  +K  +E+        P     I +KP S
Sbjct: 2   SGEPFTSASETAAQGTPVGNSSIVDSHTPTVPDKFYAEEPKGGDGFEPEFQPTIEKKPAS 61

Query: 63  EYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIV 122
            Y+ V  LC++V+FGGF+ GWDTG ++GFVNM DFK+RFG+++   + Y LS+VRTGL+V
Sbjct: 62  AYLTVSLLCVLVSFGGFLPGWDTGIMAGFVNMDDFKQRFGSYNHKTETYYLSNVRTGLLV 121

Query: 123 SIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGL 182
           +IF+ GCA GGLTL +LGD+YGRRLGLM VI++YVVG IIQI++ +KWYQYFIG+I+ G 
Sbjct: 122 AIFSAGCAFGGLTLPKLGDIYGRRLGLMIVIVLYVVGTIIQISAQDKWYQYFIGKIIYGW 181

Query: 183 GVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPL 242
           GVGG++VL+P LISETAPKHLRGT +S YQLM+T GIF+GYC  YGT+ Y+++ QW++P+
Sbjct: 182 GVGGVSVLAPMLISETAPKHLRGTLISCYQLMVTFGIFLGYCAVYGTRKYNSSAQWRIPV 241

Query: 243 GLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAG 302
           GLCFLWA+ +I GM FVPESPR+L+E G  EEAKRS+A+SNK+  E+ GV  E++LI AG
Sbjct: 242 GLCFLWAMIIIGGMTFVPESPRFLVEVGRMEEAKRSVARSNKVDPEEVGVQIEIDLIAAG 301

Query: 303 VEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDS 362
           VEAE+  G ASWGELFS K K+LQR+I G ++QS  QLTG NYFFYYGTTIF ++G+ DS
Sbjct: 302 VEAERQQGKASWGELFSTKTKVLQRLITGILMQSFLQLTGENYFFYYGTTIFKSIGLTDS 361

Query: 363 FQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDM 422
           F+TSIVLG+VNFASTF+ +Y V+ +GRRKCLLWG+A M+ C VVFASVGVT L+PNG+++
Sbjct: 362 FETSIVLGIVNFASTFLSMYVVDAFGRRKCLLWGAAGMTACMVVFASVGVTSLWPNGENV 421

Query: 423 -PSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFA 481
             +SK AGN MI             WAPIAYV+V+E++PLRVK++ M+++   NW+W F 
Sbjct: 422 GEASKGAGNCMIVFTCFFIFCFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWLWQFL 481

Query: 482 IGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSE 541
           IGF TPFITSAI FYYGYVFMGCL            ET GLTLEEV  +Y EG+ PW+S 
Sbjct: 482 IGFFTPFITSAIKFYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYDEGIPPWRSA 541

Query: 542 TWVPALRR 549
            WVP  RR
Sbjct: 542 DWVPPSRR 549

>Kwal_55.19582
          Length = 567

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/561 (55%), Positives = 405/561 (72%), Gaps = 9/561 (1%)

Query: 8   MNDRSNSNTELAAVSSPTD-----FDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLS 62
           M +   ++    A  +PT       DS + T   K   D       + +   E+P+KP S
Sbjct: 1   MKEELFTSNSATAAQTPTQGASSVVDSHTATVPKKFYMDEGNDGQMADMA--ELPKKPAS 58

Query: 63  EYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIV 122
            Y+ V  LC++V+FGGF+ GWDTG ++GFVNM DFKRRFG +     +Y LS+VRTGL+V
Sbjct: 59  AYVTVSLLCVLVSFGGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLSNVRTGLLV 118

Query: 123 SIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGL 182
           +IF+ GCA+GGLTL +LGD++GRRL LM V+ VYVVG IIQI++S+KWYQYFIG+I+ G 
Sbjct: 119 AIFSAGCALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGW 178

Query: 183 GVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPL 242
           GVGG++VL+P LISETAPKHLRGT +S YQLM+T GIF+GYC  Y T+ Y  + QW++PL
Sbjct: 179 GVGGVSVLAPMLISETAPKHLRGTLISCYQLMVTFGIFLGYCVVYATRKYDGSEQWRIPL 238

Query: 243 GLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAG 302
           GL FLWA+ ++AGM+FVPESPR+L+E G  EEA+RSIA SNK  VED  + AE++LI A 
Sbjct: 239 GLSFLWALIIVAGMVFVPESPRFLVEVGRIEEARRSIASSNKTPVEDPAIQAEIDLIAAS 298

Query: 303 VEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDS 362
           VEAEK  G A W ELFS K K+ QR+I G ++QS  QLTG NYFFYYGTTIF ++G+ DS
Sbjct: 299 VEAEKAQGKARWAELFSTKTKVFQRLITGILMQSFLQLTGENYFFYYGTTIFKSIGLTDS 358

Query: 363 FQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDM 422
           FQTSIVLG VNF S+F+ +YTV+ +GRRKCLLWG+AAM+VC V+FASVGVT L+P+G+++
Sbjct: 359 FQTSIVLGTVNFFSSFLSMYTVDAFGRRKCLLWGAAAMTVCMVIFASVGVTSLWPHGENV 418

Query: 423 -PSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFA 481
             +SK AGN MI             WAPIAYV+V+E++PLRVK++ M+++   NW+W F 
Sbjct: 419 GEASKPAGNVMIVFTCLFICFFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWLWQFL 478

Query: 482 IGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSE 541
           IGF TPFIT+AI FYYGYVFMGCL            ET GLTLEEV  +Y+EG+  W+S 
Sbjct: 479 IGFFTPFITNAIKFYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYEEGIPAWRSA 538

Query: 542 TWVPALRRNE-SYDVNETQED 561
            WVP  RR E +   +ET +D
Sbjct: 539 NWVPPTRRFENNSSPDETPQD 559

>YHR094C (HXT1) [2383] chr8 complement(290915..292627) Low-affinity
           hexose transporter, member of the hexose transporter
           family of the major facilitator superfamily (MFS),
           induced by glucose only at high concentration [1713 bp,
           570 aa]
          Length = 570

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/558 (58%), Positives = 396/558 (70%), Gaps = 18/558 (3%)

Query: 22  SSPTDFDSQSRTPSNKLS-EDGFATKTTSPLENNEIPQKPLSE----------------Y 64
           S+P     Q    SN    E G +    +P   NE     LSE                Y
Sbjct: 3   STPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQPAVAPPNTGKGVY 62

Query: 65  ILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSI 124
           + V   C+MVAFGGF+FGWDTGTISGFV  TDF RRFG     +  + LS VRTGLIVSI
Sbjct: 63  VTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG-MKHHDGSHYLSKVRTGLIVSI 121

Query: 125 FNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGV 184
           FNIGCAIGG+ L +LGDMYGRR+GL+ V+++Y +GIIIQIAS NKWYQYFIGRI+SGLGV
Sbjct: 122 FNIGCAIGGIVLAKLGDMYGRRIGLIVVVVIYTIGIIIQIASINKWYQYFIGRIISGLGV 181

Query: 185 GGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGL 244
           GGI VLSP LISE AP  +RGT VS YQ+MITLGIF+GYCTN+GTK YSN+VQW++PLGL
Sbjct: 182 GGITVLSPMLISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGL 241

Query: 245 CFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVE 304
           CF WA+FMI GM+FVPESPRYL+E G  +EA+ S+AK NK   +   +  E+E I A VE
Sbjct: 242 CFAWALFMIGGMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE 301

Query: 305 AEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQ 364
             + AG ASWGELF+ K  + QR +MG +IQSLQQLTG+NYFFYYGT +F AVG+ DSF+
Sbjct: 302 EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFQAVGLSDSFE 361

Query: 365 TSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPS 424
           TSIV GVVNF ST   LYTV+R+GRR CL+WG+  M  C+VV+ASVGVT+L+PNG+D PS
Sbjct: 362 TSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCYVVYASVGVTRLWPNGQDQPS 421

Query: 425 SKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGF 484
           SK AGN MI             WAPIAYV++SE +PLRVK++ M++A  +NWIWGF I F
Sbjct: 422 SKGAGNCMIVFACFYIFCFATTWAPIAYVVISECFPLRVKSKCMSIASAANWIWGFLISF 481

Query: 485 GTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWV 544
            TPFIT AI FYYGYVFMGC+            ETKGL+LEEVN+MY EGVLPWKS +WV
Sbjct: 482 FTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWV 541

Query: 545 PALRRNESYDVNETQEDS 562
           P  +R   Y+ ++   D 
Sbjct: 542 PVSKRGADYNADDLMHDD 559

>Scas_658.23
          Length = 568

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/557 (59%), Positives = 400/557 (71%), Gaps = 8/557 (1%)

Query: 13  NSNTELAAVSSPTDFDSQSRTPSN--KLSEDGFATKTTSPLENNEI-----PQKPLSEYI 65
           NS  +L      T  +S     SN  K+  D    +     +  ++     P      Y+
Sbjct: 2   NSTPDLITPQKSTSSNSNIEVDSNNSKVLNDPAGMEKNGSDDYEQVTELVNPNNGKGAYV 61

Query: 66  LVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIF 125
            V   C+MVAFGGFVFGWDTGTISGFV  TDF RRFG        Y LS VR GLIVSIF
Sbjct: 62  TVSICCVMVAFGGFVFGWDTGTISGFVAQTDFLRRFGQKHHNGTPY-LSKVRMGLIVSIF 120

Query: 126 NIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVG 185
           NIGCAIGG+ L RLGD +GR++GL+ V+ +Y+VGIIIQIAS   WYQYFIGRI+SGLGVG
Sbjct: 121 NIGCAIGGIVLARLGDTHGRKMGLIIVVCIYIVGIIIQIASVKAWYQYFIGRIISGLGVG 180

Query: 186 GIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLC 245
           GIAVLSP LISE APK +RGT VS YQLMITLGIF+GYCTNYGTK YSN+VQW++PLGLC
Sbjct: 181 GIAVLSPMLISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLC 240

Query: 246 FLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEA 305
           F WA+FMI GM FVPESPRYL+E G  +EA+ S++K NK   +   +  E+ELI A VE 
Sbjct: 241 FAWALFMIGGMTFVPESPRYLVEAGKIDEARASLSKVNKTPGDHPFIQQELELIEASVEE 300

Query: 306 EKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQT 365
            + AG+ASWGELF+ K  +LQR ++G +IQSLQQLTG+NYFFYYGTT+F AVGM+DSF+T
Sbjct: 301 ARAAGSASWGELFTGKPAMLQRTMLGIMIQSLQQLTGDNYFFYYGTTVFTAVGMQDSFET 360

Query: 366 SIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSS 425
           SIV G+VN AST   LYTV+++GRR CLLWG+  M  C+VV+ASVGVT+L+PNG+   SS
Sbjct: 361 SIVFGIVNLASTCCSLYTVDKFGRRNCLLWGAVGMVCCYVVYASVGVTRLWPNGEGNGSS 420

Query: 426 KSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFG 485
           K AGN MI             WAPIAYV++SET+PLRVK++AM++A  +NW+WGF IGF 
Sbjct: 421 KGAGNCMICFACFYIFCFATTWAPIAYVVISETFPLRVKSKAMSVATAANWLWGFLIGFF 480

Query: 486 TPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVP 545
           TPFIT AI FYYGYVFMGC+            ETKGLTLEEVN+MY EGV+PWKS +WVP
Sbjct: 481 TPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYSEGVVPWKSASWVP 540

Query: 546 ALRRNESYDVNETQEDS 562
             RR   Y+++E   D 
Sbjct: 541 PSRRGADYNIDELAHDD 557

>Scas_712.1
          Length = 558

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/540 (60%), Positives = 394/540 (72%), Gaps = 7/540 (1%)

Query: 28  DSQSRTPSNKLSEDGFATKTTSPLENNE-----IPQKPLSEYILVMCLCLMVAFGGFVFG 82
           D+ S + S   ++DG   K  S LE NE     IPQKP S YI V   CLMVAFGGF+ G
Sbjct: 10  DNLSASVSVHSNQDGL-KKDLSDLETNEQHVIDIPQKPASAYIAVCIFCLMVAFGGFISG 68

Query: 83  WDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDM 142
           WDTGTI GF+   DF  RFG+       Y  S+VRTGL+VSIFNIGC +G + LGRLGDM
Sbjct: 69  WDTGTIGGFLAHPDFVGRFGSKHSDGTPY-FSNVRTGLLVSIFNIGCCVGAVFLGRLGDM 127

Query: 143 YGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKH 202
           YGRR+G++  +++Y+VGI+IQIAS +KWYQYFIGRIV+GLG G IAVLSP LISE +PKH
Sbjct: 128 YGRRIGIVLAVIIYIVGIVIQIASVDKWYQYFIGRIVAGLGSGTIAVLSPMLISEVSPKH 187

Query: 203 LRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPES 262
           LRGT VS YQLMIT GIF+GYC NYGTK Y+N++QW++PLGLCF WA+F+IA M FVPES
Sbjct: 188 LRGTLVSCYQLMITFGIFLGYCANYGTKKYNNSIQWRVPLGLCFAWALFLIAAMFFVPES 247

Query: 263 PRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPKG 322
           PRYL+E G  EEAKRS+A+SNK++++D   +AEVE+I   VE+E+ AG+ASWGELF  K 
Sbjct: 248 PRYLVEAGKIEEAKRSVAQSNKVSIDDPATIAEVEIIQVAVESERAAGSASWGELFQTKT 307

Query: 323 KILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLY 382
           K+L R IM  ++ +LQQLTG NYFFYYGT +F+AVGM DS++TSIV G+VNFASTFV LY
Sbjct: 308 KVLPRTIMCVMVLALQQLTGCNYFFYYGTIVFNAVGMSDSYETSIVFGIVNFASTFVALY 367

Query: 383 TVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXX 442
            V+++GRR CLLWG+A M  C VVFASVGV  L+P+G D PSSK AGN MI         
Sbjct: 368 VVDKFGRRTCLLWGAAGMVCCMVVFASVGVKSLHPHGDDGPSSKGAGNCMIVFSCFFIFC 427

Query: 443 XXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFM 502
               WAPI +VIVSE++P ++K + MA+   SN +W F IGF TPFIT AI FYYGYVF+
Sbjct: 428 FATSWAPIPFVIVSESFPTKIKAKGMAIGTVSNQLWNFCIGFFTPFITGAIDFYYGYVFL 487

Query: 503 GCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYDVNETQEDS 562
           GCL            ETKGL LE+VN M++EGVLPWKS  WVP  +R   YD  E   D 
Sbjct: 488 GCLVFAYCYVFMFVPETKGLQLEDVNIMWEEGVLPWKSSAWVPPSQRGADYDAQELANDD 547

>Kwal_56.22285
          Length = 567

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/561 (55%), Positives = 403/561 (71%), Gaps = 9/561 (1%)

Query: 8   MNDRSNSNTELAAVSSPTD-----FDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLS 62
           M +   ++    A  +PT       DS + T   K   D          +  E+P+KP S
Sbjct: 1   MKEELFTSNSATAAQTPTQGASSVVDSHTATVPKKFYMD--EGNDGQMADMAELPKKPAS 58

Query: 63  EYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIV 122
            Y+ V  LC++V+FGGF+ GWDTG ++GFVNM DFKRRFG +     +Y LS+VRTGL+V
Sbjct: 59  AYVTVSLLCVLVSFGGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLSNVRTGLLV 118

Query: 123 SIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGL 182
           +IF+ GCA+GGLTL +LGD++GRRL LM V+ VYVVG IIQI++S+KWYQYFIG+I+ G 
Sbjct: 119 AIFSAGCALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGW 178

Query: 183 GVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPL 242
           GVGG++VL+P LIS TAPKH+RGT +S YQLM+T GIF+GYC  Y T+ Y  + QW++PL
Sbjct: 179 GVGGVSVLAPMLISLTAPKHVRGTLISCYQLMVTFGIFLGYCVVYATRKYDGSEQWRIPL 238

Query: 243 GLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAG 302
           GL FLWA+ ++AGM+FVPESPR+L+E G  EEA+RSIA SNK  VED  + AE++LI A 
Sbjct: 239 GLSFLWALIIVAGMVFVPESPRFLVEVGRIEEARRSIASSNKTPVEDPAIQAEIDLIAAS 298

Query: 303 VEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDS 362
           VEAEK  G A W ELFS K K+ QR+I G ++QS  QLTG NYFFYYGTTIF ++G+ DS
Sbjct: 299 VEAEKAQGKARWAELFSTKTKVFQRLITGILMQSFLQLTGENYFFYYGTTIFKSIGLTDS 358

Query: 363 FQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDM 422
           FQTSIVLG VNF S+F+ +YTV+ +GRRKCLLWG+AAM+VC V+FASVGVT L+P+G+++
Sbjct: 359 FQTSIVLGTVNFFSSFLSMYTVDAFGRRKCLLWGAAAMTVCMVIFASVGVTSLWPHGENV 418

Query: 423 -PSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFA 481
             +SK AGN MI             WAPIAYV+V+E++PLRVK++ M+++   NW+W F 
Sbjct: 419 GEASKPAGNVMIVFTCLFICFFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWLWQFL 478

Query: 482 IGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSE 541
           IGF TPFIT+AI FYYGYVFMGCL            ET GLTLEEV  +Y+EG+  W+S 
Sbjct: 479 IGFFTPFITNAIKFYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYEEGIPAWRSA 538

Query: 542 TWVPALRRNE-SYDVNETQED 561
            WVP  RR E +   +ET +D
Sbjct: 539 NWVPPTRRFENNSSPDETPQD 559

>AFL204C [2991] [Homologous to ScAFL204C] (51587..53194) [1608 bp,
           535 aa]
          Length = 535

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/535 (60%), Positives = 394/535 (73%), Gaps = 13/535 (2%)

Query: 29  SQSRTPS-NKLSEDGFATKTTSPLENNE-------IPQKPLSEYILVMCLCLMVAFGGFV 80
           S+  TPS ++LS DG     + P+E+ +          KP S YI     C MVAFGGF+
Sbjct: 4   SEGMTPSKSELSGDG---SNSHPIESKKDIVSVISTETKPFSAYIFACLCCFMVAFGGFI 60

Query: 81  FGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLG 140
           FGWDTGTISGFV  TDF  RFG       +Y LSD RTGLIVSIFNIGCA+GG+ L ++G
Sbjct: 61  FGWDTGTISGFVKQTDFIARFGQLS-PSGEYELSDDRTGLIVSIFNIGCAVGGIFLSKIG 119

Query: 141 DMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAP 200
           D YGR++GL  V  VYV+GI+IQI++S+KWYQYF+GRI+SGLGVGGIAVLSP LISET+P
Sbjct: 120 DAYGRKIGLATVTAVYVIGIVIQISASDKWYQYFVGRIISGLGVGGIAVLSPMLISETSP 179

Query: 201 KHLRGTCVSFYQLMITLGIFMGYCTNYGTKT-YSNAVQWKLPLGLCFLWAIFMIAGMIFV 259
           KHLRG+ VS YQLMIT GIF+GYCTNYGTKT Y+++ QW++PLGL F WA+ MI GM FV
Sbjct: 180 KHLRGSLVSCYQLMITAGIFLGYCTNYGTKTNYTDSRQWRIPLGLGFAWALLMIGGMAFV 239

Query: 260 PESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFS 319
           PESPRYL+E  N  +A+ SIA++NK+  +   V  E+  +   +E EKLAG A   +LF+
Sbjct: 240 PESPRYLVEAENLPKARMSIARANKVAEDHPIVEHELNTLQTAIELEKLAGKARIVDLFN 299

Query: 320 PKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFV 379
            K KI QR+I+G  IQSLQQL GNNYFFYYGTTIF+AVGM D F TSIVLG+VNF STF 
Sbjct: 300 VKKKIFQRLIIGIFIQSLQQLIGNNYFFYYGTTIFNAVGMDDPFVTSIVLGIVNFGSTFF 359

Query: 380 GLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXX 439
            LYTV+++GRRKCL+WG+ AM++C  +FASVGVTKL+PNG+D PSSK AGN MI      
Sbjct: 360 SLYTVDKFGRRKCLIWGAFAMAICMAIFASVGVTKLWPNGEDQPSSKPAGNVMIVFTCIY 419

Query: 440 XXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGY 499
                  WAPIAYVI+SE YPLRVK RAMA+A  +NWIWGF I F TP ITSAI F YGY
Sbjct: 420 IFFFATTWAPIAYVIISEIYPLRVKARAMALATAANWIWGFLIAFFTPRITSAIKFCYGY 479

Query: 500 VFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYD 554
           VFMGCL            ETKGLTLE+V+EM+QEGV+PW SE+W+P   R  ++D
Sbjct: 480 VFMGCLIFAFFYIFFFVPETKGLTLEDVDEMWQEGVVPWGSESWLPRSDREVAHD 534

>Scas_552.2
          Length = 572

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/548 (58%), Positives = 395/548 (72%), Gaps = 10/548 (1%)

Query: 24  PTDFDSQSRTPSNKLSE--DGFATKTTSPLENNE----IPQKPLSEYILVMCLCLMVAFG 77
           P +  SQS    + + +  D F     +  + NE    IP+KP S Y  +   C M+ FG
Sbjct: 15  PENSGSQSVLSDHSIKDENDSFKENGENGEDANEAVVEIPKKPASAYATISIFCCMIGFG 74

Query: 78  GFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLG 137
           GF+ GWDTGTI GF+   D+ RRFG        Y  S+VRTGL+VSIFNIG   G L LG
Sbjct: 75  GFISGWDTGTIGGFLAHPDYLRRFGQHHHDGTHY-FSNVRTGLVVSIFNIGGLFGCLILG 133

Query: 138 RLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISE 197
            L +  GR++ L+ V++++++GIIIQIAS NKWYQYFIGRI+SGLGVG I++ SP L+SE
Sbjct: 134 DLANRIGRKMALVVVVIIFMIGIIIQIASINKWYQYFIGRIISGLGVGAISIFSPMLLSE 193

Query: 198 TAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMI 257
            +PKHLRGT  S YQLM+T GIF+G CTNYGTK YSN+VQW++PLGL F W +FMIA M 
Sbjct: 194 VSPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKKYSNSVQWRVPLGLSFAWCLFMIAAMF 253

Query: 258 FVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGEL 317
           FVPESPRYL+E G  EEAKRSIA SNK++++D  V  EV+LI AGVEAE+LAGNASWGEL
Sbjct: 254 FVPESPRYLVEVGKMEEAKRSIATSNKVSIDDPAVQGEVDLILAGVEAERLAGNASWGEL 313

Query: 318 FSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFAST 377
           FS KGK +QR+ M C++Q LQQLTG NYFFYYGT IF AVGMKDS+QT+IV GVVNFAST
Sbjct: 314 FSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIVFGVVNFAST 373

Query: 378 FVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNG---KDMPSSKSAGNAMIX 434
           FV LY V+R+GRRKCL+WG+AAM  C+VV+ASVGVT+LYP+G   KD  SSK AGN MI 
Sbjct: 374 FVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSSKGAGNCMIC 433

Query: 435 XXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIG 494
                       WAPI +++VSE +PLR+K + MA+A G NW W F I F TPFIT AI 
Sbjct: 434 FSCFFIFCFACTWAPICWIVVSEAFPLRIKPKGMALANGCNWFWNFLISFFTPFITGAIN 493

Query: 495 FYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYD 554
           FYYGYVFMGC+            E KGLTLEEVNE++++GVLPWKS  WVP+ RR    +
Sbjct: 494 FYYGYVFMGCMVFGYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPNWVPSSRRGADVN 553

Query: 555 VNETQEDS 562
           ++E Q+D 
Sbjct: 554 MDEFQKDD 561

>Scas_657.20
          Length = 569

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/554 (57%), Positives = 397/554 (71%), Gaps = 8/554 (1%)

Query: 15  NTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENN---EIPQKPLSEYILVMCLC 71
           N  +     P    SQS    N +  +  + K TS        EIP+KP S Y+ +   C
Sbjct: 7   NNAIETPEVPQTSGSQSVISDNSIKAENESFKETSEDAQEVVLEIPKKPASAYVTISIFC 66

Query: 72  LMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAI 131
            M+AFGGF+ GWDTGTI GF+   D+ RRFG     + K+  S+VRTGLIVSIFNIG  I
Sbjct: 67  CMIAFGGFLSGWDTGTIGGFLAHPDYLRRFGQHH-HDGKHYFSNVRTGLIVSIFNIGGLI 125

Query: 132 GGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLS 191
           G L LG L +  GR++ L+AV +++++G+IIQIAS +KWYQYFIGRI+ G+GVG I++ S
Sbjct: 126 GCLVLGDLANRIGRKMALVAVTIIFMIGLIIQIASIDKWYQYFIGRIIGGVGVGAISIFS 185

Query: 192 PTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIF 251
           P L+SE +PKHLRGT  S YQLM+T GIF+G CTNYGTK Y N+VQW++PLGL F W +F
Sbjct: 186 PMLLSEVSPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGLSFAWCLF 245

Query: 252 MIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGN 311
           MIA M FVPESPRYL+E G  EEAKRSIA SNK++++D  V AEV+LI++GVEAE+LAGN
Sbjct: 246 MIAAMFFVPESPRYLVEVGKIEEAKRSIATSNKVSMDDPAVQAEVDLISSGVEAERLAGN 305

Query: 312 ASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGV 371
           ASW ELFS KGK +QR+ M C++Q LQQLTG NYFFYYGT +F AVGM DS+QT+IV G+
Sbjct: 306 ASWAELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTIVFQAVGMSDSYQTAIVFGI 365

Query: 372 VNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNG---KDMPSSKSA 428
           VNFASTFV LY V+R+GRRKCL+WG+AAM  C+VV+ASVGV++LYP G   KD+ +SK A
Sbjct: 366 VNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVSRLYPEGLKHKDI-TSKGA 424

Query: 429 GNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPF 488
           GN MI             WAPI +V+VSE++PLRVK + MA+A G NW W F I F TPF
Sbjct: 425 GNCMIVFSCFFIFSFACTWAPICWVVVSESFPLRVKPKGMALANGCNWFWNFLISFFTPF 484

Query: 489 ITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALR 548
           IT AI F YGYVFMGC+            E KGLTLEEVNE+++EGVLPWKS  WVP+ R
Sbjct: 485 ITGAINFCYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEEGVLPWKSPEWVPSSR 544

Query: 549 RNESYDVNETQEDS 562
           R    +++  Q+D 
Sbjct: 545 RGADVEMDAFQKDD 558

>CAGL0A01804g complement(175488..177179) highly similar to sp|P32466
           Saccharomyces cerevisiae YDR345c HXT3, start by
           similarity
          Length = 563

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/543 (59%), Positives = 396/543 (72%), Gaps = 6/543 (1%)

Query: 22  SSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEI--PQKPLSEYILVMCLCLMVAFGGF 79
           SS  + DS      N++ ++  A +    ++N  I  P      ++ V+  C MVAFGGF
Sbjct: 14  SSSNEVDSHESKYLNQVGKNDMADEF---VQNEMIANPNTGKGAFVGVIISCFMVAFGGF 70

Query: 80  VFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRL 139
           VFGWDTGTISGFV   DF  RFG       +Y LS VRTGLIVSIFNIGCAIGG+ L +L
Sbjct: 71  VFGWDTGTISGFVAQKDFIHRFGMKHPDGTEY-LSKVRTGLIVSIFNIGCAIGGIILSKL 129

Query: 140 GDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETA 199
           GD  GR++GL+ V+++Y+VGIIIQIAS NKWYQYFIGRI+SGLGVGGI+VLSP LISE A
Sbjct: 130 GDTKGRKMGLVVVVVIYIVGIIIQIASINKWYQYFIGRIISGLGVGGISVLSPMLISEVA 189

Query: 200 PKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFV 259
           P  LRG+ VS YQLMITLGIF+GYCTN+GTK Y+N+VQW++PLGLCF WA+FMI GM FV
Sbjct: 190 PSDLRGSLVSCYQLMITLGIFLGYCTNFGTKNYTNSVQWRVPLGLCFAWALFMIGGMTFV 249

Query: 260 PESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFS 319
           PESPRYL+E G  EEA+ S+A+ NK + +   +  E++LI A V+  + AG+ASWGELF+
Sbjct: 250 PESPRYLVEAGQIEEARSSLARINKCSPDHPYIQQELDLIQASVDEARSAGSASWGELFT 309

Query: 320 PKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFV 379
            K  + +R +MG +IQSLQQLTG+NYFFYYGT +F AVG++DSF+TSIV GVVNF ST  
Sbjct: 310 GKPAMFRRTLMGIMIQSLQQLTGDNYFFYYGTIVFKAVGLEDSFETSIVFGVVNFFSTCC 369

Query: 380 GLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXX 439
            L TV+R+GRR CLL+G+  M  C+VV+ASVGVT+L+P+G+   SSK AGN MI      
Sbjct: 370 SLLTVDRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPHGQGNGSSKGAGNCMIVFSCFY 429

Query: 440 XXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGY 499
                  WAPIAYVI+SET+PLR+K +AM++A  +NW+WGF I F TPFIT+AI FYYGY
Sbjct: 430 IFCFATTWAPIAYVIISETFPLRIKAKAMSIATAANWMWGFLIAFFTPFITNAINFYYGY 489

Query: 500 VFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYDVNETQ 559
           VFMGC+            ETKGLTLEEVNEMY EGVLPWKS  WVPA RR   YD +   
Sbjct: 490 VFMGCMVFAYFYVFFFVSETKGLTLEEVNEMYAEGVLPWKSSKWVPASRRGADYDADALM 549

Query: 560 EDS 562
            D 
Sbjct: 550 HDD 552

>Scas_685.5
          Length = 560

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/556 (54%), Positives = 389/556 (69%), Gaps = 14/556 (2%)

Query: 12  SNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENN---EIPQKPLSEYILVM 68
           S++  E  + S  ++  +++   ++   +D         +E+N   E+P+K    Y  + 
Sbjct: 2   SDAEHEQGSQSVLSNASAKAENDNDNFKDDS--------VEHNGYIEMPKKSAGAYATIS 53

Query: 69  CLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIG 128
            LC M+ FGGF+ GWDTGTI GF+   DF RRFG        Y  S+ RTGLIVSIFN+G
Sbjct: 54  ILCCMIGFGGFIAGWDTGTIGGFMGHPDFMRRFGQKRRDGTHY-FSNSRTGLIVSIFNLG 112

Query: 129 CAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIA 188
             IG LTL  L    GR+  L+ V+++Y+VGI+I++AS NKWYQYFIGRI+SG+GVG I+
Sbjct: 113 GCIGCLTLNNLAGRVGRKKALVIVVIIYMVGIVIEMASINKWYQYFIGRIISGMGVGAIS 172

Query: 189 VLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLW 248
           + SP L+SE +PKHLRGT  S YQLM+T GIF+G CTNYGT+   N+ QW+ PLGL F W
Sbjct: 173 IFSPMLLSEVSPKHLRGTLGSVYQLMVTFGIFLGDCTNYGTRHKHNSSQWRAPLGLSFAW 232

Query: 249 AIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKL 308
           A+FMIAGM FVPESPRYL+E G  EEAKRS+  SNKL+ +D  V  EV+LI A +EAE+L
Sbjct: 233 ALFMIAGMSFVPESPRYLLEIGKVEEAKRSVGTSNKLSADDPAVQCEVDLILANIEAERL 292

Query: 309 AGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIV 368
           AG+ASW ELFS KGK +QR++M CV+QSLQQLTG NYFFYYG+T+F A  +KD ++T+IV
Sbjct: 293 AGSASWPELFSTKGKYVQRLLMCCVLQSLQQLTGINYFFYYGSTVFQAASLKDPYETAIV 352

Query: 369 LGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMP--SSK 426
            G+VNFASTFV  Y V+++GRRKCL+WG+AAM  CFVV+ASVGV +LYP G+     +SK
Sbjct: 353 FGIVNFASTFVAFYVVDKFGRRKCLMWGAAAMVCCFVVYASVGVKRLYPEGRKHKEITSK 412

Query: 427 SAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGT 486
            AG+ MI              API +V+VSET+PL +K + MA+A GSNW+W F I F T
Sbjct: 413 GAGDCMIVFSCFFIFSFACTLAPICWVVVSETFPLEIKPKGMALANGSNWLWNFLISFFT 472

Query: 487 PFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPA 546
           PFIT AI FYYGYVFMGC+            E KGLTLEEVNE+++EGVLPWKS  WVP+
Sbjct: 473 PFITGAIDFYYGYVFMGCILFAYFFVFFFVPEMKGLTLEEVNELWEEGVLPWKSPDWVPS 532

Query: 547 LRRNESYDVNETQEDS 562
            RR+ + D+N  Q D 
Sbjct: 533 TRRDANMDMNALQHDD 548

>Scas_455.2*
          Length = 535

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/508 (59%), Positives = 381/508 (75%), Gaps = 1/508 (0%)

Query: 54  NEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVL 113
            E+P+KPLS+YI+   L L VAFGGF+ GWDTGTISG V   DF +RFG        + L
Sbjct: 20  EELPKKPLSDYIVACILSLAVAFGGFITGWDTGTISGIVAQEDFIQRFGE-RRSNGSHHL 78

Query: 114 SDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQY 173
           S+ RTG+IVS+FNIGCA+GG+ L R+GD +GR+ GLM VI++Y+VG+I+QI++   WYQY
Sbjct: 79  SNARTGIIVSLFNIGCAVGGIVLSRVGDKFGRKKGLMVVIVIYIVGVIVQISTQKAWYQY 138

Query: 174 FIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYS 233
           FIGR+VSGLGVGGIAVL P LISE +PKHLRGTC+SFYQLMIT GIF+GYCTNYGTK Y+
Sbjct: 139 FIGRVVSGLGVGGIAVLCPMLISEISPKHLRGTCISFYQLMITAGIFLGYCTNYGTKDYN 198

Query: 234 NAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVL 293
           N+VQW++PLGL F WA+ MI  + FVPESPR+L E  + E+AKRSIAK + ++V+D  V 
Sbjct: 199 NSVQWRVPLGLSFAWALIMIVILFFVPESPRFLCEINDPEKAKRSIAKIHNVSVKDPSVQ 258

Query: 294 AEVELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTI 353
            EV+LI +GVE+EKLAG+ASW EL S + K+ QRVIMG +I  LQQLTG+NYFFYYGT +
Sbjct: 259 TEVDLIMSGVESEKLAGSASWRELLSTRTKVRQRVIMGIMILMLQQLTGDNYFFYYGTIV 318

Query: 354 FDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVT 413
           F +VG+ DSFQTSIV GVVNF STF  LYTV+  GRR  LLW  AAM+ C ++++SVGVT
Sbjct: 319 FRSVGLNDSFQTSIVFGVVNFFSTFFALYTVDNVGRRLMLLWAGAAMTACLIIYSSVGVT 378

Query: 414 KLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVG 473
           +L+P+G+   SSK AGN MI             WAPI +V+V+E+YP+RVK++ MA++  
Sbjct: 379 RLWPHGEGNGSSKGAGNCMIVFTSFYIFCYAMSWAPIPWVLVAESYPIRVKSKCMAVSAA 438

Query: 474 SNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQE 533
           SNWIWGF I F TPFITS+I FYYGYVF+GCL            ETKGL+LEE+  ++ E
Sbjct: 439 SNWIWGFLISFFTPFITSSINFYYGYVFVGCLVFSWFYVFFFIPETKGLSLEEIQTLWDE 498

Query: 534 GVLPWKSETWVPALRRNESYDVNETQED 561
           GV PWKS  WV   +R   YD+ + Q+D
Sbjct: 499 GVAPWKSAKWVRPSKRTYDYDLEKFQKD 526

>YEL069C (HXT13) [1361] chr5 complement(21537..23231) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1695 bp, 564 aa]
          Length = 564

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/551 (51%), Positives = 383/551 (69%)

Query: 12  SNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLC 71
           S++ + + +     D D     P  K   DGF        +N E P++ L  Y+++  LC
Sbjct: 2   SSAQSSIDSDGDVRDADIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLLC 61

Query: 72  LMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAI 131
             ++FGGF+ GWD+G  +GF+NM +FK  FG++     +Y LS+VR GL+V++F+IGCAI
Sbjct: 62  YPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAI 121

Query: 132 GGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLS 191
           GGL   RL D  GRRL ++ V+LVY+VG IIQI+S++KWYQYF+G+I+ GLG GG +VL 
Sbjct: 122 GGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLC 181

Query: 192 PTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIF 251
           P L+SE AP  LRG  VS YQL +T GIF+GYC+ YGT+ Y N  QW++PLGLCFLWA+ 
Sbjct: 182 PMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWALI 241

Query: 252 MIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGN 311
           +I GM+ VPESPRYLIE    EEA+ SIAK NK++ ED  VL + + INAGV A++  G 
Sbjct: 242 IIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELGE 301

Query: 312 ASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGV 371
           ASW ELFS K K+LQR+I G ++Q+  QLTG NYFF+YGTTIF +VG+ D F+TSIVLG 
Sbjct: 302 ASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGT 361

Query: 372 VNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNA 431
           VNF ST + +  V++ GRRKCLL+G+A M  C V+FAS+GV  LYP+G+D PSSK AGNA
Sbjct: 362 VNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGNA 421

Query: 432 MIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITS 491
           MI             WAP+AY++V+E++P +VK+RAM+++   NW+W F IGF TPFIT 
Sbjct: 422 MIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFITG 481

Query: 492 AIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNE 551
           +I FYYGYVF+GCL            ET GL+LEE+  +Y+EG+ PWKS +WVP  RR  
Sbjct: 482 SIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRGI 541

Query: 552 SYDVNETQEDS 562
           S + ++T++  
Sbjct: 542 SSEESKTEKKD 552

>YNR072W (HXT17) [4655] chr14 (772654..774348) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1695 bp, 564 aa]
          Length = 564

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/552 (51%), Positives = 382/552 (69%), Gaps = 1/552 (0%)

Query: 11  RSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCL 70
           +S++ ++      P D D     P  K   DGF        +N E P++ L  Y+++  L
Sbjct: 2   QSSTESDRDIQDGP-DADIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLL 60

Query: 71  CLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCA 130
           C  ++FGGF+ GWD+G  +GF+NM +FK  FG++     +Y LS+VR GL+V++F+IGCA
Sbjct: 61  CYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCA 120

Query: 131 IGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVL 190
           IGGL   RL D  GRRL ++ V+LVY+VG IIQI+S++KWYQYF+G+I+ GLG GG +VL
Sbjct: 121 IGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL 180

Query: 191 SPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAI 250
            P L+SE AP  LRG  VS YQL +T GIF+GYC+ YGT+ Y N  QW++PLGLCFLW +
Sbjct: 181 CPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWTL 240

Query: 251 FMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAG 310
            +I GM+ VPESPRYLIE    EEA+ SIAK NK++ ED  VL + + INAGV A++  G
Sbjct: 241 IIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELG 300

Query: 311 NASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLG 370
            ASW ELFS K K+LQR+I G ++Q+  QLTG NYFF+YGTTIF +VG+ D F+TSIVLG
Sbjct: 301 EASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLG 360

Query: 371 VVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGN 430
            VNF ST + +  V++ GRRKCLL+G+A M  C V+FAS+GV  LYP+G+D PSSK AGN
Sbjct: 361 TVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGN 420

Query: 431 AMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFIT 490
           AMI             WAP+AY++V+E++P +VK+RAM+++   NW+W F IGF TPFIT
Sbjct: 421 AMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFIT 480

Query: 491 SAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRN 550
            +I FYYGYVF+GCL            ET GL+LEE+  +Y+EG+ PWKS +WVP  RR 
Sbjct: 481 GSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRG 540

Query: 551 ESYDVNETQEDS 562
              + ++T++  
Sbjct: 541 IPSEESKTEKKD 552

>YDL245C (HXT15) [632] chr4 complement(11657..13360) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/561 (50%), Positives = 383/561 (68%), Gaps = 8/561 (1%)

Query: 2   SSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPL 61
           S  ++P  +  N N+  A        D   + P  K   DGF  K        + P++  
Sbjct: 3   SEQSSPEINADNLNSSAA--------DVHVQPPGEKEWSDGFYDKEVINGNTPDAPKRGF 54

Query: 62  SEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLI 121
             Y+++  LC  V+FGGF+ GWD+G  +GF+NM +FK  FG++     +Y LS+VR GL+
Sbjct: 55  LGYLIIYLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLL 114

Query: 122 VSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSG 181
           V++F++GC+IGG+   RL D  GRRL ++ V+LVY+VG IIQI+S++KWYQYF+G+I+ G
Sbjct: 115 VAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYG 174

Query: 182 LGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLP 241
           LG GG +VL P L+SE AP  LRG  VS YQL +T GIF+GYC+ YGT+ YSN  QW++P
Sbjct: 175 LGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIP 234

Query: 242 LGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINA 301
           +GLCFLWA+ +I GM+ VPESPRYLIE    EEA  SIAK NK++ ED  VL + + INA
Sbjct: 235 VGLCFLWALIIIVGMLLVPESPRYLIECERHEEACVSIAKINKVSPEDPWVLKQADEINA 294

Query: 302 GVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKD 361
           GV A++  G ASW ELFS K K+LQR+I G ++Q+  QLTG NYFF+YGTTIF +VG+ D
Sbjct: 295 GVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTD 354

Query: 362 SFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKD 421
            F+TSIVLG VNF ST + +  V++ GRRKCLL+G+A+M  C V+FAS+GV  LYP+G+D
Sbjct: 355 GFETSIVLGTVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFASIGVKCLYPHGQD 414

Query: 422 MPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFA 481
            PSSK AGNAMI             WAP+AY++V+E++P +VK++AM+++   NW+W F 
Sbjct: 415 GPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFL 474

Query: 482 IGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSE 541
           IGF TPFIT +I FYYGYVF+GCL            ET GL+LEE+  +Y+EG+ PWKS 
Sbjct: 475 IGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSA 534

Query: 542 TWVPALRRNESYDVNETQEDS 562
           +WVP  RR  S    E ++ S
Sbjct: 535 SWVPPSRRGASSRETEAKKKS 555

>YJR158W (HXT16) [3048] chr10 (732355..734058) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/561 (50%), Positives = 382/561 (68%), Gaps = 8/561 (1%)

Query: 2   SSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPL 61
           S  ++P  +  N N+  A        D   + P  K   DGF  K        + P++  
Sbjct: 3   SEQSSPEINADNLNSSAA--------DVHVQPPGEKEWSDGFYDKEVINGNTPDAPKRGF 54

Query: 62  SEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLI 121
             Y+++  LC  V+FGGF+ GWD+G  +GF+NM +FK  FG++     +Y LS+VR GL+
Sbjct: 55  LGYLIIYLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLL 114

Query: 122 VSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSG 181
           V++F++GC+IGG+   RL D  GRRL ++ V+LVY+VG IIQI+S++KWYQYF+G+I+ G
Sbjct: 115 VAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYG 174

Query: 182 LGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLP 241
           LG GG +VL P L+SE AP  LRG  VS YQL +T GIF+GYC+ YGT+ YSN  QW++P
Sbjct: 175 LGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIP 234

Query: 242 LGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINA 301
           +GLCFLWA+ +I GM+ VPESPRYLIE    EEA  SIAK +K++ ED  VL + + INA
Sbjct: 235 VGLCFLWALIIIVGMLLVPESPRYLIECERHEEACVSIAKIDKVSPEDPWVLKQADEINA 294

Query: 302 GVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKD 361
           GV A++  G ASW ELFS K K+LQR+I G ++Q+  QLTG NYFF+YGTTIF +VG+ D
Sbjct: 295 GVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTD 354

Query: 362 SFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKD 421
            F+TSIVLG VNF ST + +  V++ GRRKCLL+G+A+M  C V+FAS+GV  LYP+G+D
Sbjct: 355 GFETSIVLGTVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFASIGVKCLYPHGQD 414

Query: 422 MPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFA 481
            PSSK AGNAMI             WAP+AY++V+E++P +VK++AM+++   NW+W F 
Sbjct: 415 GPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFL 474

Query: 482 IGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSE 541
           IGF TPFIT +I FYYGYVF+GCL            ET GL+LEE   +Y+EG+ PWKS 
Sbjct: 475 IGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEETQLLYEEGIKPWKSA 534

Query: 542 TWVPALRRNESYDVNETQEDS 562
           +WVP  RR  S    E ++ S
Sbjct: 535 SWVPPSRRGASSRETEAKKKS 555

>YIL170W (HXT12) [2508] chr9 (19847..21220) Protein of unknown
           function [1374 bp, 457 aa]
          Length = 457

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/446 (64%), Positives = 343/446 (76%), Gaps = 2/446 (0%)

Query: 119 GLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRI 178
           GLIVSIFNIGCAIGG+ L ++GD+YGRR+GL+ V  +YVVGI+IQI S NKWYQYFIGRI
Sbjct: 2   GLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRI 61

Query: 179 VSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQW 238
           +SG+GVGGIAVLSP LISE APKH+RGT V  YQLM T+GIF+GYCTNYGTK Y NA QW
Sbjct: 62  ISGIGVGGIAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQW 121

Query: 239 KLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVEL 298
           ++ LGLCF WA FM++GM+FVPESPRYLIE G  EEAK S++KSNK++V+D  +LAE + 
Sbjct: 122 RVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKDEEAKHSLSKSNKVSVDDPALLAEYDT 181

Query: 299 INAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVG 358
           I AG+E EKLAGNASW EL S K K+ QRV+MG +IQSLQQLTG+NYFFYYGTTIF +VG
Sbjct: 182 IKAGIEIEKLAGNASWSELLSTKTKVFQRVLMGVIIQSLQQLTGDNYFFYYGTTIFKSVG 241

Query: 359 MKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPN 418
           +KDSFQTSI++GVVNF S+F+ +YT+ER+GRR CLLWG+A+M  CF VFASVGVTKL+P 
Sbjct: 242 LKDSFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQ 301

Query: 419 GKDMP--SSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNW 476
           G      +S+ AGN MI             WA   +VIVSET+PLR K+R MA+A  +NW
Sbjct: 302 GSSHQDITSQGAGNCMIVFTMFFIFSFATTWAGGCFVIVSETFPLRAKSRGMAIATAANW 361

Query: 477 IWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVL 536
           +WGF I F TPFIT AI FYYGYVF+GCL            ETKGLTLEEVN M+ EGV 
Sbjct: 362 MWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVP 421

Query: 537 PWKSETWVPALRRNESYDVNETQEDS 562
            WKS +WVP  RR   YD +    D+
Sbjct: 422 AWKSASWVPPERRTADYDADAIDHDN 447

>Scas_634.16
          Length = 471

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/449 (59%), Positives = 333/449 (74%), Gaps = 13/449 (2%)

Query: 7   PMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYIL 66
           P+ND ++ +  +    S  D D + +       EDG        +   E+P+KP S Y+ 
Sbjct: 34  PLNDSASGSHSVLEAQSNKDDDEEIK----NYGEDG-------EIAPAEMPKKPASAYVT 82

Query: 67  VMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFN 126
           V  LCLM+AFGG+V+GWDTGTISGFV  TD+ RR+G     +  Y LS VRTGL+++IFN
Sbjct: 83  VSILCLMIAFGGYVYGWDTGTISGFVAQTDYVRRYGQ-KKKDGTYYLSKVRTGLLLAIFN 141

Query: 127 IGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGG 186
           IGCAIGGL   RLGDM+GRR  L+ V  VY++G+II IA+   WYQYFIGRI+SGLGVGG
Sbjct: 142 IGCAIGGLLWSRLGDMWGRRKALVFVTTVYMIGLIISIAAVKHWYQYFIGRIISGLGVGG 201

Query: 187 IAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCF 246
           IAV SP LISE APKH+RGT VS YQLMITLGIF+GYCTN+GT+ YSN+VQW++PLGL F
Sbjct: 202 IAVYSPLLISEVAPKHVRGTLVSCYQLMITLGIFLGYCTNFGTRNYSNSVQWRVPLGLGF 261

Query: 247 LWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAE 306
            WA+FMIA M FVPESPRYLIE G  EEAKRS+A+SN+LTV+D  V+AEVE + AGVEAE
Sbjct: 262 AWALFMIAAMFFVPESPRYLIEVGQMEEAKRSVAQSNRLTVDDPSVIAEVEFLTAGVEAE 321

Query: 307 KLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTS 366
           + AG+ASW ELF  KGKIL RVIMG +IQ+LQQLTG NYFF+YGT IF ++GM D F+ S
Sbjct: 322 REAGSASWMELFQTKGKILHRVIMGIMIQTLQQLTGANYFFFYGTLIFASIGMNDGFKAS 381

Query: 367 IVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNG-KDMPSS 425
           +V+G+VNFASTF  +Y V+R+GRR CLL+G+A M  C VVFASVGVT+L+P+G ++  +S
Sbjct: 382 VVIGIVNFASTFPAIYIVDRFGRRTCLLFGAAGMICCMVVFASVGVTRLHPDGDQNGVAS 441

Query: 426 KSAGNAMIXXXXXXXXXXXXXWAPIAYVI 454
           K AGN MI             WAP AYV+
Sbjct: 442 KGAGNCMICFTCFFIFCFANTWAPCAYVM 470

>Kwal_26.6680
          Length = 416

 Score =  510 bits (1314), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 242/403 (60%), Positives = 301/403 (74%)

Query: 150 MAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVS 209
           M V++VYVVG IIQI +  KWY YFIG+I+ G GVGG++VLSP LISE +PKHLRGT VS
Sbjct: 1   MLVMIVYVVGAIIQITADRKWYHYFIGKIIYGWGVGGMSVLSPMLISEISPKHLRGTLVS 60

Query: 210 FYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEK 269
            +QLM+T GIF+GYC  YGT+ YS++ QW++P+GL FLWAI ++ GM FVPESPRYL+E 
Sbjct: 61  CFQLMVTFGIFLGYCAVYGTRQYSDSAQWRIPVGLSFLWAIIIVTGMFFVPESPRYLVEA 120

Query: 270 GNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPKGKILQRVI 329
              EEAKRSIA++ KL+V+D  V  E +LI AGVEA++  G ASWGELFS K K+LQR+I
Sbjct: 121 NKVEEAKRSIARAFKLSVDDPEVQEETDLIVAGVEAQREQGEASWGELFSVKTKVLQRLI 180

Query: 330 MGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGR 389
            G ++QS  QLTG NYFFYYGTTIFD++G+ DSFQTSIVLG VN AS+F+ +YTV+  GR
Sbjct: 181 TGILMQSFLQLTGENYFFYYGTTIFDSIGLTDSFQTSIVLGTVNLASSFISMYTVDALGR 240

Query: 390 RKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAP 449
           RKCLLWG+A M++C V+FASVGVT L PNG D  +SKSAGN M+             WAP
Sbjct: 241 RKCLLWGAAGMAICMVIFASVGVTSLRPNGPDGEASKSAGNCMVVFICLFILCFATTWAP 300

Query: 450 IAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXX 509
           I+YV+VSE++PLRVK++ M+++   NW+W F I F TPFIT AI FYYGYVF GCL    
Sbjct: 301 ISYVVVSESFPLRVKSKCMSISTAFNWLWQFLISFFTPFITGAINFYYGYVFFGCLVAMF 360

Query: 510 XXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNES 552
                   ET GLTLEEV  +Y EGV  W+S +WVP  RR+ +
Sbjct: 361 LYVFFFVPETGGLTLEEVQTLYDEGVPAWRSTSWVPPGRRSSN 403

>Scas_600.1
          Length = 293

 Score =  359 bits (921), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 169/282 (59%), Positives = 209/282 (74%), Gaps = 3/282 (1%)

Query: 284 KLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGN 343
           K++V+D  V AE +LI +G+EAE+LAGNASWGELFS KGK++QR++M C++Q LQQLTG 
Sbjct: 1   KVSVDDPAVQAECDLITSGIEAERLAGNASWGELFSTKGKVVQRLLMCCMLQCLQQLTGC 60

Query: 344 NYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVC 403
           NYFFYYGT IF AVG+KDS+QT+IV G+VNFASTFV  Y V+ YGRRKCL+WG+AAM  C
Sbjct: 61  NYFFYYGTVIFQAVGLKDSYQTAIVFGIVNFASTFVAFYVVDHYGRRKCLMWGAAAMVCC 120

Query: 404 FVVFASVGVTKLYPNG---KDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYP 460
           +VV+ASVGVT+LYP+G   KD  SSK AGN MI             WAPI +V+VSE++P
Sbjct: 121 YVVYASVGVTRLYPDGIKHKDTNSSKGAGNCMIVFSCFFIFSFACTWAPICWVVVSESFP 180

Query: 461 LRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETK 520
           L++K + MA+A G NW W F + F TPFIT AI FYYGYVFMGC+            E K
Sbjct: 181 LKIKPKGMALANGCNWFWNFLVSFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMK 240

Query: 521 GLTLEEVNEMYQEGVLPWKSETWVPALRRNESYDVNETQEDS 562
           GLTLEEV+E++QEGVLPWKS  WVPA RR    D++  Q+D 
Sbjct: 241 GLTLEEVDELWQEGVLPWKSPDWVPASRRGADVDLDAFQKDD 282

>KLLA0E21021g 1870154..1871740 gi|32400014|emb|CAE00632.1
           Kluyveromyces lactis hexose transporter 3, hypothetical
           start
          Length = 528

 Score =  351 bits (900), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/490 (39%), Positives = 282/490 (57%), Gaps = 21/490 (4%)

Query: 51  LENNEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFG-NFDVGEQ 109
           +E  ++P KP+        LCL  +F GF+FGWD GTI G  NM  F+  FG NFD    
Sbjct: 48  IEQKKLPLKPI-------LLCLATSFAGFIFGWDVGTIGGITNMVSFQNFFGTNFDSSSN 100

Query: 110 KYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNK 169
            +    +  GLIVSIFNI CA+GGL L ++ D+ GR+ G+ A I +Y +G +I     + 
Sbjct: 101 THYFPKLLIGLIVSIFNISCALGGLFLVKIADINGRKPGIYAAITIYSLGTLIGWTCGSS 160

Query: 170 WYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGT 229
           W+ +F  R +SGLGVG  AV+ P  I+E+AP ++RG  V  YQLMITLGI +G   NY  
Sbjct: 161 WWYFFFARFISGLGVGATAVMIPMFIAESAPINIRGAMVVLYQLMITLGILLGNVINYCC 220

Query: 230 KTY---SNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEK-GNFEEAKRSIAKSNKL 285
           ++    ++   WK+P+GL  +WA  +  G+ F+PESP +L ++ G+  +AK + A  N L
Sbjct: 221 RSTLHETDNATWKIPVGLGNVWAAIVALGVHFMPESPVFLTKRLGSALKAKAAFAHMNNL 280

Query: 286 TVEDSGVLAEVELINAGVEAEKLAGNA---SWGELFSPKGKILQRVIMGCVIQSLQQLTG 342
            V+D  V + +  +    +AE    N    S  E    + ++  R+ +G ++ + QQL+G
Sbjct: 281 DVDDPIVDSHIRKMMESADAEVSTHNDMKNSRFEFILGQPRLGFRLFIGIMVMAFQQLSG 340

Query: 343 NNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSV 402
            NYFFYYGTT+F++VG++D + TSI+L  VNF STF G+Y VE+ GR+ CL+ GSA M  
Sbjct: 341 ANYFFYYGTTLFNSVGIEDPYLTSILLSSVNFISTFFGIYLVEKLGRKACLILGSAGMFT 400

Query: 403 CFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLR 462
           C  V+ASVG   L        S +++G  M+               P+++V++SE +P R
Sbjct: 401 CMSVYASVGSFALN------KSPQNSGAIMVTFTCVYIMFFACTSGPVSFVVISELFPSR 454

Query: 463 VKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGL 522
            K  +MA+    NW+  F I   TP++T  IGF +G+VF GCL            ETK  
Sbjct: 455 TKAISMAVCTSINWLCNFFISLCTPYVTDKIGFKFGFVFAGCLFVSFWFFTFLLKETKNK 514

Query: 523 TLEEVNEMYQ 532
           T E+V+ +Y 
Sbjct: 515 TPEQVDALYS 524

>AFR602W [3794] [Homologous to ScYNL318C (HXT14 ) - NSH]
           complement(1523019..1524695) [1677 bp, 558 aa]
          Length = 558

 Score =  347 bits (891), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/528 (36%), Positives = 294/528 (55%), Gaps = 19/528 (3%)

Query: 15  NTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMV 74
           NTE  A+ + +  + + +         G   ++ S    + +P+  L   +L    CL V
Sbjct: 38  NTETKAMDTRSVLELKEKEEYGVYEAAGSTDRSISLSGASPVPEGSLVRPVL---YCLSV 94

Query: 75  AFGGFVFGWDTGTISGFVNMTDFKRRFG---NFDVGEQKYVLSDVRTGLIVSIFNIGCAI 131
           AF G +FGWD GTI G   M  F+   G   N D G  ++       GL++ IFNIGCAI
Sbjct: 95  AFCGIIFGWDLGTIGGISTMPSFQNTLGPRFNGDTGLHEF--PGRLLGLLIGIFNIGCAI 152

Query: 132 GGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLS 191
           GGLT+ RLGD+ GR++ ++  +LVY VG+ +Q+ S + WY+YFIGR+++GL VG   VL 
Sbjct: 153 GGLTIARLGDIKGRKIAILTSLLVYAVGMFVQLGSGHFWYRYFIGRLIAGLAVGATMVLV 212

Query: 192 PTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTK-----TYSNAVQWKLPLGLCF 246
           P  +SE AP  +RG  +  YQ++I LGI +G   NY  K     T SN + WK+P+    
Sbjct: 213 PMFLSELAPVRIRGAMIVLYQVVICLGIALGSIVNYACKELVHDTLSN-MTWKVPIFFQI 271

Query: 247 LWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEV-ELINAGVEA 305
            + + +   ++  PES  +L  KG+ E+AKRS A  N L+ +   V   V   +   +++
Sbjct: 272 GFTVLLSLALLITPESAEFLAMKGHLEKAKRSFAVMNGLSKDHPFVEERVASFVQVSMKS 331

Query: 306 EKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQT 365
           + +  +    E      ++  R+ +G  + +LQ L+G NYFFYYGTT+F  VG++D++ T
Sbjct: 332 DDIEHSGDRWEFIRGNPRLGLRLFIGVTVMALQMLSGVNYFFYYGTTLFRFVGIEDAYVT 391

Query: 366 SIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSS 425
           SI++G V+   TF+G+Y VER GR+ CLL G+  M +C  V+A +G   L    KD  ++
Sbjct: 392 SIIIGCVDLLGTFIGVYIVERLGRKICLLSGATGMFICMTVYACLGSFAL----KDDSNN 447

Query: 426 KSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFG 485
           K+ G  MI               P++ V++SE +P+R K  +MA+    NW+  F I F 
Sbjct: 448 KTVGAVMIFFTCVFVMFFAATSGPVSMVVMSEIFPIRTKVMSMAICTSVNWLVNFLIAFV 507

Query: 486 TPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQE 533
           TP +T AI + +G+VF GCL            ETKGLT E+V+ +Y++
Sbjct: 508 TPDVTDAINYRFGFVFSGCLLFSIVFFIYLVPETKGLTHEQVDAIYEK 555

>Scas_716.53
          Length = 523

 Score =  333 bits (853), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/536 (37%), Positives = 288/536 (53%), Gaps = 24/536 (4%)

Query: 5   ATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEY 64
           + P +D  +SN    +++S     S    P     +     + T   EN + P       
Sbjct: 2   SVPAHDL-DSNEHTTSITSTMSRSSSQEVPIALTKKRNLGNEETILQENKKNP-----SL 55

Query: 65  ILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNF-DVGEQKYVLSDVRTGLIVS 123
           I  M +CL ++FGGF+FGWD GTI G  NM+ FK RFG   D G+       +  GLI+ 
Sbjct: 56  ITPMLICLAISFGGFLFGWDIGTIGGIANMSSFKERFGTRQDQGKGTKHFPGLLIGLIIG 115

Query: 124 IFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLG 183
           IFN+   +GG+ L + GD +GR+      I +Y +G+++Q+  +  W+Q FIGR++ GL 
Sbjct: 116 IFNLSAGVGGVALAKCGDWWGRKRATYFFIFIYSIGLLVQLIHNRAWFQIFIGRLICGLA 175

Query: 184 VGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMG-----YCTNYGTKTYSNAVQW 238
           +GGI V+ P  ISE AP  +RG+ V+FYQL IT GI +G      C N  ++++ N   W
Sbjct: 176 IGGINVIVPMFISEIAPLRVRGSMVTFYQLKITFGILVGNITVFLCHNGFSRSHQNEA-W 234

Query: 239 KLPLGLCFLWAIFMIAGMIFVPESPRYL-IEKGNFEEAKRSIAKSNKLTVEDSGVLAEVE 297
           ++PLGL F+WA  +I G+   PES +YL I+K  ++ A  S A+ N L+  D   +  VE
Sbjct: 235 QIPLGLGFVWAFIVILGLYNSPESAQYLGIKKERWDAALMSTARMNNLSTGDIRAINIVE 294

Query: 298 LINAGVEAEKLAGNASWG--ELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFD 355
            +    E ++L  ++     E    K K+  R+ +G ++   QQL+G NYFFYYGTTIF 
Sbjct: 295 EMQRRAEQDRLEKSSRRNIFEFIFGKPKLGLRLFIGIMLMIFQQLSGINYFFYYGTTIFA 354

Query: 356 AVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKL 415
            VG+ D + T+I+L  VNF +TF G+Y VE   RR  L++GS  M  C ++++S+G   L
Sbjct: 355 KVGLNDPYTTAIILSSVNFVATFFGIYFVEALRRRTSLVFGSIGMFCCMMIYSSMGSFAL 414

Query: 416 YPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSN 475
             +G         G  MI               P+  V+VSE YP+R K  +MA    +N
Sbjct: 415 NTDG--------TGITMIVVTCVYIALFAITLGPVTIVLVSELYPMRTKAMSMATCSFAN 466

Query: 476 WIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 531
           WI  F I F TP IT+ IGF YGYVF  CL            ETK  T  E++ M+
Sbjct: 467 WIMNFLITFLTPLITAQIGFKYGYVFAVCLFFSTCFDWTTVPETKNKTPTEIDNMF 522

>Kwal_55.20068
          Length = 267

 Score =  320 bits (820), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 153/257 (59%), Positives = 187/257 (72%), Gaps = 2/257 (0%)

Query: 308 LAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSI 367
           +AG ASW EL + K ++L+R I G +I SLQQLTG+NYFFYYGTTIF+AVG+KDSFQTSI
Sbjct: 1   MAGKASWAELITGKPQMLKRTINGIMIMSLQQLTGDNYFFYYGTTIFNAVGLKDSFQTSI 60

Query: 368 VLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMP--SS 425
           +LG+VNF ST + LYTV+++GRR CL++G+  M  C+ V+ASVGVT+LYP+G +    +S
Sbjct: 61  ILGIVNFVSTSLSLYTVDKFGRRNCLIYGAIGMIACYTVYASVGVTRLYPDGANHKDVTS 120

Query: 426 KSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFG 485
           K AGN +I             WAPIAYV++SETYPLRVK RAM++A  +NW+WGF I F 
Sbjct: 121 KGAGNVLICFACFYIFCFATTWAPIAYVLISETYPLRVKGRAMSLASAANWLWGFLISFF 180

Query: 486 TPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVP 545
           TPFITSAI FYYGYVFMGC+            ETKGLTLEEVNEMY EGVLPWKS  WVP
Sbjct: 181 TPFITSAINFYYGYVFMGCMVFAVFYVFFLIPETKGLTLEEVNEMYAEGVLPWKSANWVP 240

Query: 546 ALRRNESYDVNETQEDS 562
           A RR   YD +    + 
Sbjct: 241 ASRRGADYDADALNHED 257

>YNL318C (HXT14) [4295] chr14 complement(38706..40328) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1623 bp, 540 aa]
          Length = 540

 Score =  322 bits (825), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/485 (37%), Positives = 277/485 (57%), Gaps = 31/485 (6%)

Query: 70  LCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDV---GEQKYV----LSDVRTGLIV 122
           LCL+++ GGF+FGWD GTI G  NM  F+ +FG  ++    E  +V    L+D++ GLI+
Sbjct: 63  LCLVISLGGFIFGWDIGTIGGMTNMVSFQEKFGTTNIIHDDETIFVSTKKLTDLQIGLII 122

Query: 123 SIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGL 182
           SIFNI C +G LTL ++GD  GR+ G+   ++VY +GI IQI S  +WY   +GR V+G+
Sbjct: 123 SIFNISCGVGALTLSKIGDWIGRKGGIWFALVVYCIGITIQILSYGRWYFLTLGRAVTGI 182

Query: 183 GVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNY-GTKTYSNAVQ---W 238
           GVG   VL P  +SE +P  +RG+ VS YQL++T GI MG   N+   + Y +  Q   W
Sbjct: 183 GVGVTTVLVPMFLSENSPLKIRGSMVSTYQLIVTFGILMGNILNFICERCYKDPTQNIAW 242

Query: 239 KLPLGLCFLWAIFMIAGMIFVPESPRYLIE-KGNFEEAKRSIAKSNKLTVEDSGVLAEVE 297
           +LPL L ++WAI +   +++VPESP+YL + K +   AK S A+ N +   DS V+  ++
Sbjct: 243 QLPLFLGYIWAIIIGMSLVYVPESPQYLAKIKNDVPSAKYSFARMNGIPATDSMVIEFID 302

Query: 298 ----------LINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFF 347
                       N   + + L    ++ E    K K+  R+I+G +I + QQL+G NYFF
Sbjct: 303 DLLENNYNNEETNNESKKQSLVKRNTF-EFIMGKPKLWLRLIIGMMIMAFQQLSGINYFF 361

Query: 348 YYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVF 407
           YYGT++F  VG+KD + TSI+L  VNF ST +G+Y VE++G + CLL+GS  +    + +
Sbjct: 362 YYGTSVFKGVGIKDPYITSIILSSVNFLSTILGIYYVEKWGHKTCLLYGSTNLLFYMMTY 421

Query: 408 ASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRA 467
           A+VG       G++   S      +I               P+ +V+VSE +PLR +  +
Sbjct: 422 ATVGTF-----GRETDFSNI---VLIIVTCCFIFWFAITLGPVTFVLVSELFPLRTRAIS 473

Query: 468 MAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEV 527
           MA+    NW++ F I   TP I S I F  GY+F  CL            ET+    +E+
Sbjct: 474 MAICTFINWMFNFLISLLTPMIVSKIDFKLGYIFAACLLALIIFSWILVPETRKKNEQEI 533

Query: 528 NEMYQ 532
           N++++
Sbjct: 534 NKIFE 538

>Kwal_56.24841
          Length = 511

 Score =  319 bits (817), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/486 (36%), Positives = 269/486 (55%), Gaps = 33/486 (6%)

Query: 72  LMVAFGGFVFGWDTGTISGFVNMTDFKRRF---GNFDVGEQKYVLSDVRTGLIVSIFNIG 128
           L VAFGG +FG+DTGTISG + M   K  F   G+F  GE         T LI SI + G
Sbjct: 27  LFVAFGGILFGYDTGTISGILAMDHVKTTFTDRGHFTAGE---------TSLITSILSAG 77

Query: 129 CAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIA 188
              G ++   + D  GRR GL+   +++ +G+I+Q+A++ +     +GR+++G+GVG ++
Sbjct: 78  TFFGSMSAPLVSDNLGRRYGLIVSTVIFTIGVILQVAATTQ-ELLIVGRVIAGVGVGVLS 136

Query: 189 VLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLW 248
            + P   SE APK +RG  VS YQ  IT+G+ +  C N GT   +++  +++PL + FLW
Sbjct: 137 AIVPLYQSEAAPKWIRGAVVSAYQWAITIGLLLAACVNQGTHARNDSGSYRIPLAIQFLW 196

Query: 249 AIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKL 308
           AI M  GM F+PESPR+ ++KG   EA  ++++   L  +D  V AE+E I A    EK 
Sbjct: 197 AIIMFIGMCFLPESPRFYVKKGKVPEALSALSRLRGLPKDDPAVEAELEEILANYNYEKS 256

Query: 309 AGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIV 368
            G+ +  + F P     +R+ +G  IQ+LQQLTG N+ FYYGT  F   G+++ F   ++
Sbjct: 257 FGSTTVWDCFRPANHQSKRMFIGIAIQALQQLTGINFIFYYGTQFFQHSGIRNPFVIQLI 316

Query: 369 LGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSA 428
           + +VN   T  G+  +E  GRR  LLWG+  M V  ++ ASVG          +P S +A
Sbjct: 317 MNIVNVIFTIPGIALIELAGRRNLLLWGAIGMCVSEIIVASVGTA--------LPDSTAA 368

Query: 429 GNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPF 488
              +I             W P+A+V++ E YPLRV+ +++A    SNW++ FAI + TP+
Sbjct: 369 NKTLIAFSCTFIASFAATWGPLAWVVIGEIYPLRVRGKSVAFCTASNWLFNFAIAYATPY 428

Query: 489 IT--------SAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKS 540
           +         S + F +G    GC             ETKGLTLE+V+E++  G     S
Sbjct: 429 LVDEDRANLQSKVFFIWG----GCTFLCFIFVYFCVYETKGLTLEQVDELFDSGASARTS 484

Query: 541 ETWVPA 546
           + ++P+
Sbjct: 485 KRFIPS 490

>CAGL0M04103g 452677..454272 similar to sp|P42833 Saccharomyces
           cerevisiae YNL318c HXT1 hexose transport protein,
           hypothetical start
          Length = 531

 Score =  315 bits (807), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/526 (34%), Positives = 280/526 (53%), Gaps = 21/526 (3%)

Query: 22  SSPTD-FDSQSRTPSNKLSEDGFATKTTSPLEN-NEIPQKPLSEYILVMCLCLMVAFGGF 79
           SSPT+ +   +          G +   T P E   E+  K + ++   + LC +++FGG 
Sbjct: 13  SSPTENYTLNTAETRQSFQLSGKSEVNTIPGEKYEELKMKYIRQHTKAVVLCCLISFGGM 72

Query: 80  VFGWDTGTISGFVNMTDFKRRFGN-FDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGR 138
           + GWD GT+ G   M  F   FG+   +      LS+++ GL +SIFNIGCA+GG+   R
Sbjct: 73  ILGWDIGTVGGVSIMPSFNNAFGDQTTIVSSAKELSNMKRGLYISIFNIGCALGGIMFSR 132

Query: 139 LGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISET 198
           L +  GRR+G++  I  Y + + +Q+ S+  +      R V G+ VG I+VL P  +SE+
Sbjct: 133 LSNTVGRRVGILTAIAKYTLVLTVQLFSNGNFILLLASRFVLGVTVGAISVLVPMFVSES 192

Query: 199 APKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTY------SNAVQWKLPLGLCFLWAIFM 252
           AP  +RG  V  YQL ITLGI  G   NY T  +       N + WK+P+   +LWA  +
Sbjct: 193 APIKIRGALVVVYQLAITLGILFGNILNYMTNKHLSMVDPMNNMAWKIPMLFGYLWAAIV 252

Query: 253 IAGMIFVPESPRYLIE-KGNFEEAKRSIAKSNKLTVEDSGVLAEVE--LINAGVEAEKLA 309
             G    PES  +L + + ++E AK S +  N ++V D   +  V   L+   V  E   
Sbjct: 253 AVGACITPESVHFLAKIRNDYESAKISYSIMNNISVFDHETIDYVNNLLVKQDVYNENDL 312

Query: 310 GNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVL 369
            N  + E    K K  +R+++G ++ + QQL+G NYFFYYGT++F +VG+KD++ T+I+L
Sbjct: 313 RNHKF-EFLYGKPKYGKRLLIGIMVMAFQQLSGINYFFYYGTSLFKSVGIKDTYATAIIL 371

Query: 370 GVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAG 429
             VNF STF G+Y VE  GRR  L++GS  M +C + +AS G   L    KD+ S     
Sbjct: 372 SSVNFISTFAGIYLVESLGRRSTLIYGSFGMFICMIFYASFGTLSL---RKDLLSF---- 424

Query: 430 NAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFI 489
             +I               P+++V+V+E +P R ++ +M++    NW+  FAI   TP I
Sbjct: 425 -VLIIVTCLFISIFAITIGPVSFVVVAELFPTRTRSVSMSICSSFNWLVNFAIALATPVI 483

Query: 490 TSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGV 535
            + IGF YG+ F GCL            ETK  T EE++ M+Q  +
Sbjct: 484 INRIGFLYGFFFAGCLLLATGFEAFFVPETKNKTEEEIDYMFQNNL 529

>Kwal_27.9678
          Length = 513

 Score =  308 bits (790), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 177/501 (35%), Positives = 273/501 (54%), Gaps = 34/501 (6%)

Query: 72  LMVAFGGFVFGWDTGTISGFVNMTDFKRRF---GNFDVGEQKYVLSDVRTGLIVSIFNIG 128
           L VAFGG +FG+DTGTISG + M   K+ F   G+F   E         T LI +I + G
Sbjct: 26  LFVAFGGILFGYDTGTISGVLAMDYVKQHFTSRGHFTADE---------TSLITAILSAG 76

Query: 129 CAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIA 188
              G +      D  GRRLGL+   +++ VG+++Q+A++ +      GR+++G GVG ++
Sbjct: 77  TFCGAILAPLASDTIGRRLGLILSTIIFTVGVVLQVAATGQ-DLLIAGRVIAGAGVGVLS 135

Query: 189 VLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLW 248
            + P   SE +PK +RG  VS YQ  IT+G+ +  C N GT    ++  +++PL L  LW
Sbjct: 136 AIVPLYQSEASPKWIRGAVVSCYQWAITIGLLLAACVNQGTHARQDSGSYRIPLALQLLW 195

Query: 249 AIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKL 308
           A+ +  GM+ +PESPR+ I K    EA+R+++K   L  E   V AE+E I A  + E  
Sbjct: 196 ALILFIGMVILPESPRFYIMKEKVPEARRALSKLRGLPEEHCAVEAELEEIVANYKFESS 255

Query: 309 AGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIV 368
            G+ S  + F P    L+R+++G  +Q LQQLTG N+ FYYGT  F   G+KD F   ++
Sbjct: 256 FGSNSVWDCFKPANHQLKRILIGIAVQGLQQLTGINFIFYYGTQFFQNSGIKDPFIIQLI 315

Query: 369 LGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSA 428
           + VVN   T  G+  VE  GRR  LLWG+  M V  ++ A+VG          +P S SA
Sbjct: 316 MNVVNVIMTIPGIALVEIAGRRNLLLWGAVGMCVSELIVAAVGTA--------LPDSFSA 367

Query: 429 GNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPF 488
              +I             W P+A+V+V E +PLRV+ +++A+   SNW++ FAI + TP+
Sbjct: 368 NKTLIAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAVCAASNWLFNFAIAYATPY 427

Query: 489 IT--------SAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKS 540
           +         S + F +G    GC             ETKGLTLE+++++++      +S
Sbjct: 428 LVDSEHANLQSKVFFIWG----GCTFLCFLFVYFFIYETKGLTLEQIDQLFETCPSARQS 483

Query: 541 ETWVPALRRNESYDVNETQED 561
           + ++P   R E+ +V+ +  D
Sbjct: 484 KGFIPT-ERLEAGNVSPSISD 503

>Kwal_55.20064
          Length = 238

 Score =  278 bits (711), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 135/211 (63%), Positives = 165/211 (78%), Gaps = 3/211 (1%)

Query: 34  PSNKLSEDGFATKTTSPLENNE--IPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGF 91
           P+ KL  +    +  +  ++ E  +  K   +++ V   C+MVAFGGFVFGWDTGTISGF
Sbjct: 29  PAAKLHREESHDEIDALKKDAEEQLANKKSGDFVFVSLCCIMVAFGGFVFGWDTGTISGF 88

Query: 92  VNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMA 151
           V  TDFKRRFG  +   + Y LS+VRTGL+VSIFNIGCAIGG+ LG+LG++YGRRLGL  
Sbjct: 89  VAQTDFKRRFGQTNSKGEHY-LSNVRTGLMVSIFNIGCAIGGIVLGKLGEVYGRRLGLTI 147

Query: 152 VILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFY 211
           V+++Y VGIIIQIAS +KWYQYFIGRI+SGLGVG I VLSP LISE +PKHLRGT VS Y
Sbjct: 148 VVVIYAVGIIIQIASIDKWYQYFIGRIISGLGVGAITVLSPMLISEVSPKHLRGTLVSCY 207

Query: 212 QLMITLGIFMGYCTNYGTKTYSNAVQWKLPL 242
           Q M+T GIF+GYC NYGTKTYSN+VQW++PL
Sbjct: 208 QFMVTGGIFLGYCANYGTKTYSNSVQWRVPL 238

>Scas_624.5
          Length = 798

 Score =  257 bits (657), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 155/499 (31%), Positives = 252/499 (50%), Gaps = 24/499 (4%)

Query: 60  PLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTG 119
           P+   ++   +   VA GGF+FG+DTG I+   +M   K       +    +  ++ +  
Sbjct: 105 PMRSNVMSFLVGAFVAVGGFLFGYDTGLINSLTDMAYVKSH-----LAPNHHFFTNEQMS 159

Query: 120 LIVSIFNIGCAIGGLTLGRLGDMYGRRLGLM-AVILVYVVGIIIQIASSNKWYQYFIGRI 178
           ++VS  ++G   G LT   + D YGR+  +M +  +++ +G  +Q+ASS  W    IGR+
Sbjct: 160 IVVSFLSLGTFFGALTAPVIADSYGRKATIMFSTAVIFSIGNSLQVASSG-WKLLIIGRV 218

Query: 179 VSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQW 238
           VSGLG+G I+ + P   +E A K+LRG  +S YQ  ITLG+ +    + GT+  +N   +
Sbjct: 219 VSGLGIGLISAVVPLYQAEAAKKNLRGAIISTYQCAITLGLLVSSAVSQGTQHINNPASY 278

Query: 239 KLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVEL 298
           ++P+GL ++W+ F+  GMIF+PESPRY + K + + A +S++    + ++D  +L E+  
Sbjct: 279 RIPIGLQYVWSSFLAIGMIFLPESPRYYVMKDDIDRAAKSLSFLRGVPIQDPRLLEELVE 338

Query: 299 INAGVEAEKLAGNASWGELFSP---KGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFD 355
           I A  + E   G +S  + F     + K + R+  G  IQ+ QQ +G N+ FYYG T F 
Sbjct: 339 IKATYDYEASFGPSSIWDCFKSSENRPKQVLRMFTGIAIQTFQQFSGINFIFYYGVTFFS 398

Query: 356 AVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKL 415
             G+  S+  S++   VN A    G++ VE  GRRK LL+G   ++    V A VG    
Sbjct: 399 KTGVNKSYMVSLITYAVNVAFNIPGMFLVEYLGRRKILLFGGIVVTASNFVIAGVGCRM- 457

Query: 416 YPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSN 475
                    S  A   MI             W+   +VI +E YPL V+++  A+   +N
Sbjct: 458 --------DSVVANKVMIAFICLFIASFSATWSGAVWVISAELYPLGVRSKCTAICAAAN 509

Query: 476 WIWGFAIGFGTPFIT-----SAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEM 530
           W+  F     TP+I      S +G    +++                ET GLTLEE++E+
Sbjct: 510 WLVNFICALITPYIVNSGSESTMGANIFFIWGSLNALGVVCVFFTVYETSGLTLEEIDEL 569

Query: 531 YQEGVLPWKSETWVPALRR 549
           Y+E    + S  W   +R 
Sbjct: 570 YRESANCFGSIAWNKKIRE 588

>CAGL0J09020g 887145..889715 highly similar to sp|P10870
           Saccharomyces cerevisiae YDL194w SNF3 or sp|Q12300
           Saccharomyces cerevisiae YDL138w RGT2, start by
           similarity
          Length = 856

 Score =  248 bits (632), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 162/531 (30%), Positives = 271/531 (51%), Gaps = 30/531 (5%)

Query: 41  DGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRR 100
           D  +T   + L   E PQK    +++ + +   VA GGF+FG+DTG I+  V+M   +  
Sbjct: 95  DEMSTVDDASLLFAEPPQK--QSHMMSIVVGAFVAVGGFLFGYDTGLINSIVDMRYVREN 152

Query: 101 FGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLM-AVILVYVVG 159
                VG      +  +  ++VS  ++G  +G L+   + D YGR+  +M +  +V+ +G
Sbjct: 153 IAPNHVG-----FTAQQLAILVSFLSLGTFVGALSAPVISDKYGRKKTIMFSTAVVFSLG 207

Query: 160 IIIQIASSNKWYQYFI-GRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLG 218
             +Q+ + N   Q  I GR++SGLGVG ++ + P   +E A K LRG  +S YQ  IT G
Sbjct: 208 NSLQVGAHN--IQLLIAGRVISGLGVGLVSAVVPLYQAEAAHKSLRGAIISTYQWAITWG 265

Query: 219 IFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRS 278
           + +    + GT   ++A  +++P+GL ++WA  + AGM+++PESPRY + +   ++A +S
Sbjct: 266 LLVSSAVSQGTHNRNDASSYRIPIGLQYVWAYILAAGMLWLPESPRYYVLRDQLDKAAQS 325

Query: 279 IAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELF-SPKGKILQ--RVIMGCVIQ 335
           ++    + + DSG+L E+  I A  + E   G  ++ + F S K +  Q  R+  G  IQ
Sbjct: 326 LSFLRGVPIHDSGLLEELVEIKATFDYESSFGKTTFWDCFKSNKSRPKQTLRMFTGIAIQ 385

Query: 336 SLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLW 395
           + QQ +G N+ FYYG + F+  G+++S+  S++   VN   +  G++ VE +GRR  LL+
Sbjct: 386 AFQQFSGINFIFYYGVSFFNRSGVENSYIVSLITYAVNVGFSVPGMFLVEYFGRRSVLLY 445

Query: 396 GSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIV 455
           G A M++   + A VG +           S  A   MI             W  + +VI 
Sbjct: 446 GGAIMTLSNFIIAIVGSST---------QSVVANKVMIAFICLFIASFAATWGGVVWVIS 496

Query: 456 SETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSA------IGFYYGYVFMGCLXXXX 509
           +E YPL V+ +  A+   +NW+  F   F TP+I         IG    +++        
Sbjct: 497 AELYPLGVRAKCTAICAAANWLINFVCAFITPYIVDTGERRALIGPKIYFIWGSLNALGI 556

Query: 510 XXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALR-RNESYDVNETQ 559
                   ET+GLTLEE++E+Y +      S  W   +R R ++Y   E Q
Sbjct: 557 LVVYFTVYETRGLTLEEIDELYTKSPNGIVSAKWNRRIRHREKTYGHKEQQ 607

>YDL194W (SNF3) [679] chr4 (111581..114235) High-affinity glucose
           sensor responsible for induction of gene expression in
           the presence of low glucose, member of the glucose
           sensor subfamily of the hexose transporter family of the
           major facilitator superfamily (MFS) [2655 bp, 884 aa]
          Length = 884

 Score =  247 bits (630), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 158/540 (29%), Positives = 272/540 (50%), Gaps = 36/540 (6%)

Query: 11  RSNSNTE------LAAVSSPTDFDSQSRTPSNKLSE---DGFATKTTSPLENNEIPQKPL 61
           R+NSN +        ++ +PT    Q+    + ++    D  +T   + +  +E PQK  
Sbjct: 34  RNNSNKDHTTDDTTGSIRTPTSLQRQNSDRQSNMTSVFTDDISTIDDNSILFSEPPQK-- 91

Query: 62  SEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLI 121
              ++ +C+ + VA GGF+FG+DTG I+   +M   K       V       +  +  ++
Sbjct: 92  QSMMMSICVGVFVAVGGFLFGYDTGLINSITSMNYVKSH-----VAPNHDSFTAQQMSIL 146

Query: 122 VSIFNIGCAIGGLTLGRLGDMYGRRLGLM-AVILVYVVGIIIQIASSNKWYQYFIGRIVS 180
           VS  ++G   G LT   + D YGR+  ++ + I ++ +G  +Q+ +        +GR++S
Sbjct: 147 VSFLSLGTFFGALTAPFISDSYGRKPTIIFSTIFIFSIGNSLQVGAGGITL-LIVGRVIS 205

Query: 181 GLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKL 240
           G+G+G I+ + P   +E   K LRG  +S YQ  IT G+ +    + GT   ++A  +++
Sbjct: 206 GIGIGAISAVVPLYQAEATHKSLRGAIISTYQWAITWGLLVSSAVSQGTHARNDASSYRI 265

Query: 241 PLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELIN 300
           P+GL ++W+ F+  GM F+PESPRY + K   +EA +S++    + V DSG+L E+  I 
Sbjct: 266 PIGLQYVWSSFLAIGMFFLPESPRYYVLKDKLDEAAKSLSFLRGVPVHDSGLLEELVEIK 325

Query: 301 AGVEAEKLAGNASWGELF-SPKGKILQ--RVIMGCVIQSLQQLTGNNYFFYYGTTIFDAV 357
           A  + E   G++++ + F S K +  Q  R+  G  +Q+ QQ +G N+ FYYG   F+  
Sbjct: 326 ATYDYEASFGSSNFIDCFISSKSRPKQTLRMFTGIALQAFQQFSGINFIFYYGVNFFNKT 385

Query: 358 GMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYP 417
           G+ +S+  S +   VN      GL+ VE +GRRK L+ G   M++   + A VG +    
Sbjct: 386 GVSNSYLVSFITYAVNVVFNVPGLFFVEFFGRRKVLVVGGVIMTIANFIVAIVGCSL--- 442

Query: 418 NGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWI 477
                  + +A   MI             W  + +VI +E YPL V+++  A+   +NW+
Sbjct: 443 ------KTVAAAKVMIAFICLFIAAFSATWGGVVWVISAELYPLGVRSKCTAICAAANWL 496

Query: 478 WGFAIGFGTPFI------TSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 531
             F     TP+I      TS++G    +++                ETKGLTLEE++E+Y
Sbjct: 497 VNFICALITPYIVDTGSHTSSLGAKIFFIWGSLNAMGVIVVYLTVYETKGLTLEEIDELY 556

>CAGL0I03872g 337985..340273 some similarities with sp|Q12300
           Saccharomyces cerevisiae YDL138w RGT2 or sp|P10870
           Saccharomyces cerevisiae YDL194w SNF3, hypothetical
           start
          Length = 762

 Score =  244 bits (622), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 150/488 (30%), Positives = 254/488 (52%), Gaps = 26/488 (5%)

Query: 72  LMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAI 131
           L VA GGF++G+DTG I+   +M   K       +       +  +  ++VS  ++G  +
Sbjct: 121 LFVAVGGFLYGYDTGLINSITDMKYVKEH-----IAPNHSFFTTTQISMLVSFLSLGTFV 175

Query: 132 GGLTLGRLGDMYGRRLGLM-AVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVL 190
           G L    + D+YGR+  ++ + ++++ +G  +Q+A+        +GR++SG+G+G I+ +
Sbjct: 176 GALIAPWISDIYGRKSTIIFSTMIIFSIGNSLQVAAGG-LALLIVGRVISGIGIGIISAV 234

Query: 191 SPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAI 250
            P   +E A KH+RG  ++ YQL ITLG+ +    + GT++ +    +++P+GL ++W++
Sbjct: 235 VPLYQAEAAQKHMRGAIITTYQLAITLGLLVSSAVSQGTESINAPSSYRVPIGLQYVWSV 294

Query: 251 FMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAG 310
            +  GM+F+PESPRY I K   EEA RS++    +++ED  +L E+  I A  + E   G
Sbjct: 295 VLGVGMVFLPESPRYYIMKDEIEEAARSLSFLRGISLEDPRLLEELVEIKANYDYESSFG 354

Query: 311 NASWGELF---SPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSI 367
             S  + F     + K + R+  G  IQ+ QQ +G N+ FYYG   F+  G+K S+  S 
Sbjct: 355 PVSIWDCFRSSEQRPKQVLRMFTGISIQAFQQFSGINFIFYYGVYFFNKTGIKSSYLVSF 414

Query: 368 VLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKS 427
           V   VN A    G++ ++  GRRK L++G  AM+ C  + A VGV+           S  
Sbjct: 415 VTYAVNVAFNIPGMFLIDYLGRRKVLIFGGIAMTACNFIIAIVGVSA---------KSIV 465

Query: 428 AGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTP 487
           + N MI             W  + +VI +E +PL V+++  A+   +NW+  F     TP
Sbjct: 466 SNNVMIAFICVFIAAFSSTWGGVVWVISAELFPLGVRSKCTAICAAANWLVNFVCALMTP 525

Query: 488 FI-------TSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKS 540
           +I       TS++G    +++                ET+GLTLEE+NE+Y     P+ S
Sbjct: 526 YIVDTGSNYTSSMGTKIYFIWGSLNALGTIVAYLTVYETRGLTLEEINELYVNSPTPFAS 585

Query: 541 ETWVPALR 548
             W   +R
Sbjct: 586 NEWNRKIR 593

>Kwal_56.24469
          Length = 709

 Score =  241 bits (616), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 160/504 (31%), Positives = 252/504 (50%), Gaps = 26/504 (5%)

Query: 57  PQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDV 116
           P +P S  ++ + + + VA GGF++G+DTG I+    M   K  F      E K   +  
Sbjct: 81  PSRPQSS-LMSILVGVFVAVGGFLYGYDTGLINNITEMKYVKTHFA-----ENKQQFTAK 134

Query: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLM-AVILVYVVGIIIQIASSNKWYQYFI 175
              ++VS  ++G   G L    + D +GR+  ++ +   V++VG  +Q+A+ N      I
Sbjct: 135 EMSILVSFLSLGTFFGALVAPFMSDTWGRKTTIIFSTFFVFMVGNSLQVAA-NGTTLLVI 193

Query: 176 GRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNA 235
           GR+ SG+GVG I+ + P   SE A K +RG  +S YQ  IT G+ +    + GT    + 
Sbjct: 194 GRVFSGVGVGFISAVVPLYQSEAAQKRVRGAIISTYQWAITWGLLVSSAVSQGTHNRMDP 253

Query: 236 VQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAE 295
             +++P+GL F+W+  +  GMIF+PESPRY + K   + A +S+A    +  +DSG+L E
Sbjct: 254 SSYRIPIGLQFVWSCILGFGMIFLPESPRYYVLKDQLDRAAKSLAFLRGVPEDDSGLLEE 313

Query: 296 VELINAGVEAEKLAGNASWGELF-SPKGKILQRVIM--GCVIQSLQQLTGNNYFFYYGTT 352
           +  I A  + E   G+ S+ + F S K +  QR+ M  G  IQ+ QQL+G N+ FYYG  
Sbjct: 314 LVEIKANYDYEMSFGSFSYLDCFRSSKSRTKQRLRMLTGIAIQAFQQLSGINFIFYYGVN 373

Query: 353 IFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGV 412
            F   G+ DS+  S V   VN      GL+ VE  GRRK L++G   M+    V A VG 
Sbjct: 374 FFSKSGVGDSYLVSFVTYAVNVGFNIPGLFLVEYMGRRKVLIFGGVLMTAANFVIAIVGC 433

Query: 413 TKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAV 472
            +          S  A   MI             W    + I +E YPL V+++  A+  
Sbjct: 434 VE---------RSVIADKIMIAFVCVFIASFSATWGGCVWAISAELYPLGVRSKCTAICA 484

Query: 473 GSNWIWGFAIGFGTPFI------TSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEE 526
            SNW+  F     TP+       TS++G    +++ G              ET+GLTLEE
Sbjct: 485 ASNWLVNFICAMITPYFIHTGAHTSSLGTKVFFIWGGLNAIGVVVVYLTVYETRGLTLEE 544

Query: 527 VNEMYQEGVLPWKSETWVPALRRN 550
           ++ +Y+     + S++W   +R++
Sbjct: 545 IDLLYRLSPNCFTSDSWNVKIRKS 568

>YDL138W (RGT2) [730] chr4 (213352..215643) Low-affinity glucose
           sensor responsible for induction of gene expression in
           the presence of high glucose, member of the glucose
           sensor subfamily of the hexose transporter family of the
           major facilitator superfamily (MFS) [2292 bp, 763 aa]
          Length = 763

 Score =  235 bits (600), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 163/550 (29%), Positives = 284/550 (51%), Gaps = 29/550 (5%)

Query: 11  RSNSNTELAAVSSPTDFDS-QSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMC 69
            S ++TE  ++    D ++ Q    +N+ + DG A +TTS L +  +P   L   ++ + 
Sbjct: 46  ESTNDTEAKSIVMCDDPNAYQISYTNNEPAGDG-AIETTSILLSQPLP---LRSNVMSVL 101

Query: 70  LCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGC 129
           + + VA GGF+FG+DTG I+   +M   K       +       +  +  ++VS  ++G 
Sbjct: 102 VGIFVAVGGFLFGYDTGLINSITDMPYVKTY-----IAPNHSYFTTSQIAILVSFLSLGT 156

Query: 130 AIGGLTLGRLGDMYGRRLGLM-AVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIA 188
             G L    + D YGR+  +M +  +++ +G  +Q+AS        +GR++SG+G+G I+
Sbjct: 157 FFGALIAPYISDSYGRKPTIMFSTAVIFSIGNSLQVASGG-LVLLIVGRVISGIGIGIIS 215

Query: 189 VLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLW 248
            + P   +E A K+LRG  +S YQ  IT+G+ +    + GT + +    +++P+GL ++W
Sbjct: 216 AVVPLYQAEAAQKNLRGAIISSYQWAITIGLLVSSAVSQGTHSKNGPSSYRIPIGLQYVW 275

Query: 249 AIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKL 308
           +  +  GMIF+PESPRY + K    +A +S++    L +ED  +L E+  I A  + E  
Sbjct: 276 SSILAVGMIFLPESPRYYVLKDELNKAAKSLSFLRGLPIEDPRLLEELVEIKATYDYEAS 335

Query: 309 AGNASWGELFSP---KGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQT 365
            G ++  + F     + K + R+  G  IQ+ QQ +G N+ FYYG   F+  G+ +S+  
Sbjct: 336 FGPSTLLDCFKTSENRPKQILRIFTGIAIQAFQQASGINFIFYYGVNFFNNTGVDNSYLV 395

Query: 366 SIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSS 425
           S +   VN A +  G+Y V+R GRR  LL G   M++  +V A VGV++    GK + +S
Sbjct: 396 SFISYAVNVAFSIPGMYLVDRIGRRPVLLAGGVIMAIANLVIAIVGVSE----GKTVVAS 451

Query: 426 KSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFG 485
           K     MI             W  + +V+ +E YPL V+++  A+   +NW+  F     
Sbjct: 452 K----IMIAFICLFIAAFSATWGGVVWVVSAELYPLGVRSKCTAICAAANWLVNFTCALI 507

Query: 486 TPFI------TSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWK 539
           TP+I      TS++G    +++ G              ET+GLTLEE++E++++      
Sbjct: 508 TPYIVDVGSHTSSMGPKIFFIWGGLNVVAVIVVYFAVYETRGLTLEEIDELFRKAPNSVI 567

Query: 540 SETWVPALRR 549
           S  W   +R+
Sbjct: 568 SSKWNKKIRK 577

>KLLA0F05181g 510384..512747 gi|2440082|emb|CAA75114.1 Kluyveromyces
           lactis putative glucose sensor, start by similarity
          Length = 787

 Score =  226 bits (577), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 164/558 (29%), Positives = 270/558 (48%), Gaps = 34/558 (6%)

Query: 3   SSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLS 62
           SS  P   +SN+    +A SSP +    S           FA+ +    E    P    S
Sbjct: 32  SSEVPTGGKSNN---ASATSSPEEALENS---GENFELTNFASLSEMESEIFLAPPAKQS 85

Query: 63  EYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIV 122
           + I ++ + + VA GGF+FG+DTG I+    M    ++F        K   +  +  ++V
Sbjct: 86  KKISIL-VGMFVAVGGFLFGYDTGLINNISEMPYVNQKFA-----PNKNHFTTPQISILV 139

Query: 123 SIFNIGCAIGGLTLGRLGDMYGRRLGLM-AVILVYVVGIIIQIASSNKWYQYFIGRIVSG 181
           S  ++G  IG L    + D YGR+  ++ +  +V+++G  +Q+A+ +      +GR++SG
Sbjct: 140 SFLSLGTFIGALLAPLISDSYGRKTTMIFSTFVVFMIGNSLQVAAGSMTI-LVVGRVLSG 198

Query: 182 LGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLP 241
           + VG I+   P   SE A K +RG  +S YQ  IT G+ +    + GT    +A  +++P
Sbjct: 199 MSVGLISAAVPLYQSEAAQKSVRGAIISCYQWAITWGLLVASAVSQGTYKRMDASSYQIP 258

Query: 242 LGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINA 301
           +GL ++W+  +  G++F+PESPRY + K   ++A +S++    +  +DSG+L E+  I A
Sbjct: 259 IGLQYIWSFLLGVGILFLPESPRYYVFKDRLDKAAKSLSFLRGVPEDDSGLLEELVEIKA 318

Query: 302 GVEAEKLAGNASWGELF-SPKGKILQRVIM--GCVIQSLQQLTGNNYFFYYGTTIFDAVG 358
             + E   G  S+ + F S + +  QR+ M  G  +Q+ QQ++G N+ FYYG   F+  G
Sbjct: 319 TYDYEMSFGKISYLDCFRSTRSRTKQRLRMLTGIALQAFQQVSGINFIFYYGVDFFNKSG 378

Query: 359 MKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPN 418
           + +S+  S V   VN A    GL+ VE  GRRK LL G   M++   + A VG+      
Sbjct: 379 VSESYLVSFVTYAVNVAFNIPGLFLVEYIGRRKLLLMGGILMTISNFIIAIVGLAT---- 434

Query: 419 GKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIW 478
                 S  A   MI             W    +VI +E YPL V+ +  A+   SNW+ 
Sbjct: 435 -----DSMVANKVMIAFICLFIASFSATWGGGVWVISAELYPLGVRAKCTAICAASNWLI 489

Query: 479 GFAIGFGTPFI--------TSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEM 530
            F     TP+I         ++IG    +V+                ET GL+LEE++E+
Sbjct: 490 NFICALITPYIMHIDSSVRQTSIGTKIFFVWGSLNAVGVLVVYFTVYETNGLSLEEIDEL 549

Query: 531 YQEGVLPWKSETWVPALR 548
           Y++      S  W   ++
Sbjct: 550 YKKSSSGINSIEWNKKIK 567

>ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W
           (RGT2) - SH] complement(872925..874919) [1995 bp, 664
           aa]
          Length = 664

 Score =  224 bits (571), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 148/500 (29%), Positives = 246/500 (49%), Gaps = 30/500 (6%)

Query: 72  LMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAI 131
           + VA GGF++G+DTG I+    M+  K+ F    V       + +   ++VS  ++G  I
Sbjct: 98  IFVAVGGFLYGYDTGLINSITEMSFVKKHFAPNHVN-----FTSMEMSILVSFLSLGTFI 152

Query: 132 GGLTLGRLGDMYGRRLGLM-AVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVL 190
           G L    L D YGR+  ++ +  ++++ G ++Q+ S+        GR+ SG+ VG I+V+
Sbjct: 153 GALAAPLLADSYGRKSTVIFSTFIMFLEGTLLQV-SATSMALLVAGRVASGVAVGLISVV 211

Query: 191 SPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAI 250
            P    E A K  RG  +  YQ  IT G+ +    + GT   ++A  +++P+ L ++W I
Sbjct: 212 VPLYQGEAAQKWCRGAIICTYQWAITWGLLVSSAVSQGTYLRNDASSYRIPIALQYVWCI 271

Query: 251 FMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAG 310
            + +GM+ +PESPRY + +   ++A  S++    +  +D+G+L E+  I A  + E    
Sbjct: 272 ILGSGMLLLPESPRYYVLRDQLDKAALSLSFLRGVPHDDAGLLEELVEIKANYDYEMSLK 331

Query: 311 NASWGELF-----SPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQT 365
           ++S+ + F      PK +I  R++ G ++Q+ QQ +G N+ FYYG   F + G+  S+  
Sbjct: 332 SSSYLDCFRTSEHRPKQQI--RMLSGILLQAFQQFSGINFIFYYGVNFFSSTGISKSYLV 389

Query: 366 SIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSS 425
           S V   VN      GL+ VE  GRRK LL G   M++   + A VGV+           S
Sbjct: 390 SFVTYAVNVVFNIPGLFLVEYAGRRKLLLVGGVLMTISNFIIAIVGVST---------DS 440

Query: 426 KSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFG 485
             A   MI             W  + +V+ +E YPL V+++  A+   SNW+  F     
Sbjct: 441 VIAKKVMIVFICMFIAAFSATWGGVVWVMSAEMYPLGVRSKCAAICAASNWLVNFVCAMI 500

Query: 486 TPFI------TSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWK 539
           TP++      TS +G    +V+                ET GLTLEE+NE+Y+       
Sbjct: 501 TPYLIDISSYTSRLGSTIFFVWGSLNAIGVMVVYLTVYETSGLTLEEINELYRRCPSSLA 560

Query: 540 SETWVPALRRN-ESYDVNET 558
           S  W   ++ + E Y +  T
Sbjct: 561 SCAWNRRIKSSPEDYHLTVT 580

>Scas_701.44
          Length = 876

 Score =  221 bits (564), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 144/482 (29%), Positives = 236/482 (48%), Gaps = 29/482 (6%)

Query: 80  VFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRL 139
           +FG+DTG I+    +T+      +     +++    +   + VS  ++G   G LT    
Sbjct: 116 LFGYDTGLINS---ITEMDYVLTHLTPNHREFTTEQL--SITVSFLSLGTFFGALTAPVF 170

Query: 140 GDMYGRRLGLM-AVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISET 198
            D YGR++ +M + ++++ VG  +Q+A+ N      +GR++SG G+G I+ + P   +E 
Sbjct: 171 ADNYGRKVTIMISTLIIFSVGNSLQVAA-NGIVLLIVGRVISGFGIGIISAVVPLYQAEA 229

Query: 199 APKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIF 258
           A K LRG  +S YQ  IT G+ +      GT     A  +++P+GL ++W+  +  GMIF
Sbjct: 230 AHKSLRGAIISTYQWAITWGLLVSSAVAQGTHNRHGASSYRIPIGLQYIWSFILAFGMIF 289

Query: 259 VPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELF 318
           +PESPRY + K   ++A  S++   ++ ++DSG+L E+  I A  + E   G+  + + F
Sbjct: 290 LPESPRYYVLKDQLDKAAESLSFLRRVPIQDSGLLEELVEIKATYDYECSFGSTHFWDCF 349

Query: 319 -----SPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVN 373
                 PK K+  R+  G  IQ+ QQ +G N+ FYYG   F+  G+ +S+  S +   VN
Sbjct: 350 ISSKTRPKQKL--RMFTGIAIQAFQQFSGINFIFYYGVNFFNKTGVDNSYLVSFITYAVN 407

Query: 374 FASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMI 433
                 G+  VE  GRRK LL G   M +   + A VG T           S  A   MI
Sbjct: 408 VIFNIPGMVLVEFIGRRKVLLIGGILMLMSNFIVAIVGSTV---------ESVVADKVMI 458

Query: 434 XXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFI---- 489
                        W  + +VI +E YPL V+++  A+   +NW+  F     TP+I    
Sbjct: 459 AFICLFIASFSATWGGVVWVISAELYPLGVRSKCTAICAAANWLVNFICCLITPYIVDTG 518

Query: 490 --TSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPAL 547
             TS++G    Y++                ETKGLTLE+++E+Y        S  W   +
Sbjct: 519 SHTSSMGTKIYYIWGSLNVLGVIVVYFTVYETKGLTLEQIDELYSRASNSINSTKWNSRI 578

Query: 548 RR 549
           ++
Sbjct: 579 KK 580

>Kwal_34.16261
          Length = 327

 Score =  202 bits (513), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 145/217 (66%), Gaps = 2/217 (0%)

Query: 67  VMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFN 126
           V+  C  ++F GF FG+DTGTI G  NM  + RRFG+ DV   +Y ++    G++VS F+
Sbjct: 58  VVLSCFGISFTGFFFGYDTGTIGGITNMQAWLRRFGHLDVESGEYHMATALVGIVVSAFH 117

Query: 127 IGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQI-ASSNKWYQYFIGRIVSGLGVG 185
           IGC IGG T+ RL D  GRR+ +    ++Y++GI IQ+ A  +KWYQ+ IGR+V+GL VG
Sbjct: 118 IGCIIGGFTIARLADHLGRRIPIAIACIIYMIGISIQMSAGQDKWYQFMIGRMVTGLTVG 177

Query: 186 GIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTK-TYSNAVQWKLPLGL 244
             AVLSP L+SE AP  +RG  V+FYQ+ +T GI +GY   Y TK TYS+   W+LPL  
Sbjct: 178 ANAVLSPMLLSEIAPPGIRGLFVNFYQVNVTHGILVGYIVVYATKSTYSDDRMWRLPLIG 237

Query: 245 CFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAK 281
            F++++ ++  +   PESPRYLI++  FE+AK   A+
Sbjct: 238 GFVFSMIILPLLARAPESPRYLIKRCRFEDAKCVFAR 274

>Scas_637.9
          Length = 607

 Score =  174 bits (441), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 154/575 (26%), Positives = 256/575 (44%), Gaps = 82/575 (14%)

Query: 28  DSQSRTPSNKLSE--------DGFATKTTSPLENNEIPQKPLSEY--------------I 65
           D+ S T SN + E        + F  +T    EN+ I  KP+++                
Sbjct: 49  DTSSSTQSNLIVEGTQSRQDINSFDHETDDENENDRIVIKPVNDEDDTSVIITFNQGISA 108

Query: 66  LVMCLCLMVAFGGFVFGWDTGTIS-GFVNM-TDFKRRFGNFDVGEQKYVLSDVRTGLIVS 123
            ++ L  + +  GF+FG+DTG IS   V++ TD   +           VLS     +I +
Sbjct: 109 FIITLTFVASISGFMFGYDTGYISSALVSIGTDLDNK-----------VLSYGDKEIITA 157

Query: 124 IFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLG 183
             ++G  I     G   D++GRR  LM   +++V+G I+QI +++K++Q  +GR++ G G
Sbjct: 158 ATSLGALITSTMAGTAADIFGRRPCLMFSNVMFVIGAILQI-TAHKFWQMAVGRLIMGFG 216

Query: 184 VGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLG 243
           VG  +++SP  ISE APK +RG       L +T G  + Y    G    +N   W++ +G
Sbjct: 217 VGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNG--WRILVG 274

Query: 244 LCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVED--SGVLAEVELINA 301
           L  +  +   +  +F+P++PRY + KG +++AK  + +S K   +D     + E+  +N 
Sbjct: 275 LSLIPTVLQFSFFLFLPDTPRYYVMKGRYDDAKSVLHRSYKGASDDIIERKVEELRELNH 334

Query: 302 GVEAEKLAGNASWGELFSPKGKILQRV-------IMGCVIQSLQQLTGNNYFFYYGTTIF 354
            +E + +       + F    K L RV       I+ C +Q++QQ TG N   Y+  TIF
Sbjct: 335 SIEGKNIP------QRFWNTVKELHRVPSNFRALIIACGLQAIQQFTGWNSLMYFSGTIF 388

Query: 355 DAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWG----SAAMSVCFVVFASV 410
           + VG  +S   SI++   NF  T V  + +++ GRR  LL G    + +++VC + F  +
Sbjct: 389 ETVGFSNSSAVSIIVSGTNFIFTLVAFFAIDKIGRRYILLIGLPGMTGSLTVCAIAFHFI 448

Query: 411 GVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVI---VSETYPLRVKNRA 467
           G+      G D   S S   A               +A     +    SE +P  V+   
Sbjct: 449 GIRF---EGNDAVVSHSGFTAWGIVIIVFIIVFAAFYALGIGTVPWQQSELFPQNVRGVG 505

Query: 468 MAMAVGSNWIWGFAIGFG--------TPFITSAIGFYYGYVFMGCLXXXXXXXXXXXC-- 517
            + A  +NW     I           TP  T    F+ G  F+  +           C  
Sbjct: 506 TSYATATNWAGSLVIASTFLTMLQNITP--TGTFAFFAGLSFVSTI-------FCYFCYP 556

Query: 518 ETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNES 552
           E  GL LEEV  + ++G     S+T     ++  S
Sbjct: 557 ELSGLELEEVQTILKDGFNIKASQTLAKKRKQQVS 591

>Kwal_34.16190
          Length = 556

 Score =  172 bits (436), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 136/506 (26%), Positives = 224/506 (44%), Gaps = 28/506 (5%)

Query: 72  LMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAI 131
           L+    G +FG+D  ++S  +   +++  FG        Y  S  + G I    + G  +
Sbjct: 34  LVACISGLMFGFDISSMSSMIGTPEYREHFG--------YPGSTAQGG-ITGAMSGGSLL 84

Query: 132 GGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLS 191
           G L      D +GRR+ L     +++ G IIQ A+ N+     +GR++ G+GVG  + ++
Sbjct: 85  GSLVSPNFTDAFGRRVSLHLCAALWIAGAIIQCAAQNRG-MLIVGRVIGGMGVGFGSSVA 143

Query: 192 PTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIF 251
           P   SE AP ++RGT    +Q  +TLGI + +   YG         +++  G+  +  + 
Sbjct: 144 PVYCSEVAPPNIRGTVCGLFQFSVTLGIMILFYVGYGCHFIHGTAAFRITWGVQIVPGLA 203

Query: 252 MIAGMIFVPESPRYLIEKGNFEEAKRSIAK-SNKLTVEDSGVLAEVELINAGVEAEKLAG 310
           ++    F+PESPR+L     +EEA   +A+      V+D  V  ++E I   V  ++ A 
Sbjct: 204 LLVAAFFLPESPRWLANNDRWEEASEVVARIGANGDVDDPRVQIQLEEIKEQVILDQQAL 263

Query: 311 NASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDS--FQTSIV 368
              +  LF  + K L ++++G   Q  QQL G N   YY   IF   G   S    +  +
Sbjct: 264 GFGYRHLF--REKTLNKIVVGVCAQMWQQLCGMNVMMYYIVYIFQMAGYSGSRVLVSGSI 321

Query: 369 LGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASV--GVTKLYPNGKD----- 421
             V+N   T   L+ V++ GRR  L+ G   M +   V A +    T   PNG +     
Sbjct: 322 QYVLNVVMTIPALFLVDKVGRRPVLIVGGIFMFIWLFVVAGLLANYTVPSPNGFEGDETV 381

Query: 422 ---MPS-SKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWI 477
              +PS +KSA   +I             W    ++  SE +    + R  A+    NW 
Sbjct: 382 RIRIPSYNKSAAKGVIAASYLFVCSFAPSWGIGIWIYCSEIFNNMERARGSALCTSVNWG 441

Query: 478 WGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXC-ETKGLTLEEVNEMYQEGVL 536
           + FA+    P     I  +  Y+  G               ETKG TLEE+++M+ + V 
Sbjct: 442 FNFALALFVPSAFRNIS-WKTYIIFGVFSVVLTIQTFLMFPETKGKTLEEIDQMWADHVP 500

Query: 537 PWKSETWVPALRRNESYDVNETQEDS 562
            WK+ ++VP +      D N+    S
Sbjct: 501 AWKTASYVPDVPFARDEDGNKLAPKS 526

>AEL042C [2464] [Homologous to ScYOL156W (HXT11) - SH]
           (557191..558834) [1644 bp, 547 aa]
          Length = 547

 Score =  169 bits (429), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 123/500 (24%), Positives = 226/500 (45%), Gaps = 34/500 (6%)

Query: 64  YILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVS 123
           Y++ +  C+     G +FG+D  ++S   +   +K  F + +         ++  G I +
Sbjct: 29  YLVAVVACI----SGMMFGFDISSMSSMQDFEPYKDYFKHPN---------ELTQGGITA 75

Query: 124 IFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLG 183
               G  +G +    + D +GRR+ L     ++++G ++Q A+ N+    F+GRIV+GLG
Sbjct: 76  SMAAGSLLGSILSPGISDAFGRRVSLHMCSSLWIIGAVLQTAAQNQ-AMLFVGRIVAGLG 134

Query: 184 VGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLG 243
           VG  + ++P   +E +P  +RG     +QL +T+GI + +   YG+ + ++   +++   
Sbjct: 135 VGFGSSVAPVYTAEVSPPKIRGAVGGLFQLSVTVGILVMFLIGYGSVSLNSVASFRVAWS 194

Query: 244 LCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNK-LTVEDSGVLAEVELINAG 302
           +  +  + ++     +PESPR+L   G ++E    + K  + + V D  +   +  I   
Sbjct: 195 MQLVPGVVLLLATFLLPESPRWLANHGRWDETTLVVEKVGRSVNVSDEELRIHINEIRER 254

Query: 303 VEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGM--K 360
           V  +++A + ++ +LF  + K  +++ +G   Q  QQL G N   YY   +F   G    
Sbjct: 255 VALDEMARDFTYADLF--RRKTQRKIFIGMAAQMWQQLCGMNVMMYYIVHVFKMAGFSGN 312

Query: 361 DSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLY---- 416
            +  +SIV  V+N   T   L+ V+R GRR  L+ G   M     ++A  G+   Y    
Sbjct: 313 QNLVSSIVQYVLNVGMTIPSLFLVDRAGRRPVLIIGGVLMFTW--LYAVAGILATYSVPR 370

Query: 417 PNGKD---------MPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRA 467
           PNG +          P   SA  A+I             W    +V  +E +    + R 
Sbjct: 371 PNGVEGNTTVRIEIPPERSSAAKAVIVCSYLFVCSFAPTWGIGIWVYCAEIFNNIERARG 430

Query: 468 MAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEV 527
            A+    NW + FA+    P     I +    +F                ETKG TLEE+
Sbjct: 431 SALCTSVNWAFNFALAMFVPTAFKNITWRTYIIFGTFSVALTIHAFLSFPETKGKTLEEI 490

Query: 528 NEMYQEGVLPWKSETWVPAL 547
           +EM+   +  W++ ++ P L
Sbjct: 491 DEMWDAHIPAWRTASYKPEL 510

>KLLA0A11110g 964084..965739 gi|1346290|sp|P49374|HGT1_KLULA
           Kluyveromyces lactis High-affinity glucose transporter,
           start by similarity
          Length = 551

 Score =  167 bits (424), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 128/499 (25%), Positives = 222/499 (44%), Gaps = 32/499 (6%)

Query: 64  YILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVS 123
           Y++    C+     G +FG+D  ++S  +    +K  F N D          +  G I +
Sbjct: 29  YVIGFIACI----SGLMFGFDIASMSSMIGTDVYKDYFSNPD---------SLTYGGITA 75

Query: 124 IFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLG 183
               G  +G L      D +GR++ L     ++++G I+Q A+ ++     +GR++SG+G
Sbjct: 76  SMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMG 134

Query: 184 VGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLG 243
           +G  +  +P   SE +P  +RGT    +Q  +T+GI + +   YG      A  +++  G
Sbjct: 135 IGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWG 194

Query: 244 LCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAK-SNKLTVEDSGVLAEVELINAG 302
           L  +  + ++ G+ F+PESPR+L     +EE    +A       V +  V  ++E I   
Sbjct: 195 LQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ 254

Query: 303 VEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGM--K 360
           V  +  A N  + +LF  + K L + I+G   Q  QQL G N   YY   IF+  G    
Sbjct: 255 VIIDSAAKNFGYKDLF--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGN 312

Query: 361 DSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYP--- 417
            +   S +  V+N   T   L+ ++++GRR  L+ G   M       A +  T   P   
Sbjct: 313 TNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPG 372

Query: 418 --NGKD-----MPS-SKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMA 469
             NG D     +PS + SA N +I             W    ++  SE +    + +  A
Sbjct: 373 GVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSA 432

Query: 470 MAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXC-ETKGLTLEEVN 528
           ++  +NW + FA+    P     I  +  Y+  G               ETKG TLEE++
Sbjct: 433 LSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID 491

Query: 529 EMYQEGVLPWKSETWVPAL 547
           +M+ + +  W++  ++P L
Sbjct: 492 QMWVDNIPAWRTANYIPQL 510

>Kwal_33.14911
          Length = 570

 Score =  167 bits (422), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 131/509 (25%), Positives = 236/509 (46%), Gaps = 33/509 (6%)

Query: 61  LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGL 120
           LS   L + + L    G  +FG+D G +SG +   +F   F      +++   + +  G 
Sbjct: 15  LSGRSLRLAITLTSVIGFSLFGYDQGLMSGLITGEEFNSEFPATGGSDRR---TKLVQGA 71

Query: 121 IVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWY---QYFIGR 177
           + + + IGC  G L +   G+  GR+  ++   L+ ++G +I  A+    +   Q+ +GR
Sbjct: 72  VTACYEIGCFFGSLFVMFRGEQSGRKPLVIVGALLTIIGTVISTAAFGPHWGLGQFVVGR 131

Query: 178 IVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQ 237
           +++G+G G      P   SE +    RG  V+    MI +G  + Y  ++G     ++VQ
Sbjct: 132 VMTGVGTGLNTSTIPVWQSEMSKPENRGILVNLEGSMIAVGTMIAYWIDFGLSYVGSSVQ 191

Query: 238 WKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVE 297
           W+ P+ +   +A+F++AG+  +P+SPR+L+ +G  ++A   +AK + L ++D  ++AE  
Sbjct: 192 WRFPVAMQIFFALFLLAGIWELPDSPRWLMSRGRRDDALYVLAKLDDLPIDDDAIVAEAT 251

Query: 298 LINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIF-DA 356
            I   V   +    +        K + LQR ++    Q  QQ TG N   YY T +F ++
Sbjct: 252 AIQDAVNRFRHEKRSVKDLFTGGKTQNLQRALIASSTQFFQQFTGCNAAIYYSTVLFKES 311

Query: 357 VGMKDSFQTSIVLGVVNFAS-----TFVGLYTVERYGRRKCLLWGSAAMSVCF-VVFASV 410
           +G+    +  ++LG V FA+     T    + VE  GRRK  L G+   ++ F + FA  
Sbjct: 312 IGLTG--KLPLILGGV-FATIYTMFTIPSFFLVETLGRRKLFLLGATGQAISFTITFAC- 367

Query: 411 GVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAM 470
            +TK      D   +K A   +                 + ++   E   +RV++   A+
Sbjct: 368 -LTK-----DDAEVAKGAAVGLFLFICFFGMSLLS----LPWIYPPEIASMRVRSATNAL 417

Query: 471 AVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXX-XXXXXXCETKGLTLEEVN- 528
           +  +NW+  FA+   TP      G Y  Y+F   +             ET G +LEE++ 
Sbjct: 418 STCTNWLCNFAVVMFTPIFIDDTG-YGCYLFFAVMNYIYIPVIFFFYPETAGRSLEEIDI 476

Query: 529 ---EMYQEGVLPWKSETWVPALRRNESYD 554
              + Y +G+ PW+    +P L  +E  D
Sbjct: 477 IFAKSYVDGIQPWRVAANLPKLSLSEIED 505

>ADR139C [1880] [Homologous to ScYDR536W (STL1) - NSH]
           (950171..951847) [1677 bp, 558 aa]
          Length = 558

 Score =  166 bits (420), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 132/494 (26%), Positives = 223/494 (45%), Gaps = 29/494 (5%)

Query: 73  MVAFGGF-VFGWDTGTISGFVNMTDFKRRF-GNFDVGEQKYVLSDVRTGLIVSIFNIGCA 130
           + A  GF +FG+D G +SG +N   F   F    + G+     + V+ G + S + +GC 
Sbjct: 25  ITAVTGFSLFGYDQGLLSGLINGEQFNHEFPATLEQGDNDRHATVVQ-GAVTSCYELGCF 83

Query: 131 IGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWY---QYFIGRIVSGLGVGGI 187
            G L +   G+  GR+  ++   L+ ++G ++ +A+  + +   Q+ IGR+V+GLG G  
Sbjct: 84  FGSLYVMVDGERRGRKPLIIMGSLLTILGTVVSVAAFREHWGLGQFVIGRVVTGLGTGLN 143

Query: 188 AVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFL 247
               P   SE +    RG  V+    +I +G  + Y  ++G     ++VQW+ P+ +  +
Sbjct: 144 TSTIPVWQSEMSKPKNRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDSSVQWRFPVAMQIV 203

Query: 248 WAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEK 307
           +A+ ++ G++ +PESPR+L+  G   E+K  + K + L   D  VLAE   I   V   K
Sbjct: 204 FAVLLLVGIVQLPESPRWLMAHGRTAESKYVLGKLDNLDPSDDSVLAEAAAIEDAVNRFK 263

Query: 308 LAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSI 367
               +    L   +G+ LQR ++ C  Q  QQ TG N   YY T +F    +   ++ S+
Sbjct: 264 HEKRSLKDALTGGRGQNLQRTLVACSTQFFQQFTGCNAAIYYSTVLFHKT-INLEYRLSL 322

Query: 368 VLG----VVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMP 423
           +LG     V   +T    + +E  GRRK  L G+      F +  +  +     N K   
Sbjct: 323 ILGGVFSTVYTLATIPSFFLIETVGRRKLFLIGALGQGFSFTITFACLINDTKNNAKG-- 380

Query: 424 SSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIG 483
              +A    +             W     +   E   ++V++   AM+  +NW+  FA+ 
Sbjct: 381 ---AAVGLFLFIIFFGMTILSLPW-----IYPPEISSMKVRSITNAMSTCTNWLCNFAVV 432

Query: 484 FGTP-FITSA-IGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQ----EGVLP 537
             TP FI  A  G Y  +  M  L            ET G +LEE++ +Y     +G   
Sbjct: 433 MFTPIFIHEAGWGCYLFFAVMNFLYVPIIFFFYP--ETAGRSLEEIDIIYAKSFVDGTQA 490

Query: 538 WKSETWVPALRRNE 551
           W+    +P L   E
Sbjct: 491 WRVAANLPKLSLKE 504

>Scas_581.6
          Length = 587

 Score =  166 bits (420), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 153/600 (25%), Positives = 266/600 (44%), Gaps = 81/600 (13%)

Query: 5   ATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEY 64
           AT  + ++N N      S  + FD +   P++  S+ G  + +    +N+ I  KP+++ 
Sbjct: 21  ATATHVKTNDN------SITSFFDEE---PTHHTSKKGNVSLSDDEEDNDRIQIKPVNDE 71

Query: 65  I--------------LVMCLCLMVAFGGFVFGWDTGTIS-GFVNMTDFKRRFGNFDVGEQ 109
                           ++ L  + +  GF+FG+DTG IS   +++        N D+G  
Sbjct: 72  DDVSVIITFNQGISPFILILTFVASISGFMFGYDTGYISSALISI--------NKDLGR- 122

Query: 110 KYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNK 169
              L+     +I +  ++G  I  +  G   D++GR+  LM   +++V+G I+QI ++++
Sbjct: 123 --TLTYGDKEIITAATSLGALISSIFAGTAADIFGRKPCLMFSNVLFVIGAILQI-TAHR 179

Query: 170 WYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGT 229
           ++Q   GR++ G GVG  +++SP  ISE APK +RG       L +T G  + Y    G 
Sbjct: 180 FWQMNAGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGL 239

Query: 230 KTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVED 289
               N   W++ +GL  +  +   +  +F+P++PRY + KG++E AK  + +S     ED
Sbjct: 240 NHVHNG--WRILVGLSLIPTVLQFSFFLFLPDTPRYYVMKGDYENAKAVLRRSYINAPED 297

Query: 290 --SGVLAEVELINAGVEAEKLAGNASWG---ELFSPKGKILQRVIMGCVIQSLQQLTGNN 344
                + E+  +N  +  +  A    W    EL +      + +I+ C +Q++QQ TG N
Sbjct: 298 IIDRKVEELTELNHSIPGKNKAVQV-WNTVKELHTNPAN-FRALIIACGLQAIQQFTGWN 355

Query: 345 YFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWG----SAAM 400
              Y+  TIF+ VG  +S   SI++   NF  T V  + +++ GRR  LL G    + A+
Sbjct: 356 SLMYFSGTIFETVGFSNSSAVSIIVSGTNFVFTLVAFFAIDKIGRRAILLIGLPGMTMAL 415

Query: 401 SVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVI---VSE 457
           ++C + F  +G+  +   G D   S S   A               +A     +    SE
Sbjct: 416 TICAIAFHFIGIQFV---GNDAVVSNSGFTAWGIVIIVFIIVFAAFYALGIGTVPWQQSE 472

Query: 458 TYPLRVKNRAMAMAVGSNWIWGFAIGFG--------TPFITSAIGFYYGYVFMGCLXXXX 509
            +P  V+    + A  +NW     I           TP  T    F+ G  F+  +    
Sbjct: 473 LFPTNVRGVGTSYATATNWAGSLVIASTFLTMLQNITP--TGTFAFFAGLSFVSFI---- 526

Query: 510 XXXXXXXC--ETKGLTLEEVNEMYQEGV-------LPWKSETWVPALRRNESYDVNETQE 560
                  C  E  GL LEEV  + ++G        L  K +  V  +  ++      TQE
Sbjct: 527 ---FCYFCYPELSGLELEEVQSILKDGFNIKASKELAKKRKQQVARIIDDDQLKFEPTQE 583

>KLLA0F26246g 2432209..2433960 similar to sp|P39932 Saccharomyces
           cerevisiae YDR536w STL1 member of the sugar permease
           family, start by similarity
          Length = 583

 Score =  166 bits (420), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 135/497 (27%), Positives = 219/497 (44%), Gaps = 29/497 (5%)

Query: 73  MVAFGGF-VFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAI 131
           + A  GF +FG+D G +SG +    F   F            + V  G + S + +GC  
Sbjct: 29  ITAVTGFSLFGYDQGLMSGIITGVRFNDEFPGTKETSDDDRHATVVQGAVTSCYELGCFF 88

Query: 132 GGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIAS-SNKWY--QYFIGRIVSGLGVGGIA 188
           G L +   G+  GR+  ++   L+ +VG +I  A+  + W   Q+ IGR+++GLG G   
Sbjct: 89  GSLFVMMRGEKIGRKPLIIFGALLTIVGAVISTAAFGDHWGLGQFVIGRVITGLGTGMNT 148

Query: 189 VLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLW 248
              P   SE +    RG  V+    +I +G  + Y  ++G      +VQW+ P+ +   +
Sbjct: 149 STIPVWQSEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDTSVQWRFPVAMQIFF 208

Query: 249 AIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKL 308
           AI ++ G++ +P+SPR+L+ +G  EEA   + K + L   D  ++AEV  I   V   K 
Sbjct: 209 AILLMIGIVQLPDSPRWLVAQGRREEAMYVLGKLDDLDPNDDQIVAEVSTIQDAVNRFKH 268

Query: 309 AGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIF-DAVGMKDSFQTSI 367
              +    L   KG+ LQR ++    Q  QQ TG N   YY T +F   + ++D  + S+
Sbjct: 269 QKRSMKELLHGGKGQNLQRALVAASTQFFQQFTGCNAAIYYSTVLFKKTIKLED--RLSL 326

Query: 368 VLGVVNFA-----STFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDM 422
           VLG V FA     ST    + +E  GRRK  + G+      F++  +  V     N K  
Sbjct: 327 VLGGV-FATIYALSTIPSFFLIETLGRRKLFMLGAFGQGCSFLITFACLVHDTTQNAKG- 384

Query: 423 PSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAI 482
               +A    +             W     +   E   +RV++   A +  +NW+  FA+
Sbjct: 385 ----AAVGLFLFIVFFGMSILSLPW-----IYPPEIASMRVRSMTNAFSTCTNWLCNFAV 435

Query: 483 GFGTPFITSAIGFYYGYVFMGCLXXXXX-XXXXXXCETKGLTLEEVN----EMYQEGVLP 537
              TP      G +  Y+F  C+             ET G TLEE++    + Y +    
Sbjct: 436 VMFTPIFIQDAG-WGCYLFFACINFLYLPVIFFFYPETAGRTLEEIDIIFAKSYTDKTAA 494

Query: 538 WKSETWVPALRRNESYD 554
           W+    +P L   E  D
Sbjct: 495 WRVAANLPKLSLAEIED 511

>AFR343C [3535] [Homologous to ScYOL103W (ITR2) - SH; ScYDR497C
           (ITR1) - SH] (1060729..1062444) [1716 bp, 571 aa]
          Length = 571

 Score =  165 bits (418), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 142/518 (27%), Positives = 232/518 (44%), Gaps = 52/518 (10%)

Query: 66  LVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIF 125
            ++ L  + +  GF+FG+DTG IS  +            D+G Q   L+      I S  
Sbjct: 65  FIVMLTFVASLSGFLFGYDTGYISSALQSV-------GTDLGHQ---LTYRDKEYITSAT 114

Query: 126 NIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVG 185
           ++G  I  L  G   D++GRR  +M   +++VVG ++Q+A+ N W Q  +GR+V G G+G
Sbjct: 115 SLGALIAALGAGICADLFGRRKCIMFSNILFVVGTVLQVAAFNFW-QMVVGRLVMGFGIG 173

Query: 186 GIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLC 245
             +++SP  ISE APK +RG       L +T G  + Y    G +   +   W++ +G+ 
Sbjct: 174 FGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYACGAGFQHVKHG--WRILVGIS 231

Query: 246 FLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEA 305
            L A+      IF+P++PR+ + KG  E+A           +E + V AE  LI+  +E 
Sbjct: 232 MLPAVLQFVSFIFLPDTPRFYVMKGRLEDAAN--------VLERTYVGAERALIDRKIEE 283

Query: 306 -----EKLAGNASWGELFSPKGKI------LQRVIMGCVIQSLQQLTGNNYFFYYGTTIF 354
                + + G   +  +++    I      L+ +I+ C +Q +QQ  G N   Y+   IF
Sbjct: 284 LVLLNKTIPGRTVFHRVWNTIVAIHTVPANLRALIIACGLQGIQQFCGWNSLMYFSGDIF 343

Query: 355 DAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWG----SAAMSVCFVVF--- 407
             VG KD    SIV+   NF  T V  + +++ GRR  LL G    + AM+VC + F   
Sbjct: 344 SLVGFKDPVAVSIVVAATNFIFTLVAFFAIDKIGRRIILLIGLPGMTTAMTVCAIAFHYI 403

Query: 408 -ASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNR 466
              V   KL P G+    S + G  ++                + +   SE +P  V+  
Sbjct: 404 KTEVDGEKLKPVGE----SNAWGIVVVIFIIVYAAFYALGIGTVPWQ-QSELFPQPVRGV 458

Query: 467 AMAMAVGSNWIWGFAIG--FGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTL 524
             + A  +NW     I   F T F        +G+ F G              E  GL L
Sbjct: 459 GTSFATATNWAGSMVIASTFLTMFKNITPTATFGF-FAGISVISLVAVYLCYPELSGLEL 517

Query: 525 EEVNEMYQEGVLPWKSETWVPALRRNESYDVNETQEDS 562
           EEV  + ++G     S+    AL +   + + E+++ +
Sbjct: 518 EEVQFVLKDGFNIKASK----ALAKKRKFQMAESRKQA 551

>Sklu_2439.20 YDR536W, Contig c2439 31933-33648
          Length = 571

 Score =  165 bits (417), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 134/505 (26%), Positives = 229/505 (45%), Gaps = 32/505 (6%)

Query: 66  LVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIF 125
           L + + +    G  +FG+D G +SG +   +F   F            + V  G + S +
Sbjct: 21  LRLAITITAVTGFSLFGYDQGLMSGIITGKEFNSEFPATHKVSDHDRHATVVQGAVTSCY 80

Query: 126 NIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWY---QYFIGRIVSGL 182
            +GC  G L +   G+  GR+  ++   L+ VVG +I  A+    +   Q+ IGR+++G+
Sbjct: 81  ELGCFFGSLFVMFRGEHIGRKPLVIFGALLTVVGTVISTAAFGPHWGLGQFVIGRVITGI 140

Query: 183 GVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPL 242
           G G      P   SE +    RG  V+    +I +G  + Y  ++G    +++VQW+ P+
Sbjct: 141 GTGMNTSTIPVWQSEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVNSSVQWRFPV 200

Query: 243 GLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAG 302
            +   +A+ ++ G++ +P+SPR+L+ +G  EEA   + K + L   D  +LAE  +I   
Sbjct: 201 AMQIFFALLLLVGIVQLPDSPRWLMSQGRREEAMYVLGKLDGLDPNDDQILAEATVIQDA 260

Query: 303 VEAEKLAGNASWGELFS-PKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKD 361
           V   +     S  +LF+  KG+  QR ++    Q  QQ TG N   YY T +F+   +K 
Sbjct: 261 VNRFR-HQKRSVKDLFTGGKGQNFQRALIAASTQFFQQFTGCNAAIYYSTVLFNET-IKL 318

Query: 362 SFQTSIVLGVVNFASTFVGLYT------VERYGRRKCLLWGSAAMSVCFVVFASVGVTKL 415
            ++ S++LG V   ST   L+T      +E  GRRK  L G+   ++ F +  +  +   
Sbjct: 319 DYRLSLILGGV--FSTIYALFTIPSFFLIESLGRRKLFLIGATGQAISFTITFACLIDDT 376

Query: 416 YPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSN 475
             N K      +A    +             W     +   E   +RV++   A++  +N
Sbjct: 377 TQNAK-----GAAVGLFLFISFFGVALLSLPW-----IYPPEIASMRVRSSTNALSTCTN 426

Query: 476 WIWGFAIGFGTP-FITSA-IGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQ- 532
           W+  FA+   TP FI  A  G Y  +  M  L            ET G +LEE++ ++  
Sbjct: 427 WLCNFAVVMFTPIFIQDAGWGCYLFFAVMNYLYIPVIFFFYP--ETAGRSLEEIDIIFAK 484

Query: 533 ---EGVLPWKSETWVPALRRNESYD 554
              +G  PW+    +P L   E  D
Sbjct: 485 SHVDGTRPWRVAANLPKLSFAEVED 509

>YDR536W (STL1) [1346] chr4 (1507992..1509701) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1710 bp, 569 aa]
          Length = 569

 Score =  163 bits (412), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 136/507 (26%), Positives = 223/507 (43%), Gaps = 41/507 (8%)

Query: 80  VFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRL 139
           +FG+D G ++  +    F   F            + V  G   S + +GC  G L +   
Sbjct: 41  LFGYDQGLMASLITGKQFNYEFPATKENGDHDRHATVVQGATTSCYELGCFAGSLFVMFC 100

Query: 140 GDMYGRR-LGLMAVILVYVVGIIIQIASSNKWY--QYFIGRIVSGLGVGGIAVLSPTLIS 196
           G+  GR+ L LM  ++  +  +I   A    W   Q+ IGR+V+G+G G      P   S
Sbjct: 101 GERIGRKPLILMGSVITIIGAVISTCAFRGYWALGQFIIGRVVTGVGTGLNTSTIPVWQS 160

Query: 197 ETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGM 256
           E +    RG  V+     I  G  + Y  ++G    +++VQW+ P+ +  ++A+F++A M
Sbjct: 161 EMSKAENRGLLVNLEGSTIAFGTMIAYWIDFGLSYTNSSVQWRFPVSMQIVFALFLLAFM 220

Query: 257 IFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGE 316
           I +PESPR+LI +   EEA+  +   +     D  V+ EV +++  V   K   + S   
Sbjct: 221 IKLPESPRWLISQSRTEEARYLVGTLDDADPNDEEVITEVAMLHDAVNRTKHEKH-SLSS 279

Query: 317 LFSP-KGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFA 375
           LFS  + + LQR ++    Q  QQ TG N   YY T +F+   +K  ++ S+++G V FA
Sbjct: 280 LFSRGRSQNLQRALIAASTQFFQQFTGCNAAIYYSTVLFNKT-IKLDYRLSMIIGGV-FA 337

Query: 376 -----STFVGLYTVERYGRRKCLLWGSAAMSVCF-VVFASVGVTKLYPNGKDMPSSKSAG 429
                ST    + +E+ GRRK  L G+   +V F + FA      L    K+     + G
Sbjct: 338 TIYALSTIGSFFLIEKLGRRKLFLLGATGQAVSFTITFAC-----LVKENKENARGAAVG 392

Query: 430 NAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFI 489
             +                 + ++   E   ++V+    A +  +NW+  FA+   TP  
Sbjct: 393 LFLFITFFGLSLL------SLPWIYPPEIASMKVRASTNAFSTCTNWLCNFAVVMFTPIF 446

Query: 490 --TSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVN----EMYQEGVLPWKSETW 543
              S  G Y  +  M  L            ET G +LEE++    + Y++G  PW+    
Sbjct: 447 IGQSGWGCYLFFAVMNYLYIPVIFFFYP--ETAGRSLEEIDIIFAKAYEDGTQPWRVANH 504

Query: 544 VPALRRNE---------SYDVNETQED 561
           +P L   E         SYD    +ED
Sbjct: 505 LPKLSLQEVEDHANALGSYDDEMEKED 531

>Kwal_56.22724
          Length = 578

 Score =  162 bits (411), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 112/366 (30%), Positives = 182/366 (49%), Gaps = 27/366 (7%)

Query: 58  QKPLSEYILVMCLCLMVAFGGFVFGWDTGTIS-GFVNM-TDFKRRFGNFDVGEQKYVLSD 115
            + +S +I++  L  + +  GF+FG+DTG IS   +++ TD   R           VL+ 
Sbjct: 63  NQKVSPFIII--LTFVASISGFLFGYDTGYISSALISIGTDLDNR-----------VLTY 109

Query: 116 VRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFI 175
               +I +  ++G  I  +  G   D++GR+  LM   L +V+G ++Q+++S  W Q  +
Sbjct: 110 GDKEIITAATSLGALISAVAAGTCADIWGRKPCLMISNLFFVIGAVLQVSASTFW-QMAV 168

Query: 176 GRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNA 235
           GR++ G GVG  +++SP  I E APK +RG  V    L +T G  + Y    G     N 
Sbjct: 169 GRLIMGFGVGIGSLISPLFIGEIAPKMIRGRLVVINSLCLTGGQLIAYGCGAGLDHVHNG 228

Query: 236 VQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVED--SGVL 293
             W++ +GL  +          F+P++PRY + KG  ++A   +AKS      D     +
Sbjct: 229 --WRILVGLSLIPTFTQFVCFCFLPDTPRYYVMKGKLDKAAEVLAKSYVDAPADLIHQKI 286

Query: 294 AEVELINAGVEAEKLAGNA--SWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGT 351
            E+  +N  +  + + G    +  E+ +      + +I+GC +Q +QQ  G N   Y+  
Sbjct: 287 QELHALNRTIPGDSVPGKVWNTIKEIHTVPAN-FRALILGCALQGIQQFCGWNSLMYFSG 345

Query: 352 TIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMS----VCFVVF 407
           TIF+ VG K+S   SIV+   NF  T V  + ++R GRR  LL G   M     VC V F
Sbjct: 346 TIFETVGFKNSAAVSIVVAGTNFIFTLVAFFAIDRIGRRSILLIGLPGMCVSLIVCAVAF 405

Query: 408 ASVGVT 413
             +GVT
Sbjct: 406 HYLGVT 411

>Sklu_2313.3 YDR497C, Contig c2313 3640-5376 reverse complement
          Length = 578

 Score =  162 bits (409), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 122/420 (29%), Positives = 200/420 (47%), Gaps = 32/420 (7%)

Query: 1   MSSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIP--- 57
           M S ++P  +   S     + +    FD          S+D    K  +  ++  +    
Sbjct: 1   MYSLSSPQANSKESFKVHESSAHEVAFDQDEHHKRVSGSQDRILIKPVNDEDDTSVMITF 60

Query: 58  QKPLSEYILVMCLCLMVAFGGFVFGWDTGTIS-GFVNM-TDFKRRFGNFDVGEQKYVLSD 115
            + +S +I++  L  + +  GF+FG+DTG IS   V++ TD   +      GE++     
Sbjct: 61  NQKVSPFIII--LTFVASISGFMFGYDTGYISSALVSIGTDLDNK--TLTYGEKE----- 111

Query: 116 VRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFI 175
               +I +  ++G  I  +  G   D++GR+  +M   L++V+G I+Q+++   W Q  I
Sbjct: 112 ----IITAATSLGALITAVFAGVSADLFGRKPCIMFSNLLFVIGAILQVSAHTFW-QMAI 166

Query: 176 GRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNA 235
           GR+V G GVG  +++SP  ISE APK +RG       L +T G  + Y    G     N 
Sbjct: 167 GRLVMGFGVGIGSLISPLFISEIAPKMIRGRLTVVNSLCLTGGQLIAYACGAGLDKVHNG 226

Query: 236 VQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAE 295
             W++ +GL  +  +      +F+P++PRY + KGN E+A + + KS    V+  G L E
Sbjct: 227 --WRILVGLSLIPTVIQFTMFMFLPDTPRYYVMKGNLEKAAQVLGKS---YVDAPGDLIE 281

Query: 296 VELINAGVEAEKLAGNASWGELFSPKGKILQRV-------IMGCVIQSLQQLTGNNYFFY 348
            + +N  VE       A+  E      K +  V       I+GC +Q +QQ  G N   Y
Sbjct: 282 RK-VNELVELNTTIPGANIFEKVRNTVKEIHVVPANFRALIIGCALQGIQQFCGWNSLMY 340

Query: 349 YGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFA 408
           +  TIF  VG ++S   SI++   NF  T V  + +++ GRR  LL G   M V  +V A
Sbjct: 341 FSGTIFQTVGFENSTAVSIIVAGTNFIFTLVAFFAIDKIGRRAILLIGLPGMMVSLIVCA 400

>KLLA0C12309g 1046848..1048557 highly similar to sp|P30606
           Saccharomyces cerevisiae YOL103w ITR2 myo-inositol
           permease, minor, start by similarity
          Length = 569

 Score =  160 bits (406), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 117/421 (27%), Positives = 204/421 (48%), Gaps = 48/421 (11%)

Query: 8   MNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIP-------QKP 60
           MND S  ++++    SP  FD  S++     SE+    +      N+E          + 
Sbjct: 1   MNDTSEHSSDV----SPIIFDDISQSKLKDSSENETTDRIIIKPVNDEDDTSVMITFNQK 56

Query: 61  LSEYILVMCLCLMVAFGGFVFGWDTGTIS-GFVNM-TDFKRRFGNFDVGEQKYVLSDVRT 118
           +S +IL+  L    +  GF+FG+DTG IS   V++ TD   +   +  G+++        
Sbjct: 57  ISPFILI--LTFTASISGFMFGYDTGYISSALVSIGTDLDNKALTY--GDKE-------- 104

Query: 119 GLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRI 178
            +I +  ++G  I  +  G   D++GR+  LM   +++V+G  +Q+++ + W Q  +GR+
Sbjct: 105 -IITAATSLGALISAVFAGISADIFGRKPCLMFSNILFVIGAALQVSAHSFW-QMAVGRL 162

Query: 179 VSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQW 238
           + G GVG  ++L+P  ISE APKH+RG       L +T G  + Y    G     N   W
Sbjct: 163 IMGFGVGIGSLLAPLFISEIAPKHIRGRLTVINSLWLTGGQLIAYACGAGLNKVHNG--W 220

Query: 239 KLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVEL 298
           ++ +GL  +  +       F+P++PR+ + KGN+++A   + KS         + A  EL
Sbjct: 221 RILVGLSLIPTVVQFTCFSFLPDTPRFYVIKGNYKKAAEVLQKSY--------INAPQEL 272

Query: 299 INAGVEA-----EKLAGNASWGELFSPKGKI------LQRVIMGCVIQSLQQLTGNNYFF 347
           I+  +       E + G     + F+   ++       + +++GC +Q +QQ  G N   
Sbjct: 273 IDQKIRELSDLNEAIPGKTPVHKFFNTVKELHTVPCNFRALVIGCALQGIQQFCGWNSLM 332

Query: 348 YYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVF 407
           Y+  TIF  VG ++S   SI++   NF  T V  + +++ GRR  LL G   M V  V+ 
Sbjct: 333 YFSGTIFQTVGFENSTAVSIIVAGTNFVFTLVAFFAIDKVGRRAILLIGLPGMMVSLVMC 392

Query: 408 A 408
           A
Sbjct: 393 A 393

>YDR497C (ITR1) [1312] chr4 complement(1443701..1445455)
           Myo-inositol permease (major), closely related to Itr2p,
           member of the hexose transporter family of the major
           facilitator superfamily (MFS) [1755 bp, 584 aa]
          Length = 584

 Score =  160 bits (405), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 117/397 (29%), Positives = 202/397 (50%), Gaps = 37/397 (9%)

Query: 32  RTPSNKLSEDGFATKTTSPLENNEIP---QKPLSEYILVMCLCLMVAFGGFVFGWDTGTI 88
           R P++   ED    K  +  ++  +     + LS +I+   L  + +  GF+FG+DTG I
Sbjct: 51  RAPASD-DEDRIQIKPVNDEDDTSVMITFNQSLSPFIIT--LTFVASISGFMFGYDTGYI 107

Query: 89  S-GFVNM-TDFKRRFGNFDVGEQKYVLSDVRTG-LIVSIFNIGCAIGGLTLGRLGDMYGR 145
           S   +++ TD   +   +  GE++ V +    G LI SIF           G   D++GR
Sbjct: 108 SSALISIGTDLDHKVLTY--GEKEIVTAATSLGALITSIFA----------GTAADIFGR 155

Query: 146 RLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRG 205
           +  LM   L++V+G I+Q+++   W Q  +GR++ G GVG  ++++P  ISE APK +RG
Sbjct: 156 KRCLMGSNLMFVIGAILQVSAHTFW-QMAVGRLIMGFGVGIGSLIAPLFISEIAPKMIRG 214

Query: 206 TCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRY 265
                  L +T G  + Y    G    +N   W++ +GL  +        + F+P++PRY
Sbjct: 215 RLTVINSLWLTGGQLVAYGCGAGLNYVNNG--WRILVGLSLIPTAVQFTCLCFLPDTPRY 272

Query: 266 LIEKGNFEEA----KRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNA--SWGELFS 319
            + KG+   A    KRS   +++  +E    + E+  +N  +  + +      +  EL +
Sbjct: 273 YVMKGDLARATEVLKRSYTDTSEEIIERK--VEELVTLNQSIPGKNVPEKVWNTIKELHT 330

Query: 320 PKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFV 379
                L+ +I+GC +Q++QQ TG N   Y+  TIF+ VG K+S   SI++   NF  T V
Sbjct: 331 VPSN-LRALIIGCGLQAIQQFTGWNSLMYFSGTIFETVGFKNSSAVSIIVSGTNFIFTLV 389

Query: 380 GLYTVERYGRRKCLLWG----SAAMSVCFVVFASVGV 412
             +++++ GRR  LL G    + A+ VC + F  +G+
Sbjct: 390 AFFSIDKIGRRTILLIGLPGMTMALVVCSIAFHFLGI 426

>YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permease
           (minor), closely related to Itr1p, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1830 bp, 609 aa]
          Length = 609

 Score =  160 bits (406), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 129/487 (26%), Positives = 228/487 (46%), Gaps = 40/487 (8%)

Query: 66  LVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIF 125
            ++ L  + +  GF+FG+DTG IS    +    R   N        VL+     LI +  
Sbjct: 108 FIITLTFVASISGFMFGYDTGYISS--ALISINRDLDN-------KVLTYGEKELITAAT 158

Query: 126 NIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVG 185
           ++G  I  +  G   D++GRR  LM   L++++G I+QI +++K++Q   GR++ G GVG
Sbjct: 159 SLGALITSVGAGTAADVFGRRPCLMFSNLMFLIGAILQI-TAHKFWQMAAGRLIMGFGVG 217

Query: 186 GIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLC 245
             +++SP  ISE APK +RG       L +T G  + Y    G     N   W++ +GL 
Sbjct: 218 IGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNG--WRILVGLS 275

Query: 246 FLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEA 305
            +  +   +   F+P++PRY + KG+ + AK  + K + +  ED  +  +VE +++    
Sbjct: 276 LIPTVLQFSFFCFLPDTPRYYVMKGDLKRAKM-VLKRSYVNTEDEIIDQKVEELSS--LN 332

Query: 306 EKLAGNASWGELFSPKGKI------LQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGM 359
           + + G     + ++   ++       + +I+GC +Q++QQ TG N   Y+  TIF+ VG 
Sbjct: 333 QSIPGKNPITKFWNMVKELHTVPSNFRALIIGCGLQAIQQFTGWNSLMYFSGTIFETVGF 392

Query: 360 KDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWG----SAAMSVCFVVFASVGVTKL 415
           K+S   SI++   NF  T +  + +++ GRR  LL G    + A+ +C + F  +G+   
Sbjct: 393 KNSSAVSIIVSGTNFVFTLIAFFCIDKIGRRYILLIGLPGMTVALVICAIAFHFLGIKF- 451

Query: 416 YPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVI---VSETYPLRVKNRAMAMAV 472
             NG D   +    ++               +A     +    SE +P  V+    + A 
Sbjct: 452 --NGADAVVASDGFSSWGIVIIVFIIVYAAFYALGIGTVPWQQSELFPQNVRGVGTSYAT 509

Query: 473 GSNWIWGFAIGFGTPFIT-----SAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEV 527
            +NW     I   + F+T     +  G +  +  + CL            E  GL LEEV
Sbjct: 510 ATNWAGSLVI--ASTFLTMLQNITPTGTFSFFAGVACLSTIFCYFCYP--ELSGLELEEV 565

Query: 528 NEMYQEG 534
             + ++G
Sbjct: 566 QTILKDG 572

>KLLA0E00264g 15302..16837 weakly similar to sp|P54854 Saccharomyces
           cerevisiae YDL245c HXT15, start by similarity
          Length = 511

 Score =  158 bits (400), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 122/462 (26%), Positives = 215/462 (46%), Gaps = 26/462 (5%)

Query: 82  GWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGD 141
           G+D    +    M  F  +FG +D     Y +  V    + S   IG A G +    +  
Sbjct: 57  GFDNQGFATIQAMDSFIEKFGQYDAQTGAYAIPPVFLSFLNSFQYIGFAFGLVCGSIVSS 116

Query: 142 MYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPK 201
            +GR++ ++++ L  ++   I I S++K  Q    R+++ + +G    + P   +E  P 
Sbjct: 117 RFGRKICVLSMSLYALITATIGITSNSKE-QILSARVLNYVFIGMEMAVIPVFQAEIVPP 175

Query: 202 HLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPE 261
           + RG  V  +QL + +G  + +     T        W++PLGL +++   + + ++F+PE
Sbjct: 176 NTRGFFVGAFQLSLNIGGLVIHIITNSTAHIDGTSSWRIPLGLYYIFPSVIASLVMFIPE 235

Query: 262 SPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPK 321
           SPR+LI KG  EEA RS+ +    T+ +S ++ E E I + VEAEK    + + ELF+  
Sbjct: 236 SPRWLILKGKKEEAMRSLVRLRNGTIYESEIINEYESIISSVEAEK-QEKSKYTELFTGT 294

Query: 322 GKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGL 381
            K  +R ++  +    QQ+TG  +   YGT    ++   D FQ SIV  VV   +  + L
Sbjct: 295 NK--RRTLIVILANIFQQVTGQAFASQYGTIFIKSLNTVDPFQMSIVSSVVAIVAVIIVL 352

Query: 382 YTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXX 441
              + +GR+K L+ GS   ++  +V   +G         D+ ++K   N ++        
Sbjct: 353 LFTDEFGRKKFLVIGSVIQAIALLVMGGLGT-------GDVTTAKK--NGIVATMMINSF 403

Query: 442 XXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPF--------ITSAI 493
                WAP++YVI SE    R++++  A+ +  N ++ F   F  P+        + S +
Sbjct: 404 AYCISWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFITAFTLPYLLSKPYANLQSKV 463

Query: 494 GFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGV 535
           GF Y     G              E +GL+LEE+   +   V
Sbjct: 464 GFIY-----GAFTVLSVVFSYYLPECRGLSLEEIESNFVNKV 500

>CAGL0I07447g 716104..717816 highly similar to sp|P30606
           Saccharomyces cerevisiae YOL103w ITR2 myo-inositol
           permease, minor, hypothetical start
          Length = 570

 Score =  155 bits (392), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 145/527 (27%), Positives = 238/527 (45%), Gaps = 59/527 (11%)

Query: 66  LVMCLCLMVAFGGFVFGWDTGTIS-GFVNM-TDFKRRFGNFDVGEQKYVLSDVRTGLIVS 123
            ++ L  + +  GF+FG+DTG IS   +++ TD   +       E  Y   ++ T     
Sbjct: 72  FIIMLTFVASLSGFLFGYDTGYISSALISIGTDLDNK-------ELTYGEKEITTAAT-- 122

Query: 124 IFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLG 183
             ++G  I  L  G   D++GR+  LM   +++++G I+Q+ +++K++Q   GR + G G
Sbjct: 123 --SLGALIFALVAGFSVDIFGRKPCLMFSNIMFLIGAILQV-TAHKFWQMTAGRFIMGFG 179

Query: 184 VGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLG 243
           VG  ++++P  ISE APK +RG       L +T G  + Y    G     N   W++ +G
Sbjct: 180 VGIGSLIAPLYISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVHNG--WRILVG 237

Query: 244 LCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGV 303
           L  +  +      IF+P++PRY + KG++E+AK S+ K +   V D       ELI+  +
Sbjct: 238 LSLIPTVLQFVFFIFLPDTPRYYVMKGDYEKAK-SVLKRSYNGVSD-------ELIDRKI 289

Query: 304 EAEKLAGNAS----------WGEL--FSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGT 351
           E E LA N S          W  +     K    + +I+ C +Q +QQ TG N   Y+  
Sbjct: 290 E-ELLALNQSIPGKNHVERTWNAVKELHTKPANFRALIIACGLQGIQQFTGWNSLVYFSG 348

Query: 352 TIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVV----F 407
           TIF++VG K+S   SI++   NF  T V  + +++ GRR  L+ G   M+V  V+    F
Sbjct: 349 TIFESVGFKNSSAVSIIVSGTNFIFTLVAFFCIDKIGRRNILIIGIPGMTVAHVMSAIAF 408

Query: 408 ASVGVTKLYPNGKDMPSS--KSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKN 465
             +G+ K   N   +  S   S G  +I                + +   SE +P  V+ 
Sbjct: 409 HFIGI-KFVGNTAIVEHSGFSSWGIVIIVFIIMFAAFYALGIGTVPWQ-QSELFPQNVRG 466

Query: 466 RAMAMAVGSNWIWGFAIGFGTPFITSAIGF----YYGYVFMGCLXXXXXXXXXXXCETKG 521
              A A  +NW     I   + F+T          +G+ F G              E  G
Sbjct: 467 VGTAFATATNWAGSLVI--ASTFLTMLQNITPTGTFGF-FAGLCVVSFFFCYFCYPELSG 523

Query: 522 LTLEEVNEMYQEGV-------LPWKSETWVPALRRNESYDVNETQED 561
           L LEEV  + Q+G        L  K +  +  L++ +     E  E+
Sbjct: 524 LELEEVQTILQDGFNVQASKELAKKRKRQIAVLKKAKHQPTEEIIEE 570

>Kwal_27.11638
          Length = 723

 Score =  154 bits (388), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 131/514 (25%), Positives = 222/514 (43%), Gaps = 45/514 (8%)

Query: 36  NKLSEDG-FATKTTSPLENNEIPQKPLSEYIL-----VMCLCLMVAFGGFVFGWDTGTIS 89
           N L   G       +P  +N+ P   + +  L     +    + V+ G F+FG+D G +S
Sbjct: 76  NTLEHPGALQNSHLNPAPSNDTPHIQVKDSFLTGRALLYFTSVFVSLGVFLFGYDQGVMS 135

Query: 90  GFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGL 149
           G +    FK  F +          S    G +VSI  IG  I  L +GRLG+ +GRR  +
Sbjct: 136 GIITGPLFKDYFHD---------PSRFAIGNMVSILEIGALISSLMVGRLGEKWGRRRTI 186

Query: 150 MAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRG--TC 207
                V+++G + Q  S+ K     IGR++SGLGVG ++ + P   SE +P H RG   C
Sbjct: 187 RYGSFVFIIGGLFQ-TSATKLSHLIIGRVISGLGVGLLSTIVPIYQSEISPPHNRGKLAC 245

Query: 208 VSFYQLMITLGIFMGYCT----NYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESP 263
           + F       G  +GYC+    +YG     N   W+LPL +  +  + ++ G   + E+P
Sbjct: 246 IEF------TGNIVGYCSSVWVDYGCSYIPNNAAWRLPLFIQCVMGLGLMLGTFVIVETP 299

Query: 264 RYLIEKGNFEEAKRSIAK-SNKLTVEDSGVLAEVELINAGVEAEKLAG-NASWGELFSPK 321
           R+L+   +  E    IA   +   V+D    AE + I   V   +L G   S+  +F   
Sbjct: 300 RWLLNHDHDVEGLIVIADLHSNGDVQDQRAHAEFQAIKETVLISRLEGEKKSYSYVFK-- 357

Query: 322 GKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGM--KDSFQTSIVLGVVNFASTFV 379
            +   R+++    Q   QL G N   YY   +F+  G   +D+   + +  V+   ST +
Sbjct: 358 -RYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGRDAILMTGINSVIYVLSTIL 416

Query: 380 GLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXX 439
             + V+++GR+  LL G   M +  V  ++     LY N    P+       ++      
Sbjct: 417 PWHLVDKWGRKPILLIGGMVMGLSLVSISAA----LYINIASTPT------LVVVFVVVF 466

Query: 440 XXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGY 499
                  W PI ++   E  PL  ++   + +  +NW+  + +G  TP +   I +    
Sbjct: 467 NAFFGFSWGPIPWLYPVEIAPLSARSAMASASTATNWLCNWLVGIMTPVLQEKIQWRMYL 526

Query: 500 VFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQE 533
           +                 ET GL LE++  ++ +
Sbjct: 527 IHAASCFISFWCVLRVYPETAGLRLEDMGSVFDD 560

>CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces
           cerevisiae YDR387c, hypothetical start
          Length = 547

 Score =  133 bits (334), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 122/505 (24%), Positives = 217/505 (42%), Gaps = 73/505 (14%)

Query: 77  GGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTL 136
           GG +FG+DTG ISG   +   K +    D+G  +  +SD    LI SI  +GC +G L  
Sbjct: 60  GGLLFGYDTGVISGV--LLSLKPQ----DLG--RATISDWDKELITSITCLGCFVGSLLG 111

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLIS 196
             L D YGRR+ L    ++++V  +    +SN     F GR V G+ VG  A  +P  + 
Sbjct: 112 SPLADKYGRRITLAIFCVLFIVAALWMALASNLVLLVF-GRFVVGIAVGTAAQCTPVYLC 170

Query: 197 ETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGM 256
           E +P  +RG  ++   + +T G F+ Y   Y  + Y     W++  GL  + AI  ++ +
Sbjct: 171 EISPAKIRGQILALNSIAVTGGQFLSYIFAY--ELYDVNGSWRILFGLSAVPAIIFLSML 228

Query: 257 IFVPESPRYLIEKGNFEEAKRSI------------------------------------- 279
            F+PESPR+L+    ++ AK ++                                     
Sbjct: 229 DFIPESPRWLVSMSKYDSAKAALRMIYPTASPGQINLKFNELVINLSKLKHYQDEQTSLM 288

Query: 280 ----AKSNKLTVE--DSGVLAEVELINAGVEAEK--LAGNASWGELFSPKGKILQRVIMG 331
                +S+++T+   D G +A +  +++ +         N +      P+ K  + +++G
Sbjct: 289 VPLSVRSSRVTINSADYGSVANLRSLHSLMNEPSGTNHSNKTVHHRMEPRTK--RALLIG 346

Query: 332 CVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRK 391
           CV+   QQ+TG N F YY   IF  +   +    ++ +   NF  TF+ +Y V+  GRR 
Sbjct: 347 CVLMFFQQITGFNAFMYYAPLIFSKLNSHNPLLPAMSIAFTNFLFTFLAVYLVDLVGRRS 406

Query: 392 CLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIA 451
            LL     M+V  ++ +++G    + N   +  + S     I             W+ + 
Sbjct: 407 MLLNTIWIMTVG-LLLSTIGFQ--HENVVVLLFAVS-----IFVAAYASAMGTIPWSSVE 458

Query: 452 YVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXX-X 510
           ++      PL  ++   +    +NW+  F I      + + IG     +F          
Sbjct: 459 FL------PLNRRSFGASCISCTNWLTNFVITASYLSVMNKIGTEDTMLFFALFSVMAWF 512

Query: 511 XXXXXXCETKGLTLEEVNEMYQEGV 535
                  E KGL+LEE+ ++++ G+
Sbjct: 513 FVYFWYPEVKGLSLEEIGKVFENGI 537

>Sklu_2427.8 , Contig c2427 19304-21040
          Length = 578

 Score =  133 bits (334), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 119/528 (22%), Positives = 228/528 (43%), Gaps = 21/528 (3%)

Query: 18  LAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFG 77
           L  ++SP + ++ +  P   L          +  E+   P +  +  I    +    A  
Sbjct: 2   LLKLNSPENLNATTGMPRKTLYHRLGLKNIFAKTEDRPTPPEVYNWRIYATAMIASTA-- 59

Query: 78  GFVFGWDTGTISGFVNMTDFKRRFG-NFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTL 136
             + G+DTG + G  +   F R FG   D       LS+     ++S F+     G L  
Sbjct: 60  SILIGYDTGFVGGCFSNEYFLRNFGYEKDTPTANDALSN-----MISCFHAAAFFGALIS 114

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIIIQIAS-SNKWYQYFIGRIVSGLGVGGIAVLSPTLI 195
             +   +GRR+ L+    V  +G  + +A+ ++     +IGR+++GL VG    L+   +
Sbjct: 115 YPMSHYWGRRVSLIIAAGVAAIGAALMMAAVTSHLAPLYIGRVLTGLTVGASTNLTVVYL 174

Query: 196 SETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNA--VQWKLPLGLCFLWAIFMI 253
           SE +P  +RG  ++FY++   +G  +G+  N+G   + +    QW +PLG+  + A    
Sbjct: 175 SEVSPAPIRGQIIAFYEVGWRIGDLIGFWINFGVSEHISPGNKQWIIPLGVQLIPAGMFF 234

Query: 254 AGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEK----LA 309
            G   + ESPR+L +     EA  ++    +L  +   ++ E+  I   +E +     L 
Sbjct: 235 VGSFIMKESPRWLFQMDRDHEAIENLHYLRQLPEDHEYMVWEINSIKNSIEEQNSTVGLG 294

Query: 310 GNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQT---S 366
                 E+F    K  +R+++  ++   Q   G     YY   IF ++G++ +  T   S
Sbjct: 295 MFDPVKEVFVRNRKYSRRLVITALLFLFQNFMGIQSINYYSPRIFKSIGVQGTNATLFSS 354

Query: 367 IVLGVVNFASTFVG-LYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSS 425
            + GVV F  TF+  L+ V+ +GRR+  +W ++  SVCF    +    K+    K   S+
Sbjct: 355 GMFGVVKFICTFIYILFIVDNFGRRRAFMWSASVCSVCFWYVGA--YLKINDPSKPGVSA 412

Query: 426 KSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFG 485
              G A I             W+   +V  +E Y   +++   ++    +W+  F +   
Sbjct: 413 GPGGKAAIGFMFIWTASFILAWSGGPFVWGAEVYEQNIRSFVQSINAAISWVPIFIMTRM 472

Query: 486 TPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQE 533
           T  +   + +   + F                ETKG+ LE++++++ +
Sbjct: 473 TNDMVDKMQYGIFFFFASLAALAVPFVFFFVPETKGIALEDIDKLFDK 520

>KLLA0A03223g 290002..292035 some similarities with sp|P39932
           Saccharomyces cerevisiae YDR536w STL1 member of the
           sugar permease family P33.1.f24.1, hypothetical start
          Length = 677

 Score =  130 bits (328), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 117/503 (23%), Positives = 208/503 (41%), Gaps = 47/503 (9%)

Query: 50  PLENNEIP----------QKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKR 99
           PL+   IP             L+   L+    + V+ G F+FG+D G +SG +    FK 
Sbjct: 89  PLDQQRIPPSYTDHLQVKDTYLTGRTLLYFTSIFVSLGVFLFGYDQGVMSGIITGPYFKT 148

Query: 100 RFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVG 159
            F N          +    G +VSI  IG  +  L +  +G+ +GRR  +    L++++G
Sbjct: 149 YFNN---------PTAATIGTMVSILEIGALVSSLLVSNIGEKFGRRFTIKYGSLIFILG 199

Query: 160 IIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRG--TCVSFYQLMITL 217
            ++Q  S    +  F GRI+SG+GVG ++ + P   SE +P H RG   C+ F       
Sbjct: 200 GLVQTFSWEMGHMIF-GRIISGIGVGLLSTIVPIYQSEISPPHNRGKLACIEF------T 252

Query: 218 GIFMGYCT----NYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFE 273
           G  +GY +    +Y      +   W+LPL +  +  + +  G   + E+PR+L+   +  
Sbjct: 253 GNIVGYASSVWVDYACSYIESDTSWRLPLFIQCVMGLLLFLGSFVIVETPRWLLNHDHDI 312

Query: 274 EAKRSIAK-SNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGC 332
           E    IA   +   V  S    E +LI   V   +L G      L     +   R+++  
Sbjct: 313 EGLVVIADLHSDGDVLHSKAHEEYKLIKETVLISRLEGEKK--SLRFAFKRYRTRMLIAM 370

Query: 333 VIQSLQQLTGNNYFFYYGTTIFDAVGM--KDSFQTSIVLGVVNFASTFVGLYTVERYGRR 390
             Q   QL G N   YY   +F+  G   +++   + +  ++   ST +    V+++GR+
Sbjct: 371 SSQMFAQLNGINVISYYAPLVFEQAGWVGREALLMTGINSIIYILSTILPWKLVDKWGRK 430

Query: 391 KCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPI 450
             LL G+  M    +  A      L+ N    P        ++             W PI
Sbjct: 431 PILLSGALVMGTSLLAIA----MSLWANVAATP------RLVVVFVIIFNAFFGYSWGPI 480

Query: 451 AYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXX 510
            ++   E  P   ++   + +  +NW++ + +G  TP +   I +    +          
Sbjct: 481 PWLYPVEIAPAMARSAMASASTATNWLFNWLVGIMTPILQEKIHWRMYLIHTVSCYLSFW 540

Query: 511 XXXXXXCETKGLTLEEVNEMYQE 533
                  ET GL LE+++ ++ +
Sbjct: 541 CVLKVYPETAGLRLEDMDSVFDD 563

>Scas_632.14
          Length = 553

 Score =  129 bits (324), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 129/526 (24%), Positives = 209/526 (39%), Gaps = 98/526 (18%)

Query: 77  GGFVFGWDTGTISGFV---NMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGG 133
           GG +FG+DTG ISG +      D  R            VL++     I SI + G  IG 
Sbjct: 49  GGLLFGYDTGVISGVLLTLKPQDLSRS-----------VLTNFDKETITSITSFGSFIGS 97

Query: 134 LTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPT 193
           +    L D  GRR  L     ++++  +  +A S       +GR + G  VG  A   P 
Sbjct: 98  IIAFPLADRCGRRKTLAICCFIFIIAAL-WMAGSTTLLLLVLGRFIVGCAVGVAAQCVPI 156

Query: 194 LISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMI 253
            +SE +P  +RG  ++   L IT G  + Y   Y     +++  W+   G+  + AI ++
Sbjct: 157 YLSEISPSSIRGFILTLNSLAITGGQLLSYIAAYFLANVNHS--WRYLFGISSIPAIILM 214

Query: 254 AGMIFVPESPRYLIEKGNFEEAKRSIA-------------KSNKLTVEDSGVLAEVELIN 300
             + F+PESPR+LI KG F EA +S+              K  KL + D G L   + I 
Sbjct: 215 LLLDFIPESPRWLISKGEFSEAHKSLTMIYPTASHYQVNLKLRKLII-DLGKLRHYQDIE 273

Query: 301 AGVEAE---------------------------------KLAGNASWGELFSP------- 320
             +                                     +AG AS  +L +P       
Sbjct: 274 EPLLIRSRSFLRSLNSSLLSQNREQSTAAGGPIQPQPFTSIAGLASIADLTAPIPIPPRT 333

Query: 321 --------KGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVV 372
                   + +  + +I+GCV+   QQ+TG N F YY   IF  + +++    +I++ + 
Sbjct: 334 SKKHVHKMEARTKRALIIGCVLMFFQQITGFNAFMYYAAVIFSKLNLENPLLPAILVALT 393

Query: 373 NFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAM 432
           NF  TFV L  V++ G+R  LL+    MS+  ++  S+G  K               N M
Sbjct: 394 NFLFTFVALRYVDKIGKRLMLLYTLVVMSIG-LLLVSIGFDK---------------NNM 437

Query: 433 IXXXXXXXXXXXXXWAPIAYV--IVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFIT 490
           I              + +  V     E  PL  +    +    +NW+    +      + 
Sbjct: 438 ILILISIVIFVGGYASALGTVPWTCVEFLPLNRRAFGSSCISCTNWLTNAIVALSYLSLM 497

Query: 491 SAIGF-YYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGV 535
            +IG      +F G              E KGL+LEE+ ++++ G+
Sbjct: 498 DSIGNGNTMLIFAGFTSLAWLFVYFFYPEVKGLSLEEIGKVFEHGI 543

>Scas_552.0d
          Length = 112

 Score =  114 bits (285), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 53/95 (55%), Positives = 64/95 (67%)

Query: 468 MAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEV 527
           MA+A G NW W F I F TPFIT AI FYYGYVFMGC+            E KGLTLEEV
Sbjct: 7   MALANGCNWFWNFLISFFTPFITGAINFYYGYVFMGCMVFGYFYVFFFVPEMKGLTLEEV 66

Query: 528 NEMYQEGVLPWKSETWVPALRRNESYDVNETQEDS 562
           NE++++GVLPWKS  WVP+ RR    +++E Q+D 
Sbjct: 67  NELWEDGVLPWKSPNWVPSSRRGADVNMDEFQKDD 101

>KLLA0E02970g complement(278965..280587) similar to sgd|S0002795
           Saccharomyces cerevisiae YDR387c, start by similarity
          Length = 540

 Score =  122 bits (305), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 132/559 (23%), Positives = 224/559 (40%), Gaps = 72/559 (12%)

Query: 17  ELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAF 76
           ++   SSP    S     S+  S     T TT+    N+I Q+P         + +    
Sbjct: 4   DIVRSSSPQRDSSVEDVYSDLYSTFSQMTTTTA----NDIEQRPYPFTWRTGIMFVSSTI 59

Query: 77  GGFVFGWDTGTISG-FVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLT 135
           GG +FG+DTG ISG  + M      F + ++ +++         +I SI   G  IG + 
Sbjct: 60  GGMLFGYDTGVISGVLIAMNPKDLNFHSLEIWQKE---------IITSITCAGSFIGSII 110

Query: 136 LGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLI 195
              L D  GR+  L    +++    ++ +A S  +     GR+V G+ VG  A   P  +
Sbjct: 111 AFPLADRCGRKHTLTVCCIIFAASSML-MAVSYTFEMLVTGRLVVGIAVGIAAQCIPIYL 169

Query: 196 SETAPKHLRGTCVSFYQLMITLGIFMGYCTNY---GTKTYSNAVQWKLPLGLCFLWAIFM 252
           +E +P  +RGT ++   + IT G F  Y   Y         +   W+    L  + AI  
Sbjct: 170 TEISPAKIRGTMLTLNSISITGGQFAAYVIAYFMIDNDHPQSTAAWRYLFALGSIPAIVF 229

Query: 253 IAGMIFVPESPRYLIEKGNFEEAKRSIAKS--------------------NKLTVEDSGV 292
           +  + F+PESPR+L+ K    EA+ ++ K                     NKL   +   
Sbjct: 230 LLTLDFIPESPRWLLSKSRLVEAELALHKVYPAATVPEIRHKLRKLTSDLNKLRYHNDET 289

Query: 293 LAEVELINAGVE-AEKLAGNASWGELFSP----------KGKILQRVIMGCVIQSLQQLT 341
              +  +N     A    G +S G  +            +GK  + +I+GCV+   QQ +
Sbjct: 290 DPLLFPVNKRRSVASTRTGRSSLGATYYNEQLGKKRHRWEGKSKRALIIGCVLMFFQQTS 349

Query: 342 GNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMS 401
           G N F YY  TIF+ VG  +    +I++   NF+ T + +  ++  G+R  LL     M+
Sbjct: 350 GFNAFMYYSATIFEQVGFTNPLVPAIIVAFTNFSFTLLAMKLIDTMGKRTLLLMTIWIMT 409

Query: 402 V----CFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSE 457
           V    C V F    +  L  +      + + G  ++             W+ + ++    
Sbjct: 410 VGLLLCSVGFELNNLALLVVSVIVYVGAYATGMGVV------------PWSSVEFL---- 453

Query: 458 TYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXX-XXXXXXX 516
             PL  +    +M   +NW+    +      IT  IG     +                 
Sbjct: 454 --PLNRRAVGGSMISCTNWLTNSVLSLTYLTITDRIGNENTMLLFALFTIFNWLFVYIWY 511

Query: 517 CETKGLTLEEVNEMYQEGV 535
            E KGL+LEE+ ++++ GV
Sbjct: 512 PEVKGLSLEEIGQVFENGV 530

>KLLA0B00264g 12844..14574 gi|5441459|emb|CAB46745.1 Kluyveromyces
           lactis maltose permease, start by similarity
          Length = 576

 Score =  120 bits (302), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 132/548 (24%), Positives = 230/548 (41%), Gaps = 30/548 (5%)

Query: 2   SSSATPMNDRSNSNTELAAVSSPTD--FDSQSRTPSNKLSEDGFATKTTSPLENNEIPQK 59
           SSS+    D    + E    +S  D   D  +   S     DG A+   +  E +    +
Sbjct: 3   SSSSVLQKDTKQVDIEHREEASSNDQLVDQNALLDSFLGDVDGAASADAT--EKSMSLLE 60

Query: 60  PLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKY-VLSDVRT 118
            L +Y   +   L+V+ G  + G+DT  I+    +  F+  FG ++     + + S  + 
Sbjct: 61  GLRKYPKAVGWSLVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPSKWQI 120

Query: 119 GLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMA-VILVYVVGIIIQIASSNKWYQYFIGR 177
           GL + +   G  IG    G   D YG RL L+A ++L+     I+  A  N      IG+
Sbjct: 121 GLGMCV-ACGEIIGLQITGIFADRYGYRLVLIAGLVLLIAFNFILYFA--NSLTMIAIGQ 177

Query: 178 IVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLG--IFMGYCTNYGTKTYSNA 235
           I+SG+  G    L  +  SE  P  LR    ++  L   +G  I  G          ++ 
Sbjct: 178 ILSGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLKACQEHLANDE 237

Query: 236 VQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAE 295
           + W+LP  L ++W + +I G+   PESP +L+ KG  ++AKRS+ +   L   +   L +
Sbjct: 238 LGWRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTLPTSEKDKLTD 297

Query: 296 VEL--INAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTI 353
           + +  +   VE E    + S   +   KG   +R  + C+   +Q LTG+     Y T  
Sbjct: 298 IMITKMRMTVEKENRLASESSSYMDCFKGIDARRTRITCLTWVMQNLTGSA-LMGYSTYF 356

Query: 354 FDAVGMKDS--FQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVG 411
           ++  G+  S  F  SI+  V+    T    +   R GR   L WG    ++   +   +G
Sbjct: 357 YEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQTIVMFITGGLG 416

Query: 412 VTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMA 471
            +          +S  AG+ ++               P+ Y +VSE    R++ + + +A
Sbjct: 417 FS------SSEGASWGAGSMLLIYNFFYNSTL----GPVVYCVVSEIPSDRLRTKTVVLA 466

Query: 472 VGSNWIWGFAIGFGTPFITSAIGFYYGY---VFMGCLXXXXXXXXXXXC-ETKGLTLEEV 527
             S  +        TP++ ++  + +G    +F G L             ETKG T  E+
Sbjct: 467 RNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVWAYFDLPETKGRTFAEL 526

Query: 528 NEMYQEGV 535
           +E++ + V
Sbjct: 527 DELFHQRV 534

>ABR223C [817] [Homologous to ScYFL040W - SH] (820632..822506) [1875
           bp, 624 aa]
          Length = 624

 Score =  120 bits (302), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 99/440 (22%), Positives = 201/440 (45%), Gaps = 40/440 (9%)

Query: 78  GFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLG 137
           G V G D   ++ F++   F R F   +  EQ         G++     +    G L  G
Sbjct: 18  GLVLGIDISAMAVFISSDYFNRYFHYPNAFEQ---------GMVSGAHPMEGLTGCLLFG 68

Query: 138 RLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISE 197
            +G+   R         ++++G I+ +   +  Y   IGR + G+ VG ++V++   + E
Sbjct: 69  YVGERVSRLGCFRYFTFIWIIGCIVSVLVMDI-YMVAIGRFIKGVAVGSLSVVASVYLVE 127

Query: 198 TAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMI 257
             P + +G   +  QL +T GIF+ Y   +    ++N + +++  GL  + A+ +I+G +
Sbjct: 128 IFPSNRKGIATALVQLTLTFGIFLMYMLCWTFSRFNNHMAFRISWGLEIIPAVALISGTL 187

Query: 258 FVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGEL 317
           FVPESPR+ + +G +++A+  +     L         +  L+N   +  K    AS+ +L
Sbjct: 188 FVPESPRWFVMQGQYKKAQEIL---TLLNCRSKNEFNKQTLLNMYGDTAK----ASFKDL 240

Query: 318 FSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGM--KDSFQTSIVLGVVNFA 375
              K   ++++IMG  IQ+L Q TG N   YY   I +  G+  ++    + +  ++N  
Sbjct: 241 I--KLPYIKQLIMGMTIQALVQFTGINVVMYYVVYICEMAGLEGREKMNVASIPYLLNIL 298

Query: 376 STFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPS----------- 424
            TF+ L+ ++R  R+  +++GS A++    +   +G+T ++ +G D+             
Sbjct: 299 FTFIPLHLLDRVQRKVLIVYGSFALA---AIMNLIGLT-MWIHGHDVSPINGNPALVWKL 354

Query: 425 SKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGF 484
           S   G   I              +   ++  +E    ++++R +++ +  +WI    + F
Sbjct: 355 SPLGGQITISLCFAFIAIFASTLSCAGWLYTNEVLADKIRSRGLSICMSVSWICNAVLTF 414

Query: 485 GTPFITSAIG----FYYGYV 500
            +P + S +     F +G V
Sbjct: 415 LSPLMMSTMKWGTFFLFGMV 434

>KLLA0D00253g <12780..14534 gi|5441459|emb|CAB46745.1 Kluyveromyces
           lactis maltose permease, hypothetical start
          Length = 584

 Score =  120 bits (301), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 132/548 (24%), Positives = 230/548 (41%), Gaps = 30/548 (5%)

Query: 2   SSSATPMNDRSNSNTELAAVSSPTD--FDSQSRTPSNKLSEDGFATKTTSPLENNEIPQK 59
           SSS+    D    + E    +S  D   D  +   S     DG A+   +  E +    +
Sbjct: 11  SSSSVLQKDTKQVDIEHREEASSNDQLVDQNALLDSFLGDVDGAASADAT--EKSMSLLE 68

Query: 60  PLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKY-VLSDVRT 118
            L +Y   +   L+V+ G  + G+DT  I+    +  F+  FG ++     + + S  + 
Sbjct: 69  GLRKYPKAVGWSLVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPSKWQI 128

Query: 119 GLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMA-VILVYVVGIIIQIASSNKWYQYFIGR 177
           GL + +   G  IG    G   D YG RL L+A ++L+     I+  A  N      IG+
Sbjct: 129 GLGMCV-ACGEIIGLQITGIFADRYGYRLVLIAGLVLLIAFNFILYFA--NSLTMIAIGQ 185

Query: 178 IVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLG--IFMGYCTNYGTKTYSNA 235
           I+SG+  G    L  +  SE  P  LR    ++  L   +G  I  G          ++ 
Sbjct: 186 ILSGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLKACQEHLANDE 245

Query: 236 VQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAE 295
           + W+LP  L ++W + +I G+   PESP +L+ KG  ++AKRS+ +   L   +   L +
Sbjct: 246 LGWRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTLPTSEKDKLTD 305

Query: 296 VEL--INAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTI 353
           + +  +   VE E    + S   +   KG   +R  + C+   +Q LTG+     Y T  
Sbjct: 306 IMITKMRMTVEKENRLASESSSYMDCFKGIDARRTRITCLTWVMQNLTGSA-LMGYSTYF 364

Query: 354 FDAVGMKDS--FQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVG 411
           ++  G+  S  F  SI+  V+    T    +   R GR   L WG    ++   +   +G
Sbjct: 365 YEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQTIVMFITGGLG 424

Query: 412 VTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMA 471
            +          +S  AG+ ++               P+ Y +VSE    R++ + + +A
Sbjct: 425 FS------SSEGASWGAGSMLLIYNFFYNSTL----GPVVYCVVSEIPSDRLRTKTVVLA 474

Query: 472 VGSNWIWGFAIGFGTPFITSAIGFYYGY---VFMGCLXXXXXXXXXXXC-ETKGLTLEEV 527
             S  +        TP++ ++  + +G    +F G L             ETKG T  E+
Sbjct: 475 RNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVWAYFDLPETKGRTFAEL 534

Query: 528 NEMYQEGV 535
           +E++ + V
Sbjct: 535 DELFHQRV 542

>YDR387C (YDR387C) [1215] chr4 complement(1248142..1249809) Member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1668 bp, 555 aa]
          Length = 555

 Score =  119 bits (297), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 107/411 (26%), Positives = 169/411 (41%), Gaps = 73/411 (17%)

Query: 54  NEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVL 113
           N+I Q P +       + +    GG +FG+DTG ISG   +   K             VL
Sbjct: 26  NDIEQLPYALTFKTSLIFVGATIGGLLFGYDTGVISGV--LLSLKPE------DLSLVVL 77

Query: 114 SDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQY 173
           +DV+  LI S  ++G   G +    L D YGRR+ L     ++++   I +A +      
Sbjct: 78  TDVQKELITSSTSVGSFFGSILAFPLADRYGRRITLAICCSIFILA-AIGMAIARTLTFL 136

Query: 174 FIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYS 233
             GR++ G+ VG  A   P  +SE +P  +RG  ++   + IT G  + Y      K   
Sbjct: 137 ICGRLLVGIAVGVSAQCVPLFLSEISPSRIRGFMLTLNIIAITGGQLVSYVIASLMKEID 196

Query: 234 NAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSI-------------A 280
           N+  W+    L  + AI  ++ + F+PESPR+ I KG+    + S+             +
Sbjct: 197 NS--WRYLFALSAIPAILFLSILDFIPESPRWSISKGDILYTRDSLRMLYPTASTYHVNS 254

Query: 281 KSNKLTVE----------------------------DSGVLAEVELINAGVEAEKLA--- 309
           K  +L +E                             SG L+   +       E+ +   
Sbjct: 255 KIKQLIIELDKLRLYEDASEPLLVQSQSVIRYMDSSTSGTLSPPNIKRLSSNTERTSNTM 314

Query: 310 -----------GNASWGELFSPKGK-------ILQRVIMGCVIQSLQQLTGNNYFFYYGT 351
                      G A  G L S K K        ++ +I+GC++   QQ+TG N F YY  
Sbjct: 315 SSSSAYLSALRGPAPNGALASNKKKRHRMEPRTIRALIVGCMLMFFQQITGFNAFMYYAA 374

Query: 352 TIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSV 402
            IF    +K+     I++   NF  TF  +YT++  GRR  LL     M+V
Sbjct: 375 IIFSKFNIKNPLLPPILIASTNFIFTFFAMYTMDSLGRRAILLRTILIMTV 425

>Kwal_34.16266
          Length = 158

 Score =  109 bits (273), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 88/157 (56%), Gaps = 2/157 (1%)

Query: 377 TFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXX 436
           T+V ++  +  GR+K LLWGS +  +C  +F++VGV  +  +  D P  K +G  MI   
Sbjct: 2   TYVSIFVADNLGRKKGLLWGSISCFICLFIFSTVGVVMV-DHAAD-PDYKLSGYVMIIFT 59

Query: 437 XXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFY 496
                     W+ IA V+VSE + L +K++AMA++   NW   F I   TP IT+ IG+ 
Sbjct: 60  CFFVVSFCCSWSAIASVLVSEIFTLEIKSQAMALSQAFNWGANFFIALCTPIITARIGYA 119

Query: 497 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQE 533
           +GYVF G +            ETKGLTLEE++E Y++
Sbjct: 120 FGYVFTGFMFVAIFFVYVFIPETKGLTLEEIDEFYEK 156

>KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromyces
           lactis YGL104C, start by similarity
          Length = 528

 Score =  117 bits (293), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 121/520 (23%), Positives = 215/520 (41%), Gaps = 88/520 (16%)

Query: 35  SNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNM 94
           +N+L   G A +  + LEN     K ++    ++   L+   G   +G+  G ++   + 
Sbjct: 4   NNRLLPHGRADELNN-LENASSNNKGVTFTPHLLLSMLVACLGSLQYGYHMGELNAPEDY 62

Query: 95  TDFKRR----FGNFDVGE----QKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRR 146
              K      + +  +G     Q   L+D + GLI S+F++G  IG L  G L D YGR+
Sbjct: 63  ITCKAELNPGYADSFLGRLGLAQCIPLTDSQFGLITSVFSVGGLIGSLVAGPLADSYGRK 122

Query: 147 --------LGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISET 198
                   +G++  + ++         SSN +     GR+++G+  G + V++P  I+E 
Sbjct: 123 PISYWNCSVGILGAVCLF---------SSNNYLGMLFGRLLAGISCGSLIVVTPLFINEM 173

Query: 199 APKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIF 258
           +P HL+G+  S  Q+ I  GI +   T      ++N +QW+  L    L ++     +  
Sbjct: 174 SPVHLKGSLGSMNQVSINCGILV---TQSLAMLWANMLQWRWILLFGGLISLLNFGLLFR 230

Query: 259 VPESPRYLIEKGNFEEAKRSIAKSNKLTVEDS--------------GVLAEVEL-----I 299
           + ESPR+L+ KGN  +A+  +++    + ++S                 +++E      +
Sbjct: 231 INESPRWLVSKGNMTDAEDVLSQLRGNSRQESRQEIDGWLQGSQPVRTFSDLEAHTNSQM 290

Query: 300 NAGV---------------EAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNN 344
           N G                ++E +     W +   PK K  +RVI    I   QQ  G N
Sbjct: 291 NLGSNLNLERPSSTRSSLRDSESITVVEYWKD---PKYKYPRRVI--TTILMAQQFCGIN 345

Query: 345 YFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVC- 403
              +YG  +        +   +  + +VN   TF     V+ +GR+  L+  S  MS+C 
Sbjct: 346 SIVFYGVKVIKKAFPDTAIIINFAISIVNVLMTFFSSPLVDHWGRKPLLISSSTLMSICS 405

Query: 404 -FVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLR 462
             + F  VG               +A   ++               PI ++I+SE     
Sbjct: 406 FMICFGIVG---------------NAPMILVIFVILYITAFAGGLGPIPFLIISELSHPE 450

Query: 463 VKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFM 502
               A +     NWI  F +G+G P + S +    GYVF+
Sbjct: 451 TVGVAQSYGTTMNWIATFMVGYGFPALNSVMD---GYVFL 487

>KLLA0D00374g 30962..32632 weakly similar to sp|Q9P8X7 Aspergillus
           parasiticus Hexose transporter protein, start by
           similarity
          Length = 556

 Score =  117 bits (292), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 115/484 (23%), Positives = 206/484 (42%), Gaps = 53/484 (10%)

Query: 81  FGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLG 140
            G+D   ++G   M D+    GN +  E             + + + G   G L L +L 
Sbjct: 67  LGYDGSLLNGLYAMPDYLNAMGNPNGAE-------------LGVISNGMVFGMLILFQLA 113

Query: 141 ----DMYGRRLGLMAVILVYVVGIIIQIASSNKWYQ--------------YFIGRIVSGL 182
               D YGR++G+    ++  +G++IQ A S  W                +   RI+ G 
Sbjct: 114 PYIIDKYGRKVGMYVGNVLICIGVLIQ-ALSGTWINGLPEDYDKKDVFGMFVASRIILGS 172

Query: 183 GVGGIAVLSPTLISETA-PKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLP 241
           GV  I++ +P LISE + P H R  C S Y     LG  +     YG +  ++   W++P
Sbjct: 173 GVLLISIATPALISEISYPPH-RELCTSIYNTCWYLGAIVSAWVTYGCRNLAHHWNWRIP 231

Query: 242 LGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVEL--I 299
             +  L+ +  +  +   PESPRYL+      EA+  + K +    E+   L + EL  I
Sbjct: 232 SIIQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAGNNEEYAGLIDFELAEI 291

Query: 300 NAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGM 359
              +E EK + +  + +     G    R+ +        QL+GN    YY + +F+++G+
Sbjct: 292 KLAIEQEKASQSTKFSDFIKTSGN-RHRLWILIWTAIFTQLSGNGLVSYYLSKVFNSIGI 350

Query: 360 ---KDSFQTSIVLGVVNFASTFVGL-YTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKL 415
               D  + +  L + N+  + + + Y    + RR+  L    +M+ C+VV+ ++     
Sbjct: 351 TDPDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQLFLISLVSMTSCYVVWTALSAENQ 410

Query: 416 YPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMA---MAV 472
             N +D    KS  N ++             +     +  +E  P  ++ + +    +A+
Sbjct: 411 KRNFED----KSLANGVLAMIFLYYLSYNFGFNGFPNLYTTEILPYTLRGKGLTIFQLAI 466

Query: 473 GSNWIWGFAIGFGTPFITSAIGFYYGYVFMGC-LXXXXXXXXXXXCETKGLTLEEVNEMY 531
             + I+    GF  P    AI + Y Y+F  C L            ET G +LEEV+E++
Sbjct: 467 SISVIFN---GFVNPVAMDAIEWKY-YIFYCCFLAVEIVVCYFTFVETSGRSLEEVDEVF 522

Query: 532 QEGV 535
            +G+
Sbjct: 523 GDGI 526

>Kwal_27.12811
          Length = 181

 Score =  107 bits (268), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 62/176 (35%), Positives = 97/176 (55%), Gaps = 13/176 (7%)

Query: 72  LMVAFGGFVFGWDTGTISGFVNMTDFKRRF---GNFDVGEQKYVLSDVRTGLIVSIFNIG 128
           L VAFG  +FG++TGTISG + M   K++F   G+F   E         T LI  I + G
Sbjct: 16  LFVAFGDILFGYNTGTISGMLAMDYVKQQFTSRGHFTADE---------TSLITEILSAG 66

Query: 129 CAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIA 188
              G +      D  G RLGL+   +++  G+I+Q+A++ +      GR+++G GVG ++
Sbjct: 67  TFCGAILAPLASDTIGHRLGLILSTIIFTFGVILQVAATGQ-DLLIAGRVIAGAGVGVLS 125

Query: 189 VLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGL 244
            + P   SE +PK +RG  VS YQ  IT+G+ +  C N GT    ++  +++PL L
Sbjct: 126 AIVPLYQSEASPKWIRGAVVSCYQWAITIGLLLAACVNQGTHARQDSGSYRIPLAL 181

>AFL034W [3159] [Homologous to ScYBR241C - SH; ScYGL104C - SH]
           complement(371827..373251) [1425 bp, 474 aa]
          Length = 474

 Score =  114 bits (284), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 119/476 (25%), Positives = 199/476 (41%), Gaps = 46/476 (9%)

Query: 38  LSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDF 97
           +S+D     +  P   +  P   L+  + V+CL      G   FG+    ++      + 
Sbjct: 1   MSQDQLLLGSERPPRGSVTP--ALAGSVFVVCL------GALQFGYHMAELNA---PQEV 49

Query: 98  KRRFGNFDVG-----------EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRR 146
               G  D G           EQ   L D + GL+ SIF++G  +G L  G   D YGRR
Sbjct: 50  LMCHGPLDPGYADTWWGRHGWEQCLHLDDSQYGLVTSIFSVGGLLGSLCTGSQADRYGRR 109

Query: 147 LGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGT 206
              +   ++   G    +  +N + Q  +GR+V+G+G GG  V++  +++E AP  L+G 
Sbjct: 110 AAAIGSSVLAAAGSAAMV-FANSYAQLLLGRLVAGVGCGGGIVVTSLMLNEMAPAELKGA 168

Query: 207 CVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYL 266
             +  Q  I LGI +   T      ++N+VQW+L   +    A+     ++ V ESPR+L
Sbjct: 169 LGALNQTCINLGILV---TQLLAFAWANSVQWRLLFAVSAAVAVAHCGLLLGVEESPRWL 225

Query: 267 IEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPKGKILQ 326
              G+ + A+R++     L  +D+    E+       E E  A  +S     +       
Sbjct: 226 AANGHEQRAERAL---RWLRADDAAAAHELREWRRAREHEAAAQCSSLRRYIADARYAHV 282

Query: 327 RVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVER 386
           R ++  ++   QQ  G N   +YG  + +      S   +  +  VN   T      V+R
Sbjct: 283 RCVVAVLLMG-QQFCGINSIVFYGVKLINGALPGLSIAVNFGISAVNLVVTLTAAALVDR 341

Query: 387 YGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXX 446
            GRR  L   +AAM+V          + L   G  + S+      ++             
Sbjct: 342 VGRRPLLQCSAAAMAV---------ASTLMAAGILLESAA----VLVVCTFAYITFFALG 388

Query: 447 WAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFM 502
           + PI ++I++E         A +  +  NW+  F +GFG P +   IG   GYVFM
Sbjct: 389 FGPIPFLIIAELSSPGTAAVAQSYGLALNWVATFFVGFGFPVLNQLIG---GYVFM 441

>KLLA0E25025g complement(2219051..2220721) weakly similar to
           sp|P32466 Saccharomyces cerevisiae YDR345c HXT3
           low-affinity hexose transporter P33.1.f24.1,
           hypothetical start
          Length = 556

 Score =  114 bits (286), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 124/548 (22%), Positives = 230/548 (41%), Gaps = 63/548 (11%)

Query: 28  DSQSRTPSNKLSEDGFATKTTSP-----LENNEIPQ--KPLSEYILVMCLCLMV---AFG 77
           DS S    NK+++   A K ++      + ++ +P   KP  +   +  L   +   +  
Sbjct: 4   DSVSDKAKNKITDSCSADKVSADERYHMVMSDVLPDLGKPFYKVPYLRTLSWFIVGLSLS 63

Query: 78  GFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLG 137
               G+D   ++G   M D+    GN +  E             + + + G   G L L 
Sbjct: 64  STNLGYDGSLLNGLYAMPDYLNAMGNPNGAE-------------LGVISNGMVFGMLILF 110

Query: 138 RLG----DMYGRRLGLMAVILVYVVGIIIQIASSNKWYQ--------------YFIGRIV 179
           +L     D YGR++G+    ++  +G++IQ A S  W                +   RI+
Sbjct: 111 QLAPFIIDKYGRKVGMYVGNVLICIGVLIQ-ALSGTWINGLPEDYDRKDVFGMFVASRII 169

Query: 180 SGLGVGGIAVLSPTLISETA-PKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQW 238
            G GV  I++ +P LISE + P H R  C S Y     LG  +     YG +  ++   W
Sbjct: 170 LGSGVLLISIATPALISEISYPPH-RELCTSIYNTCWYLGAIVSAWVTYGCRNLAHHWNW 228

Query: 239 KLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVEL 298
           ++P  +  L+ +  +  +   PESPRYL+      EA+  + K +    E+   L + EL
Sbjct: 229 RIPSIIQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAGNNEEYAGLIDFEL 288

Query: 299 --INAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDA 356
             I   +E EK + +  + +     G    R+ +        QL+GN    YY + +F++
Sbjct: 289 AEIKLAIEQEKASQSTKFSDFIKTSGN-RHRLWILIWTAIFTQLSGNGLVSYYLSKVFNS 347

Query: 357 VGM---KDSFQTSIVLGVVNFASTFVGL-YTVERYGRRKCLLWGSAAMSVCFVVFASVGV 412
           +G+    D  + +  L + N+  + + + Y    + RR+  L    +M+ C+VV+ ++  
Sbjct: 348 IGITDPDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQLFLISLVSMTSCYVVWTALSA 407

Query: 413 TKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMA--- 469
                N +D    K+  N ++             +     +  +E  P  ++ + +    
Sbjct: 408 ENQKRNFED----KTLANGVLAMIFLYYLSYNFGFNGFPNLYTTEILPYTLRGKGLTIFQ 463

Query: 470 MAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGC-LXXXXXXXXXXXCETKGLTLEEVN 528
           +A+  + I+    GF  P    AI + Y Y+F  C L            ET G +LEEV+
Sbjct: 464 LAISISVIFN---GFVNPIAMDAIEWKY-YIFYCCFLSVEIVVCYFTFVETSGRSLEEVD 519

Query: 529 EMYQEGVL 536
           E++ + ++
Sbjct: 520 EVFGDRII 527

>Kwal_55.21289
          Length = 537

 Score =  112 bits (281), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 129/556 (23%), Positives = 225/556 (40%), Gaps = 82/556 (14%)

Query: 31  SRTPSNKLSEDGFA---------TKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGGFVF 81
           SR   N   ED ++         T TT+     +I  +  S     + + L  + GG +F
Sbjct: 3   SRLSGNAEVEDVYSDLYSAFSQLTDTTA----RDIDHRHYSLTWKTLNIYLGASIGGLLF 58

Query: 82  GWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGD 141
           G+DTG I+G +       + G+  +     +L D +  +I  +  IG  +G +   +L +
Sbjct: 59  GYDTGVIAGVL----LGLKPGDLGLD----ILQDHQKEVITGVTGIGSVMGSMVAFKLAN 110

Query: 142 MYGRRL--GLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETA 199
             GRRL  GL +V+      ++    S   +     GR++ G+ +G  A   P  +SE +
Sbjct: 111 CLGRRLTLGLCSVVFTLAAALMALALS---FRALVAGRLIVGVAIGIAAQCVPLYLSEIS 167

Query: 200 PKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFV 259
           P   RGT ++F    IT G  +     +      N+  W+   G   + ++ ++  + F+
Sbjct: 168 PSSRRGTILAFNTSAITGGQLLASLIAWAIIDKPNS--WRYLFGASAIPSLLLLFTLKFI 225

Query: 260 PESPRYLIEKGNFEEAK-----------------------RSIAKSNKLTVEDSGVLAE- 295
           PESPR+L+     + A+                       R + K  K   E+  +L+  
Sbjct: 226 PESPRWLLLTEQPQRAREAIETMYPEASELEINDKLTKMGRDLTKLRKYQDENQPLLSRR 285

Query: 296 ---VELINAGVEAEKLA----------GNASWGELFSPKGKILQR--VIMGCVIQSLQQL 340
                  N+G  ++ +A           N   G     K +   R  +++GC++   QQ 
Sbjct: 286 PEASRRYNSGSSSDNIALARDFTHSIRSNNRRGLKIKHKLEPRTRRALLVGCLLMFFQQA 345

Query: 341 TGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAM 400
           TG N F YY   I   +G+ D    +I +  VNFA T V +  V+ YGRR  LL+    M
Sbjct: 346 TGFNAFIYYSPVILLRIGVSDPLLPAIGIAFVNFAFTGVAMKVVDHYGRRTALLYTVWIM 405

Query: 401 SVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYP 460
           +V  +V  S G+   Y N     SS   G+ ++             W  + ++      P
Sbjct: 406 TVGLIV-GSAGLQ--YNN-----SSLFLGSLLVFIAGYAAGIGSVPWMSVEFL------P 451

Query: 461 LRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXX-XXXXXXXCET 519
           L  ++   +    +NW   FA+      +   IG     +    +             E 
Sbjct: 452 LNQRSFGASCIACTNWFTNFAVSISFLSMIRIIGGEASMLIFAAMSALGWLFVYFWYPEV 511

Query: 520 KGLTLEEVNEMYQEGV 535
           KGL+LEE+ ++++ G+
Sbjct: 512 KGLSLEEIGQVFETGI 527

>KLLA0E14696g 1309427..1310860 weakly similar to sp|Q9P8X7
           Aspergillus parasiticus Hexose transporter protein,
           hypothetical start
          Length = 477

 Score =  109 bits (273), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 104/424 (24%), Positives = 184/424 (43%), Gaps = 44/424 (10%)

Query: 141 DMYGRRLGLMAVILVYVVGIIIQIASSNKWYQ--------------YFIGRIVSGLGVGG 186
           D YGR++G+    ++  +G++IQ A S  W                +   RIV G GV  
Sbjct: 39  DKYGRKVGMYVGNVLICIGVLIQ-AVSGAWINGLPEDYDKKDVFGMFVASRIVLGTGVLL 97

Query: 187 IAVLSPTLISETA-PKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLC 245
           I++ +P LISE + P H R  C S Y     LG  +     YG +  ++   W++P  + 
Sbjct: 98  ISISTPALISEISYPPH-RELCTSIYNTCWYLGAVVSAWVTYGCRNLAHHWNWRIPSIIQ 156

Query: 246 FLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVEL--INAGV 303
             + I  +  +   PESPRYL+      EA+  + K +    E+   L + EL  I   +
Sbjct: 157 AFFPIVQLIVLYNCPESPRYLVFHNRDSEARAILNKYHAGDNEEYAGLIDFELAEIKLAI 216

Query: 304 EAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKD-- 361
           E EK +   ++ + F   G    R+ +        QL+GN    YY + +F+++G+ D  
Sbjct: 217 EQEKASQATNFSDFFKTSGN-RHRLWILIWTAIFTQLSGNGLVSYYLSKVFNSIGITDPD 275

Query: 362 -SFQTSIVLGVVNFASTFVGL-YTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNG 419
              + +  L + N+  + + + Y    + RR+  L    +M+ C++V+ ++       N 
Sbjct: 276 EQLEWNGWLMLYNWLCSLILMSYIAPFFKRRQLFLISLTSMACCYIVWTALSAENQKRNF 335

Query: 420 KDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNR-------AMAMAV 472
           +D    KS  N ++             +    ++  +E  P  ++ +       A+++AV
Sbjct: 336 ED----KSLANGVLAMIFLYYLSYNFGFNGYPFLYTTEILPYTLRGKGLTIFQLAISLAV 391

Query: 473 GSNWIWGFAIGFGTPFITSAIGFYYGYVFMGC-LXXXXXXXXXXXCETKGLTLEEVNEMY 531
             N       GF       AI + Y Y+F  C L            ET G +LEEV+E++
Sbjct: 392 IFN-------GFVNSIAMDAIEWKY-YIFYCCFLAVEIVVCYFTFVETSGRSLEEVDEVF 443

Query: 532 QEGV 535
            +G+
Sbjct: 444 GDGI 447

>KLLA0E08987g 804915..806615 gi|22293246|emb|CAC79614.1
           Kluyveromyces lactis hexose transporter, start by
           similarity
          Length = 566

 Score =  109 bits (273), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 114/482 (23%), Positives = 211/482 (43%), Gaps = 46/482 (9%)

Query: 66  LVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIF 125
           +V+ L    +F G + G D  TISG            ++ +     + SD    LI S+ 
Sbjct: 91  MVIMLGFFASFAGILSGVDQSTISG-----------ASYGMKASLKLTSD-EDSLISSLM 138

Query: 126 NIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVG 185
            +G   G + L  L + +GR++ L+   + Y +G I+  A++   +  + GR + G+GVG
Sbjct: 139 PLGAVGGSILLTPLSEYFGRKVALVISCIFYTIGGIL-CAAAQDVHTMYAGRFLIGVGVG 197

Query: 186 GIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLC 245
                    I+E+ P  +RG+ VS YQ  I LG  +GY    G   +     W+  LG  
Sbjct: 198 IEGGGVGVYIAESVPSTVRGSLVSLYQFNIALGELVGYVI--GVIFFDVKGGWRYMLGSS 255

Query: 246 FLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEA 305
            +++  +  G+ F+PESPR+LI KG   EA + + +  + T +       +E+ +A  + 
Sbjct: 256 LVFSTILFVGLFFLPESPRWLIHKGYDVEAYK-VWRRLRDTSDLGNKREFLEMKHAAEQD 314

Query: 306 EKLAGNAS-----WGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGM- 359
            +L    S     +  +  P+ +  + ++   ++ SL QLTG N   YY +T+   +G  
Sbjct: 315 RQLKEQESRFKSMFDLILIPRNR--RALLYSIMMVSLGQLTGINAIMYYMSTLMGQIGFS 372

Query: 360 -KDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCF-VVFASVGVTKLYP 417
            K +   S+V G      T   +  ++++GRR    W    +     +V   VG      
Sbjct: 373 PKQAVAMSMVGGAALLIGTIPAILYMDKFGRRP---WSMTIIGFSVGLVLVGVGYQ---- 425

Query: 418 NGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWI 477
              D+ ++ +A   +              +A + +V+ SE++ L  ++  M +     ++
Sbjct: 426 --IDLNTNLAAAEGVYLTGQILYNIFFGTYATLTWVVPSESFSLATRSIGMTICSAFLYL 483

Query: 478 WGFAIGFGTPFITSA-------IGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEM 530
           W F + +    +  A       +GFY G      +            ETK  TLEE++++
Sbjct: 484 WAFTVTYNFNKMKDAFTYTGLTLGFYGGI----AIVIGIPYQLLFMPETKDKTLEEIDDI 539

Query: 531 YQ 532
           ++
Sbjct: 540 FE 541

>Kwal_14.1105
          Length = 522

 Score =  108 bits (270), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 110/475 (23%), Positives = 206/475 (43%), Gaps = 30/475 (6%)

Query: 73  MVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIG 132
           ++A  G + G D  +IS F+    FK  F N     Q         G++     +G  +G
Sbjct: 14  ILAVAGTILGMDISSISIFLTSDFFKSYFNNPGPAAQ---------GIMTGANPVGGLVG 64

Query: 133 GLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSP 192
            +  G L +  GR      + L++++G I      N W    +GR+V G+ VG  +VL P
Sbjct: 65  CVLFGVLTERTGRVSTFRILSLIWILGSIFSALVLNVW-MITVGRLVRGMAVGSFSVLLP 123

Query: 193 TLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFM 252
             I E  P H +GT  +  QL IT  I + +   +      +   +++  GL  + A+ +
Sbjct: 124 VYIGEVIPAHKKGTATAVVQLSITSAILVTFFVCFLLSFLGDQASFRIAWGLEMIPALLV 183

Query: 253 IAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNA 312
           +     + ESP++L+  G +++A+  +       +    V   V +  + ++  +L G A
Sbjct: 184 LLLSFSLIESPKWLVSHGEYDKAREILQHFKPPGMPGEKVTNNVRV--SKIDILELYGTA 241

Query: 313 S---WGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGM--KDSFQTSI 367
               + +LFS    + +  I G  IQ L Q  G N   +Y   I + +G+  K+    ++
Sbjct: 242 QKTRYSDLFS--RSLWKHTIAGITIQVLVQTCGINTLMFYIVYICEMIGLRGKNKLVAAL 299

Query: 368 VLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASV----GVTKLYPNGKDMP 423
           +  ++N   TFV + T++   R+  ++ G   ++   ++        G      NG    
Sbjct: 300 IPCLINVVFTFVPILTLDHLRRKVVIVSGGFTLAAIMILIGGTMGVFGHAVATVNGNSTV 359

Query: 424 SSK---SAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGF 480
           + K   ++G  ++              +  A++  SE +PLR K + MA  +  +W    
Sbjct: 360 TWKVEGASGFLVMALCFLFVAIFASTLSCCAWLYTSEIFPLRAKPKGMAFCMAISWFLNA 419

Query: 481 AIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXC--ETKGLTLEEVNEMYQE 533
            + F TP + S I +   +V +GC+           C  ET GLT ++V  ++++
Sbjct: 420 TLTFTTPLLLSKIRWVL-FVLLGCI-TCALTVLIGVCFPETLGLTEQQVCNLFKD 472

>Kwal_27.12815
          Length = 198

 Score = 98.6 bits (244), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 99/200 (49%), Gaps = 23/200 (11%)

Query: 369 LGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSA 428
           + VVN   T  G+  VE  GRR  LLWG+  M V  ++ A+VG          +P S SA
Sbjct: 1   MNVVNVIMTIPGIALVEIAGRRNLLLWGAVGMCVSELIVAAVGTA--------LPDSFSA 52

Query: 429 GNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPF 488
              +I             W P+A+V+V E +PLRV+ +++A+   SNW++ FAI + TP+
Sbjct: 53  NKTLIAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAVCAASNWLFNFAIVYATPY 112

Query: 489 IT--------SAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPWKS 540
           +         S + F +G    GC             ETKGLTLE+++++++      +S
Sbjct: 113 LVDSEHANLQSKLFFIWG----GCTFLCFLFVYFFIYETKGLTLEQIDQLFETCSSARQS 168

Query: 541 ETWVPALR---RNESYDVNE 557
           + ++P  R    N S  ++E
Sbjct: 169 KGFIPTERLETDNASPSISE 188

>YBR241C (YBR241C) [420] chr2 complement(702546..704012) Member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1467 bp, 488 aa]
          Length = 488

 Score =  103 bits (258), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 102/398 (25%), Positives = 168/398 (42%), Gaps = 31/398 (7%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           +Q   L+D + G I SIF+IG   G    G   + YGR+   M    + +V  ++ +  S
Sbjct: 77  KQCIALTDSQYGAITSIFSIGGLFGSYYAGNWANRYGRKYVSMGASAMCMVSSLL-LFFS 135

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNY 227
           N + Q   GR + G+  G   V++P  I+E AP   RG   S  Q+ I LGI +   T  
Sbjct: 136 NSYLQLLFGRFLVGMSCGTAIVITPLFINEIAPVEWRGAMGSMNQVSINLGILL---TQT 192

Query: 228 GTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTV 287
               Y+++  W+  L    + A+  I   + V ESPR+L+  G   EA+ ++ K    T 
Sbjct: 193 LALKYADSYNWRWLLFSGSVIAVANILAWLKVDESPRWLVSHGFVSEAETALFKLRPGTY 252

Query: 288 EDSGVLAEVELINAG------VEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLT 341
           + +    +    + G         E  +G   W  +  P  K  + VI+   I S QQ  
Sbjct: 253 QQAKQEIQDWQRSHGHNRDPESSEETHSGPTLWQYVTDPSYKKPRTVILA--ILSCQQFC 310

Query: 342 GNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMS 401
           G N   +YG  +   +    S Q +  + ++N   T      ++  GRR  LL  +  M+
Sbjct: 311 GINSIIFYGVKVIGKILPDYSIQVNFAISILNVVVTLAASAIIDHVGRRPLLLASTTVMT 370

Query: 402 VCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSE-TYP 460
               +  SVG+T             S    ++               PI ++I+ E +YP
Sbjct: 371 -AMSLLISVGLT------------LSVSFLLVTATFVYIAAFAIGLGPIPFLIIGELSYP 417

Query: 461 LRVKNRAMAMAVGS--NWIWGFAIGFGTPFITSAIGFY 496
              ++ A A + G+  NW+  F +G+  P     +G Y
Sbjct: 418 ---QDAATAQSFGTVCNWLATFIVGYLFPIGHGLMGGY 452

>Kwal_33.12950
          Length = 566

 Score =  103 bits (258), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 124/488 (25%), Positives = 206/488 (42%), Gaps = 36/488 (7%)

Query: 57  PQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDV 116
           P   LS+++++  LC   +     FG D   I G V    ++ +F   DV  Q       
Sbjct: 92  PLLCLSKHMILAALC--TSLAALNFGMDESAIGGAV--LQYQNQFNITDVNIQ------- 140

Query: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMY-GRRLGLMAVILVYVVGIIIQIASSNKWYQYFI 175
             GL V+   +  A  G  L    D Y GRR  +    L+   G +IQ   +N +     
Sbjct: 141 --GLTVAAPYLAAACIGSPLTVYLDKYTGRRWIVFWSCLIGFAGSLIQ-GFANGFGCLLF 197

Query: 176 GRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNA 235
            R++ G+G+G  +   P   +E +P + RG  +  +Q  I LG+ +G   N      + +
Sbjct: 198 ARLLLGVGMGLNSATVPIYTAECSPANSRGALLMLWQTFIALGVCLGSVFNRAFVNINGS 257

Query: 236 VQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVED-SGVLA 294
           + W+L +G   +  +   A + F PESPR+L+     + AK+++    KL   D SG   
Sbjct: 258 LSWRLMIGSSAVAPVITAALIFFPPESPRWLVVH---KRAKQALISLTKLRPNDLSGARD 314

Query: 295 EVELINA-GVEAEKLAGNASWGE---LFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYG 350
              LI++   EAE     + W +   LFS K      ++    I   QQ  G N    Y 
Sbjct: 315 FYILIDSLKFEAELNNNLSPWNQFVSLFSNKRNRFALIVSLIGILG-QQYGGVNILVSYT 373

Query: 351 TTIFDAVGMK--DSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFA 408
           TTI    G+    +   SI +G   F +T +    ++R+GRRK LL+     ++C     
Sbjct: 374 TTILTKAGVDPVTAIAGSIGIGGGCFLATLLSAQLIDRFGRRKMLLYTLPVEALCLFWLG 433

Query: 409 SVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAM 468
            V          ++ ++KS   A +               P+++ +V+ET  + V+    
Sbjct: 434 GV---------LNVTNAKSRLGAGLASMYVYVLFYGTGIGPVSFTLVAETSSISVRMAHS 484

Query: 469 AMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXC-ETKGLTLEEV 527
           +  +  NWI  F +    P + S +    G  F G               ETK  TLE++
Sbjct: 485 STCMFVNWILDFCLSMTWPKMDSTMSTSGGLYFYGGFNIVVWTLAFLCIPETKQFTLEQL 544

Query: 528 NEMYQEGV 535
           +E+++ GV
Sbjct: 545 DEIFKVGV 552

>Kwal_27.10664
          Length = 653

 Score =  102 bits (254), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 134/538 (24%), Positives = 218/538 (40%), Gaps = 63/538 (11%)

Query: 19  AAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGG 78
           A    PT +D  S      LSED    +     E+N   +    + I ++C   M   G 
Sbjct: 93  ALARRPTQYDHMS-----FLSED---ERIACYEEDNHPFRNLPRKLIAIICASAM---GA 141

Query: 79  FVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCA-IGGLTLG 137
            V G D   I+G  N+  + R+     +G       + R GL+     + CA +      
Sbjct: 142 AVQGMDETVING-ANLF-YPRQLA---LGHGT-AYDEWREGLVNGAPYLCCAAVSCWMTD 195

Query: 138 RLGDMYGRRLGLMAVILVYVVGIIIQIAS---SNKWYQYFIGRIVSGLGVGGIAVLSPTL 194
            L +  GR+  +     V  +  ++Q  +      W+  F  R + GLG+G  +      
Sbjct: 196 WLNNWLGRKRVIFWTCAVSAITCLLQAFAPTGERGWHYLFAMRFLLGLGIGPKSATVSVY 255

Query: 195 ISETAPKHLRGTCVSFYQLMITLGIFMGYCTNY-----GTKTYSNAVQWKLPLGLCFLWA 249
           ++E + K LRG     +Q     GI  GY  +      G+   S  + W+L L    + A
Sbjct: 256 LAECSTKKLRGIICMNWQTFTAFGIMWGYVFSLIFYRVGSGAVSGGLNWRLTLASAMIPA 315

Query: 250 IFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGV---EAE 306
           IF++  + + PESPR+L+ KG + EA  S  +     +    +LA  +L    V   E E
Sbjct: 316 IFVLFQIPYCPESPRWLMGKGRYLEAYESTVQ-----IRPHRILACRDLFYQHVLLMEEE 370

Query: 307 KLAGN--ASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKD--S 362
            L        GE+F+ + +     I   +   +QQ    N   YY + IF   G  +  S
Sbjct: 371 SLEKPYFKRLGEVFTVR-RNRNAFIAAFICAFMQQFCAINVIAYYSSAIFLQSGFSEISS 429

Query: 363 FQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDM 422
              S+  G+VNF       + ++R+GRR  LL    AM+V   +    G     P+ +  
Sbjct: 430 LCASLGFGLVNFFFAIPAFFMIDRFGRRFLLLSTFPAMAVFLFI---TGFAFWIPDQQTR 486

Query: 423 PSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGF-- 480
               S G  +                 + +V+  E +PL V  RA+  ++ +  +WGF  
Sbjct: 487 IGIVSMGIYIFSAIYSFGCGV------VPFVVAGEVFPLYV--RAIGASLFTIILWGFNF 538

Query: 481 AIGFGTPFITSAI------GFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQ 532
            +    P + SA+      GFY G+  +G              ETK LTLEE++E++ 
Sbjct: 539 ILSLTWPRMLSALHPQGAFGFYAGWNVVGWFLVYFLLP-----ETKQLTLEELDEVFD 591

>Kwal_14.1625
          Length = 506

 Score =  101 bits (251), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 95/427 (22%), Positives = 176/427 (41%), Gaps = 58/427 (13%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           +Q   LS+ + GL  SIF IG  +G L  G++ D YGR+    +  ++ V+G +I +  +
Sbjct: 73  QQCIPLSEEQMGLATSIFCIGGLVGSLYAGKVADRYGRKRYSFSNCVIGVIGSLI-LFRA 131

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNY 227
           N +    IGR++ G+  G   V++P  I+E +PK LRG+  S  Q+ I +GI +   T  
Sbjct: 132 NSYASLLIGRLIVGISCGSCIVVTPLFINEISPKELRGSLGSMNQVCINIGILL---TQL 188

Query: 228 GTKTYSNAVQWKLPL----GLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAK------- 276
               Y+++ +W+  +    GL  +  + + A    + ESP +L  +G+ + A+       
Sbjct: 189 LALRYADSYRWRWLMLAGAGLALIQFLLLFA----IEESPLWLASRGDLDGAENVLSILR 244

Query: 277 ---------------------RSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWG 315
                                R    S   T  +S    +  L  + ++A   + + S  
Sbjct: 245 GGDRRRSRGEVEEWLQTRGSSRPGTSSPDSTGRESPASQQSSLPESAIDAASQS-DVSVS 303

Query: 316 ELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFA 375
             FS       R  +  ++   QQ  G     +YG  +      + +   +  + ++N  
Sbjct: 304 NYFSDPRYSKSRWAVTAILMG-QQFVGIGSIIFYGVKLISGQLPQYAVLVNFAISILNVV 362

Query: 376 STFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXX 435
            T      V+ +GR+  L++ + A+S+   VF S G+              S    ++  
Sbjct: 363 VTLGASVLVDHWGRKPLLVFSAGAISIA-SVFVSAGIV------------MSNAAMLVTS 409

Query: 436 XXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGF 495
                        PI +++++E  P      A +     NWI    +G+G P +     F
Sbjct: 410 TFMFVAVFAMGLGPIPFLVIAELSPPEASGIAQSYGTACNWIGNSIVGYGFPIMNE---F 466

Query: 496 YYGYVFM 502
           + GY F+
Sbjct: 467 FGGYAFL 473

>YJR160C (MPH3) [3050] chr10 complement(737923..739731) Protein with
           maltose permease activity, member of hexose transporter
           family of the major facilitator superfamily (MFS),
           identical to Mph2p [1809 bp, 602 aa]
          Length = 602

 Score =  100 bits (250), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 133/587 (22%), Positives = 246/587 (41%), Gaps = 66/587 (11%)

Query: 8   MNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGF-ATKTTSPLENNE--IP-QKPLSE 63
           M+D++  +  L  V      D+++ + SNK+  + F AT+     + +E  +P    L+ 
Sbjct: 35  MDDQTKKDG-LDIVHVEFSPDTRAPSDSNKVITEIFDATEDAKEADESERGMPLATALNT 93

Query: 64  YILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFG--NFDVGEQKYVLSDVRTGLI 121
           Y       L+V+    + G+DT  +  F  +  F+R+FG  N   GE + + +  + GL 
Sbjct: 94  YPKAAAWSLLVSTTLIMEGYDTAILGAFYALPIFQRKFGSQNDKTGEWE-ISASWQIGLT 152

Query: 122 VSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSG 181
           +  +  G  +G    G   D+ G R  L+ + L ++      +   N      +G+ + G
Sbjct: 153 LC-YMAGEIVGLQLTGPSVDLVGNRYTLI-IALFFLAAFTFILYFCNSLGMIAVGQALCG 210

Query: 182 LGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFM--GYCTNYGTKTYSNAVQWK 239
           +  G    L+ +  SE  P  LR    ++  L    G     G   N   K   + + +K
Sbjct: 211 MPWGCFQCLTVSYASEICPLALRYYLTTYSNLCWLFGQLFAAGIMKNSQKKYADSELGYK 270

Query: 240 LPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAK--SNKLTVEDSGVLAEVE 297
           LP  L ++  + +  G+ F PESP +L++KG F+EA+RS+ +  S K   ++  V  EV+
Sbjct: 271 LPFALQWILPVPLALGIFFAPESPWWLVKKGRFDEARRSLRRTLSGKGPEKEILVTLEVD 330

Query: 298 LINAGVEAEK--LAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFD 355
            I   ++ EK   +   S+ + F  K    +R  + C+  + Q   G +    Y T  ++
Sbjct: 331 KIKVTIDKEKRLTSKEGSYSDCFEDKIN-RRRTRITCLCWAGQATCG-SILIGYSTYFYE 388

Query: 356 AVGMKD--SFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVT 413
             G+    SF  SI+   +   +TF+  +  + +GR     +G A  ++ F +   +G +
Sbjct: 389 KAGVSTEMSFTFSIIQYCLGICATFLSWWASKYFGRYDLYAFGLAFQTIVFFIIGGLGCS 448

Query: 414 KLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVG 473
             +  G  M S    G+ ++              AP+ + +VSE    R++ + + +A  
Sbjct: 449 STH--GSKMGS----GSLLMAVAFFYNLGI----APVVFCLVSEMPSSRLRTKTIILARN 498

Query: 474 S-------------------NWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXX 514
           +                    W WG           +  GF++G +    L         
Sbjct: 499 TYNVVSIICSVLILYQLNSKKWNWG-----------AKSGFFWGVLCFCTLIWAVVDLP- 546

Query: 515 XXCETKGLTLEEVNEMYQEGV--LPWKSETWVPALRRNESYDVNETQ 559
              ET G T  E+NE+++ GV    +KS    P + +    DV+   
Sbjct: 547 ---ETAGKTFVEINELFKLGVSARKFKSTKVDPFVVKTPPKDVSHND 590

>YDL247W (MPH2) [630] chr4 (5985..7814) Protein with maltose
           permease activity, member of hexose transporter family
           of the major facilitator superfamily (MFS), identical to
           Mph3p [1830 bp, 609 aa]
          Length = 609

 Score =  100 bits (248), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 128/561 (22%), Positives = 237/561 (42%), Gaps = 64/561 (11%)

Query: 8   MNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGF-ATKTTSPLENNE--IP-QKPLSE 63
           M+D++  +  L  V      D+++ + SNK+  + F AT+     + +E  +P    L+ 
Sbjct: 35  MDDQTKKDG-LDIVHVEFSPDTRAPSDSNKVITEIFDATEDAKEADESERGMPLATALNT 93

Query: 64  YILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFG--NFDVGEQKYVLSDVRTGLI 121
           Y       L+V+    + G+DT  +  F  +  F+R+FG  N   GE + + +  + GL 
Sbjct: 94  YPKAAAWSLLVSTTLIMEGYDTAILGAFYALPIFQRKFGSQNDKTGEWE-ISASWQIGLT 152

Query: 122 VSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSG 181
           +  +  G  +G    G   D+ G R  L+ + L ++      +   N      +G+ + G
Sbjct: 153 LC-YMAGEIVGLQLTGPSVDLVGNRYTLI-IALFFLAAFTFILYFCNSLGMIAVGQALCG 210

Query: 182 LGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFM--GYCTNYGTKTYSNAVQWK 239
           +  G    L+ +  SE  P  LR    ++  L    G     G   N   K   + + +K
Sbjct: 211 MPWGCFQCLTVSYASEICPLALRYYLTTYSNLCWLFGQLFAAGIMKNSQKKYADSELGYK 270

Query: 240 LPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAK--SNKLTVEDSGVLAEVE 297
           LP  L ++  + +  G+ F PESP +L++KG F+EA+RS+ +  S K   ++  V  EV+
Sbjct: 271 LPFALQWILPVPLALGIFFAPESPWWLVKKGRFDEARRSLRRTLSGKGPEKEILVTLEVD 330

Query: 298 LINAGVEAEK--LAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFD 355
            I   ++ EK   +   S+ + F  K    +R  + C+  + Q   G +    Y T  ++
Sbjct: 331 KIKVTIDKEKRLTSKEGSYSDCFEDKIN-RRRTRITCLCWAGQATCG-SILIGYSTYFYE 388

Query: 356 AVGMKD--SFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVT 413
             G+    SF  SI+   +   +TF+  +  + +GR     +G A  ++ F +   +G +
Sbjct: 389 KAGVSTEMSFTFSIIQYCLGICATFLSWWASKYFGRYDLYAFGLAFQTIVFFIIGGLGCS 448

Query: 414 KLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVG 473
             +  G  M S    G+ ++              AP+ + +VSE    R++ + + +A  
Sbjct: 449 STH--GSKMGS----GSLLMAVAFFYNLGI----APVVFCLVSEMPSSRLRTKTIILARN 498

Query: 474 S-------------------NWIWGFAIGFGTPFITSAIGFYYGYVFMGCLXXXXXXXXX 514
           +                    W WG           +  GF++G +    L         
Sbjct: 499 TYNVVSIICSVLILYQLNSKKWNWG-----------AKSGFFWGVLCFCTLIWAVVDLP- 546

Query: 515 XXCETKGLTLEEVNEMYQEGV 535
              ET G T  E+NE+++ GV
Sbjct: 547 ---ETAGKTFVEINELFKLGV 564

>KLLA0B14861g complement(1305927..1307690)
           gi|125935|sp|P07921|LACP_KLULA Kluyveromyces lactis
           Lactose permease, start by similarity
          Length = 587

 Score = 99.8 bits (247), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 129/533 (24%), Positives = 217/533 (40%), Gaps = 59/533 (11%)

Query: 30  QSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILV-----------MCLCLMVAFGG 78
             R     L+ D      TS L+ N +P +   E +L+             LC +     
Sbjct: 27  NDRDHKEALNSD---NDNTSGLKINGVPIEDAREEVLLPGYLSKQYYKLYGLCFITYLCA 83

Query: 79  FVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGR 138
            + G+D G + G +   D   ++ + D+       S   TGL+ SIFN+G  I G     
Sbjct: 84  TMQGYD-GALMGSIYTEDAYLKYYHLDIN------SSSGTGLVFSIFNVG-QICGAFFVP 135

Query: 139 LGDMYGRRLGLMAVILVYVVGIIIQIASSNK-------WYQYFIGRIVSGLGVGGIAVLS 191
           L D  GR+  ++   L  V+G II   ++ K       W+  F   I +          +
Sbjct: 136 LMDWKGRKPAILIGCLGVVIGAIISSLTTTKSALIGGRWFVAFFATIANAA--------A 187

Query: 192 PTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGT-KTYSNAVQ-WKLPLGLCFLWA 249
           PT  +E AP HLRG     Y  + ++G  +   + YGT K + N+ + +K+PL L  ++ 
Sbjct: 188 PTYCAEVAPAHLRGKVAGLYNTLWSVGSIVAAFSTYGTNKNFPNSSKAFKIPLYLQMMFP 247

Query: 250 IFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELIN-----AGVE 304
             +      +PESPR+L+  G  EEA+  I K + L  + +  L ++E+        G +
Sbjct: 248 GLVCIFGWLIPESPRWLVGVGREEEAREFIIKYH-LNGDRTHPLLDMEMAEIIESFHGTD 306

Query: 305 AEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQ 364
                       LF  +     R ++  ++    Q +GNN   YY  T+   VGMK    
Sbjct: 307 LSNPLEMLDVRSLFRTRSD-RYRAMLVILMAWFGQFSGNNVCSYYLPTMLRNVGMKSVSL 365

Query: 365 TSIVLGV---VNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKD 421
             ++ GV   V + S+  G + +++ GRR+  L GS + +   +   S+   +     K 
Sbjct: 366 NVLMNGVYSIVTWISSICGAFFIDKIGRREGFL-GSISGAALALTGLSICTARYEKTKK- 423

Query: 422 MPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFA 481
               KSA N  +             + P+  +  +E      +++A  +    + +  F 
Sbjct: 424 ----KSASNGALVFIYLFGGIFSFAFTPMQSMYSTEVSTNLTRSKAQLLNFVVSGVAQFV 479

Query: 482 IGFGTPFITSAIG--FYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQ 532
             F TP     I   FY  YVF                ETKG +LEE+  +++
Sbjct: 480 NQFATPKAMKNIKYWFYVFYVFFDIF--EFIVIYFFFVETKGRSLEELEVVFE 530

>Sklu_2144.6 YFL040W, Contig c2144 7747-9330 reverse complement
          Length = 527

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 97/463 (20%), Positives = 203/463 (43%), Gaps = 36/463 (7%)

Query: 84  DTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMY 143
           D  +++ F+    F + F   +  EQ         GL+      G  +G +  G L +  
Sbjct: 27  DISSMAIFIGSETFNKYFNYPNPLEQ---------GLVAGANPSGALVGCIVYGMLSEKS 77

Query: 144 GRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHL 203
           GR   +     +++ G  I I   N W    + R++ G+ VG  + L P  I E  PK  
Sbjct: 78  GRVSTIKVSSGIWIFGSFISIFVLNIW-MVILSRLIKGVSVGIFSALLPVYIGEVIPKKR 136

Query: 204 RGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESP 263
           +GT  S  QL +T  I + +   +      N + +++  GL  + A+ +      +PESP
Sbjct: 137 KGTATSTIQLALTAAILLMFYVCFFMNFIGNHLSFRISWGLEMIPALLLFFLAFLLPESP 196

Query: 264 RYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINA-GVEAEKLAGNASWGELFSPKG 322
           R+L+  G + +A+  + +  K T    GV +++++++  G  +++     ++ +LF  K 
Sbjct: 197 RWLVTHGKYTDAQELLERL-KSTKFGKGV-SKIDILDKYGSSSQR----CTYLDLF--KK 248

Query: 323 KILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQ--TSIVLGVVNFASTFVG 380
            + +  I+G  IQ+L Q  G     YY   I + +G++   +  ++ +  ++N   T   
Sbjct: 249 TLWRHTIIGMTIQALVQCCGIGVLMYYVVYICEMIGLEGDIRLFSASIQYIINVLFTIFP 308

Query: 381 LYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPS-----------SKSAG 429
           +  ++++ R+  +++GS  ++   V+  S+G T  +  G ++P                G
Sbjct: 309 IIWLDKFRRKDVIVYGSYLLA---VIMFSIGFTMNW-YGHEVPPINGNKAMVWEVKGRPG 364

Query: 430 NAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFI 489
           + ++              +  A++  +E  P + K + M++ +  +W+  F + F  P++
Sbjct: 365 SVILGLCFLFVAIFAATLSCGAWLYTNEILPAKTKAKGMSICMAMSWVMNFILTFLAPWL 424

Query: 490 TSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQ 532
            + I +    +  G              ET GLT  E+ ++Y+
Sbjct: 425 LNRIKWVTFIILGGMTLVITTIVAFSFPETYGLTDLEIEKLYE 467

>YIL171W (HXT12) [2507] chr9 (19515..19844) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [330 bp, 109 aa]
          Length = 109

 Score = 89.7 bits (221), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/93 (52%), Positives = 63/93 (67%), Gaps = 13/93 (13%)

Query: 11  RSNSNTELAAVSSPTDF-DSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMC 69
            SNSN+ + A S  T+  DS+     + L+ D     T +P++   +PQKPLS Y  V  
Sbjct: 16  ESNSNSAVGAPSVKTEHGDSK-----DSLNLDA----TEAPID---LPQKPLSAYTTVAI 63

Query: 70  LCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFG 102
           LCLM+AFGGF+FGWDTGTISGFVN++DF RRFG
Sbjct: 64  LCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFG 96

>Sklu_2375.1 YGR289C, Contig c2375 1376-3217 reverse complement
          Length = 613

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 123/557 (22%), Positives = 224/557 (40%), Gaps = 49/557 (8%)

Query: 13  NSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQ-------------- 58
           +S TEL   S  TDF  +  T   + S         S +EN  I +              
Sbjct: 19  SSQTELGLSSIMTDFTKKQETEHVEFSSSTVEQVDCSNVENEVIAKFLGMSEDAQQSDNQ 78

Query: 59  -------KPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKY 111
                  + + +Y       ++++    + G+DT  ++    +  F ++FG+F+     Y
Sbjct: 79  DKEMSLLQGIKQYPKAAFWSVVLSSALIMEGYDTALLASLYALPAFAKKFGSFNAASGIY 138

Query: 112 VLSDV-RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKW 170
            +S   +TGL + IF +G  IG    G   D  G R  L+  +L     I +   + +  
Sbjct: 139 EISAAWQTGLSMCIF-VGEIIGLQLAGVAADRVGYRWTLITSLLALFCFIFVLFFAPSC- 196

Query: 171 YQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFM--GYCTNYG 228
               +G I+ G+  G    L+ +  +E  P  LR    ++  +   +G  M  G   N  
Sbjct: 197 AVLAVGEILCGIPWGCFQTLTVSYATEVCPLVLRYYLTTYVNICWVIGQIMASGVLKNSQ 256

Query: 229 TKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAK---SNKL 285
                +A+ +KLP  L ++W   +  G+ F PESP +L++K   +EA+RS+ +     + 
Sbjct: 257 ENLADSALAYKLPFALQWIWPFPIALGIYFAPESPWWLVKKNRLKEAERSLKRLITGIEA 316

Query: 286 TVEDSGVLAEVELINAGVEAEK-LAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNN 344
           T +D  V A ++ +    E E  +  N ++ + F  KG   +R  +  ++   Q   G+ 
Sbjct: 317 TEKDIVVDAMIKKMKLTTEKEDMMTKNVTYWDCF--KGVDGRRTRIASLVWIAQNACGST 374

Query: 345 YFFYYGTTIFDAVGMKDS--FQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSV 402
               Y T  +   G+ DS  F  SI+   + F  TF   +  +RYGR      G    ++
Sbjct: 375 -LMGYSTYFYQKAGLSDSFAFNFSIIQYCLGFVGTFSSWFFSKRYGRFTIFTTGLGLQTL 433

Query: 403 CFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLR 462
              V   +G +           SK+A  A+                P+ Y I  E    +
Sbjct: 434 LLFVIGGLGFS----------DSKNASWAIGSLMMAFVFVYDVGVGPVTYCIFPEEPSTK 483

Query: 463 VKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGY---VFMGCLXXXXXXXXXXXC-E 518
           ++ + + +A     I G      TP++ ++  + +G    +F G +             E
Sbjct: 484 LRTKTVIVARNFYNIMGIINSIWTPYMLNSTEWNWGAKTGLFWGGISLVMLVWAVLDLPE 543

Query: 519 TKGLTLEEVNEMYQEGV 535
           T G T  E++E++ + +
Sbjct: 544 TAGRTFGEIDELFAQKI 560

>YGL104C (VPS73) [1880] chr7 complement(308714..310174) Putative
           hexose transporter, class B vacuolar sorting protein
           involved in Prc1p vacuolar trafficking pathway, member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1461 bp, 486 aa]
          Length = 486

 Score = 96.7 bits (239), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 106/481 (22%), Positives = 205/481 (42%), Gaps = 50/481 (10%)

Query: 47  TTSPLENNEIPQKPLSEYILVMCLCLMVA-FGGFVFGWDTGTISG---FVNMTDFKRRFG 102
           + S L N  +P++   +    +C  ++VA  G   FG+    ++     ++ ++F     
Sbjct: 7   SASLLSNVSMPRQNKHKITKALCYAIIVASIGSIQFGYHLSELNAPQQVLSCSEFDIPME 66

Query: 103 NFD-----VGEQKYV----LSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVI 153
            +      +G++ Y     L+D + G++ S+F IG  +G      L ++YGR+   +   
Sbjct: 67  GYPYDRTWLGKRGYKQCIPLNDEQIGIVTSVFCIGGILGSYFATSLANIYGRKFSSLINC 126

Query: 154 LVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQL 213
            + +VG +I I +SN +    IGRI+ G+  G + V+ P  I E AP    G   S  Q+
Sbjct: 127 TLNIVGSLI-IFNSNSYRGLIIGRILVGISCGSLIVIIPLFIKEVAPSGWEGLLGSMTQI 185

Query: 214 MITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFE 273
            I LG+ +   T       +++ +W+  L   FL A+        V ESP++L+  G   
Sbjct: 186 CIRLGVLL---TQGIALPLTDSYRWRWILFGSFLIAVLNFFMWFIVDESPKWLLAHGRVT 242

Query: 274 EAKRSIAKSNKLTVEDSGVLAEVELINAGVEA----------EKLAGNASWGELFSPKGK 323
           +AK S+ K   +T +++    E++     +E+            ++G+ S  +    +  
Sbjct: 243 DAKLSLCKLRGVTFDEAA--QEIQDWQLQIESGDPLIEPTTTNSISGSNSLWKYLRDRTN 300

Query: 324 ILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYT 383
           +  R ++  ++   QQ  G N    YGT I   +  + + + +  + +VN   T +    
Sbjct: 301 VKSRHVITVLLFG-QQFCGINSIVLYGTKIISQLYPQHAIRINFFISMVNVLVTILVSLL 359

Query: 384 VERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXX 443
           +    R+  L+  +  +SV   +            G  M  +K   N +I          
Sbjct: 360 IHSLPRKPLLMTSTVLVSVTAFIM-----------GIAMNHNKM--NLLIVFSFIYMGVF 406

Query: 444 XXXWAPIAYVIVSETYPLRVKNRAMAMAVGS--NWIWGFAIGFGTPFITSAIGFYYGYVF 501
                P+ ++I+ E    + ++  +A   G+  NW+  F I +  P I   +    GYVF
Sbjct: 407 TMGLNPLPFIIMREVS--KPQDMVLAQRYGTICNWVGTFIIAYTFPIIHDVLS---GYVF 461

Query: 502 M 502
           +
Sbjct: 462 I 462

>KLLA0D05379g complement(464200..465690) weakly similar to sp|P43562
           Saccharomyces cerevisiae YFL040w, start by similarity
          Length = 496

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 100/494 (20%), Positives = 216/494 (43%), Gaps = 44/494 (8%)

Query: 78  GFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLG 137
           GF+ G DT ++S F+  + FK  F            + ++TG++     IG  +G L  G
Sbjct: 18  GFMLGMDTSSLSLFLGTSYFKEYFKQ---------PTALQTGMMTGANQIGGFVGCLMSG 68

Query: 138 RLGDMYGRRLGLMAVILVYVVG-----IIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSP 192
            L ++ G +  L A  +++ +G      ++++      Y   + R V G+ VG ++VL+ 
Sbjct: 69  SLIELIGCKWCLCACSVIWTMGSVGSFFVLEV------YTMALSRFVKGIAVGILSVLAS 122

Query: 193 TLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFM 252
             + E    ++RG   +  Q+ +T+ I   Y  +         + +K+  GL  + ++ +
Sbjct: 123 FYLMEVFSSNIRGQATALMQMALTISILSIYFLSMLLDKIQGPLAFKITWGLEVIPSLLL 182

Query: 253 IAGMIFVPESPRYLIEKG-NFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGN 311
           +     +PESPR+L + G + ++  RS+A    L V+D   L E + ++   +  KL+  
Sbjct: 183 LMLFQALPESPRWLYKHGYSNKDIDRSLA---ILRVKDVEKLRE-KFVSETKQKPKLS-- 236

Query: 312 ASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLG- 370
                 +  K    + + +G ++Q L Q++G N   YY   I + VG  D   + +  G 
Sbjct: 237 ------YIIKKGYWKHMSLGIIVQILIQISGINVVMYYTIYICEMVGFDDDVSSKLTAGP 290

Query: 371 -VVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAG 429
            +VN   T V ++ ++++ R+  + W S  +    ++     +  L    +         
Sbjct: 291 YIVNTIFTLVPVFLLDKFNRKVFIGWASVFLGGIMLL-----IGFLIGERERHVGDVVLR 345

Query: 430 NAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFI 489
           N ++              +   ++  +E  P  +K+ A+++ + ++W  GFA+    P++
Sbjct: 346 NIVVALCFLFVSVFSSSLSCAGFIYTNEILPESIKSVALSVCISTSWFTGFALALMAPYL 405

Query: 490 TSAIGFYYGYVFMGCLXXXXXXXXXX-XCETKGLTLEEVNEMYQEGVLPWKSETWVPALR 548
              +  ++ +V +G               ET+ L+  +++ ++++  L   +E     + 
Sbjct: 406 MQIVE-WWTFVMLGTSTIALAFIIIMWFPETRDLSPHDIDNLFKQDAL--SAEVEYEKIE 462

Query: 549 RNESYDVNETQEDS 562
            ++S D     E S
Sbjct: 463 SDQSADFESIPERS 476

>KLLA0E01782g 171319..173037 weakly similar to ca|CA5798|IPF4181
           Candida albicans putative permease (by homology),
           hypothetical start
          Length = 572

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 105/406 (25%), Positives = 169/406 (41%), Gaps = 20/406 (4%)

Query: 143 YGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKH 202
           +GRR  ++    + V G +IQ   SN        R+  G+G+G  +   P   +E AP  
Sbjct: 172 FGRRFIVLISCFIGVSGSLIQ-GFSNGLGLILFARLYLGIGMGLCSSTVPIYTAECAPAV 230

Query: 203 LRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFV-PE 261
            RG  +  +Q  I LG+ +G   N         + W+L +G   + A F+ A ++++ PE
Sbjct: 231 SRGAILMLWQTFIALGVCLGSVFNRAFVEIEGNLSWRLMIGSSCV-APFITALVVYIPPE 289

Query: 262 SPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWG-ELFSP 320
           SPR+LI  G   E+  S+ +      E SG      L  +     KLA   SW  E+ S 
Sbjct: 290 SPRWLIGNGFVRESLESLIRLRN--TEVSGSRDFYILYESLKYEHKLAAKLSWHQEIKSL 347

Query: 321 KGKILQRVIMGCVIQSL--QQLTGNNYFFYYGTTIFDAVGMK--DSFQTSIVLGVVNFAS 376
              I  R  +      +  QQ  G N    Y  TI    G+    +   SI +G   F +
Sbjct: 348 FSNIRNRFALWVSFLGILGQQYGGVNILVSYTATILTNAGIDPVTAIAGSIGIGGGCFLA 407

Query: 377 TFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXX 436
           TF+    ++R+GRR  LL        C      +       N K+  +  +AG A +   
Sbjct: 408 TFLSSQLIDRFGRRTMLLLTLPVEGACLFWLGGI------LNIKEDQARLAAGLAAMYVF 461

Query: 437 XXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFY 496
                       PI++ +V+ET  + V+    A A+  NW+  F +    P +  ++G  
Sbjct: 462 VLFYGIGI---GPISFTLVAETPSITVRMAHSAFAMSINWLLDFCLTMTWPKMADSMGTS 518

Query: 497 YGYVFMGCLXXXXXXXXXXXC-ETKGLTLEEVNEMYQEGVLPWKSE 541
            G  F G               ETK  TLE+++E+++ GV  +  +
Sbjct: 519 GGLYFYGAFNFLIWVLAYFTIPETKRFTLEQLDEVFKHGVTHYAKQ 564

>Sklu_2080.4 YBR241C, Contig c2080 4658-6229
          Length = 523

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 96/458 (20%), Positives = 180/458 (39%), Gaps = 76/458 (16%)

Query: 113 LSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRR--------LGLMAVILVYVVGIIIQI 164
           L D + GL+ SIF++G   G L  G L D YGR+        LG++  +L++        
Sbjct: 80  LDDQQIGLVTSIFSLGGLAGSLYAGNLADKYGRKRVSFFNSTLGILGSLLLF-------- 131

Query: 165 ASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYC 224
             SN +     GR  +G+  G   V++P LI+E +P   +G   S  Q+ I +GI +   
Sbjct: 132 -RSNSYGSLLFGRFTAGVSCGSSIVITPLLINEISPHEWKGALGSMNQVSINIGILV--- 187

Query: 225 TNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKR------- 277
           T      ++++ +W+  L    + A+     +  + ESP++L+ +G  ++A+        
Sbjct: 188 TQLLALRWADSFRWRWLLFFGAILALLNFLLLFVIDESPKWLLSRGEVDQAESILHGLRG 247

Query: 278 ----------------------------SIAKSNKLTVEDSGV----LAEVELINAGVEA 305
                                       S  + +  T++ S V       +   N+ +  
Sbjct: 248 GHRQHSRDEINEWLTLRGDRSRSQQQTPSQTRDSLRTIKPSHVSPPTYDPLPSANSTIST 307

Query: 306 EKLAGN--ASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSF 363
           E+ +    + W  + SPK    +R I   ++   QQ  G N   +YG  +   +    + 
Sbjct: 308 EQSSEEEMSLWQYITSPKYTKSRRAITAILMG--QQFCGINSIIFYGVKVISDLLPDQAI 365

Query: 364 QTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMP 423
             +  + ++N   TF     V+ +GR+  L+  + +MS+   +  S G+           
Sbjct: 366 LANFGISILNVVVTFGASPLVDHWGRKPLLITSATSMSLASSLI-SYGIL---------- 414

Query: 424 SSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIG 483
              S    ++               PI ++++ E  P+    +A +     NW+  F IG
Sbjct: 415 --TSNAVLLVAFTFVYIGVFAVGLGPIPFLVIPELSPVEAVGKAQSYGTTCNWLATFIIG 472

Query: 484 FGTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKG 521
           +G P + S +G    ++F                ETKG
Sbjct: 473 YGFPILNSWLGGAVFFLFSSFAILFAIYVYYEIPETKG 510

>YBR298C (MAL31) [475] chr2 complement(802587..804431) Maltose
           permease, a high affinity maltose/H[+] symporter, member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1845 bp, 614 aa]
          Length = 614

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 126/591 (21%), Positives = 234/591 (39%), Gaps = 85/591 (14%)

Query: 1   MSSSATPMNDRSNSN-TELAAVSSPTDFDS-----QSRTPSNKLSEDGFATKTTSPLENN 54
           +SS      DR++S+  E+    + T+F+S     Q +     LS   +   +  P +NN
Sbjct: 4   LSSLINRKKDRNDSHLDEIENGVNATEFNSIEMEEQGKKSDFDLSHLEYGPGSLIPNDNN 63

Query: 55  E-IPQ----------------------KPLSEYILVMCLCLMVAFGGFVFGWDTGTISGF 91
           E +P                         L  Y       L+V+      G+DT  +  F
Sbjct: 64  EEVPDLLDEAMQDAKEADESERGMPLMTALKTYPKAAAWSLLVSTTLIQEGYDTAILGAF 123

Query: 92  VNMTDFKRRFGNFDVGEQKYVLS-DVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLM 150
             +  F++++G+ +     Y +S   + GL +  +  G  +G    G   D  G R  L+
Sbjct: 124 YALPVFQKKYGSLNSNTGDYEISVSWQIGLCLC-YMAGEIVGLQMTGPSVDYMGNRYTLI 182

Query: 151 AVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSF 210
            + L ++   I  +          +G+ + G+  G    L+ +  SE  P  LR    ++
Sbjct: 183 -MALFFLAAFIFILYFCKSLGMIAVGQALCGMPWGCFQCLTVSYASEICPLALRYYLTTY 241

Query: 211 YQLMITLGIFM--GYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIE 268
             L    G     G   N   K  ++ + +KLP  L ++W + +  G+ F PESP +L++
Sbjct: 242 SNLCWAFGQLFAAGIMKNSQNKYANSELGYKLPFALQWIWPLPLAVGIFFAPESPWWLVK 301

Query: 269 KGNFEEAKRSIAK--SNKLTVEDSGVLAEVELINAGVEAE-KLAGNASWGELFSPKGKIL 325
           KG  ++A+RS+ +  S K   ++  V  E++ I   +E E K++   ++ +     G   
Sbjct: 302 KGRIDQARRSLERTLSGKGPEKELLVSMELDKIKTTIEKEQKMSDEGTYWDCVK-DGINR 360

Query: 326 QRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGM--KDSFQTSIVLGVVNFASTFVGLYT 383
           +R  + C+   + Q +       Y T  ++  G+    +F  SI+   +  A+TF+  + 
Sbjct: 361 RRTRIACLCW-IGQCSCGASLIGYSTYFYEKAGVSTDTAFTFSIIQYCLGIAATFISWWA 419

Query: 384 VERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXX 443
            +  GR     +G A  ++ F +   +G +       D   +K    A++          
Sbjct: 420 SKYCGRFDLYAFGLAFQAIMFFIIGGLGCS-------DTHGAKMGSGALLMVVAFFYNLG 472

Query: 444 XXXWAPIAYVIVSETYPLRVKNRAMAMAVGS-------------------NWIWGFAIGF 484
               AP+ + +VSE    R++ + + +A  +                    W WG   GF
Sbjct: 473 I---APVVFCLVSEIPSSRLRTKTIILARNAYNVIQVVVTVLIMYQLNSEKWNWGAKSGF 529

Query: 485 GTPFITSAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQEGV 535
                     F+ G+    CL            ET G T  E+NE+++ GV
Sbjct: 530 ----------FWGGF----CLATLAWAVVDLP-ETAGRTFIEINELFRLGV 565

>KLLA0E06743g complement(612941..614944) similar to
           ca|CA5798|IPF4181 Candida albicans putative permease (by
           homology), start by similarity
          Length = 667

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 98/417 (23%), Positives = 172/417 (41%), Gaps = 45/417 (10%)

Query: 139 LGDMYGRRLGLMAVILVYVVGIIIQI---ASSNKWYQYFIGRIVSGLGVGGIAVLSPTLI 195
           L +M+GR+  +     +  +   +Q    A +  W+  F  R + G G+G  +  +   +
Sbjct: 212 LNNMFGRKKVIFITCAISAITCFLQAFGPAGTPGWHYLFAMRFLLGFGIGPKSATTSVYL 271

Query: 196 SETAPKHLRGTCVSFYQLMITLGIFMGYCTNY-----GTKTYSNAVQWKLPLGLCFLWAI 250
           +E + K LRG     +Q     GI  GY  +      G    +  + W+L L    + AI
Sbjct: 272 AECSTKKLRGIICMNWQTFTAFGIMWGYVFSLIFYRVGRAGIAGGLNWRLMLASAMIPAI 331

Query: 251 FMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGV--EAEKL 308
            ++  + F PESPR+L+ KG ++EA  S      L + +  +LA  +L    V    E  
Sbjct: 332 LVLVQIPFCPESPRWLMGKGRYKEAYES-----TLQIRNHKILACRDLFYQHVLLMEENS 386

Query: 309 AGNASWG---ELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKD--SF 363
              + W    E+F+ + +    +I   +   +QQ    N   YY + IF   G  +  S 
Sbjct: 387 LEMSYWTRLREIFTVR-RNRNALICAFICAFMQQFCAINVIAYYSSAIFLQSGFTEISSL 445

Query: 364 QTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMP 423
             S+  G++NF       + ++R+GRR  LL     ++V  ++    G +    + +   
Sbjct: 446 CASLGFGLINFFFAIPAFFMIDRFGRRFLLLNTFPWLAVFLLI---TGFSFWIDDTEKRI 502

Query: 424 SSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIG 483
              S G  +                 + +VI  E +PL V  RA+  ++ +  +WGF   
Sbjct: 503 GVVSMGIYVFSAIYSFGCGV------VPFVIAGEVFPLYV--RAIGASLFTIVLWGFNFI 554

Query: 484 FGTPFIT--------SAIGFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYQ 532
               + +         A GFY  +  +G              ETK LTLEE++E++ 
Sbjct: 555 LSLTWPSMLRAFEPQGAFGFYAAWNVIGWFLVYFFMP-----ETKQLTLEELDEVFD 606

>CAGL0C01771g 187030..188487 similar to sp|P38142 Saccharomyces
           cerevisiae YBR241c or sp|P53142 Saccharomyces cerevisiae
           YGL104c, start by similarity
          Length = 485

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 109/470 (23%), Positives = 193/470 (41%), Gaps = 44/470 (9%)

Query: 45  TKTTSPLENNEIPQKPLSEYIL-VMCLCLMVAFGGFVFGWDTGTISG---FVNMTDFKRR 100
           T T S + N     +  S  IL V+  CL    G   FG+    ++    F+  ++ K  
Sbjct: 2   TATESLMGNTRRKIELTSSLILAVLVSCL----GTIQFGYHIAELNAPQQFLTCSEVKYP 57

Query: 101 FGNFDV-------GEQKYV----LSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGL 149
            G+ D+       G    V    ++  + G++ S+ ++G  IG    G+L   YG++   
Sbjct: 58  HGDPDIPYDETLFGRHGLVQCIPMTTEQFGVVTSVLSVGGLIGSYIAGQLAAKYGKKKIS 117

Query: 150 MAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVS 209
                VY +G ++   ++  W   F GR++ G+  G   V+ P  I+E  P   +G   +
Sbjct: 118 QGTAFVYFIGSLMLTMANGYWTMIF-GRLLVGMASGISIVVIPVYINEITPAEYKGAMGT 176

Query: 210 FYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEK 269
             QL I +GI     T      ++N+  W+  L +    A+        + ESP++L+++
Sbjct: 177 MNQLSINIGILF---TQTIALVFTNSYYWRWILLIGTAIALVNFVAWSTIDESPKWLLKR 233

Query: 270 GNFEEAKRSIAKSNKLTVEDSGVLAEV--ELINAGVEAEKLAGNAS--WGELFSPKGKIL 325
           G   EA+  + K +  T +D+    +     +N+  E    AG     W  +   + K  
Sbjct: 234 GLTSEAEMVVYKLHGGTYQDAKDQIQTWQTDMNSHHEHADFAGREPTLWEFVTREEYKKP 293

Query: 326 QRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVE 385
           + VI   +I   QQ  G N   +YG  +        +   +  + V+N   TFV    ++
Sbjct: 294 RNVIF--MILCAQQFCGINSIIFYGVKVISNSLPNSAVLVNFGISVLNVLMTFVASVIID 351

Query: 386 RYGRRKCLLWGSAAMS-VCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXX 444
             GR+  LL  SA M+   F++  S+G++      KD+P        ++           
Sbjct: 352 SLGRKPLLLSSSALMAGTSFLI--SIGIS------KDVPI------LLVIAVFAYIASFA 397

Query: 445 XXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIG 494
               PI  +I+SE        +A +     NW+  F +GF  P     +G
Sbjct: 398 IGVGPIPLMIISELTTHEAAAKAQSFGTICNWLATFLVGFLFPSFHEVMG 447

>CAGL0K12716g complement(1260169..1261623) similar to sp|P43562
           Saccharomyces cerevisiae YFL040w, hypothetical start
          Length = 484

 Score = 89.7 bits (221), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 96/430 (22%), Positives = 183/430 (42%), Gaps = 38/430 (8%)

Query: 78  GFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVL-SDVRTGLIVSIFNIGCAIGGLTL 136
           G++ G D  ++  F+N  +F   FG     EQ  ++ ++   GLI SIF +  A      
Sbjct: 18  GYLMGMDLSSLGVFLNGDEFLSYFGTPTPIEQGLLMGANPLGGLIGSIFYVSLA------ 71

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLIS 196
                +Y  RL      +++++G  I I     W    + R + G+ +G +++     I+
Sbjct: 72  KNCARLYSFRLS----TIIWLIGCFIGIFVLEIW-MIAVARFLKGITIGMLSIHITNYIN 126

Query: 197 ETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGM 256
           E  P ++RG  ++F Q+  T  IF  +    G  T+ +   ++L  GL F+ A+ +I   
Sbjct: 127 EVFPSNIRGRTLAFVQVGYTFSIFSMHYYCVGLNTFKSHYAFRLAWGLEFIPAVAVIIAT 186

Query: 257 IFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEV-ELINAGVEAEKLAGNASWG 315
            ++PESP YL+     + +++      K   +     A++ + I+   E E  +      
Sbjct: 187 FWIPESPVYLLRNTIPQISQKVDVMKVKHDSDSENDPADISDNIDDIFEFECTSRILCIR 246

Query: 316 ELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNF- 374
           E+   K +   R++MG ++Q L Q TG N   YY T I +  G+K+  +T +++  V + 
Sbjct: 247 EILKLKTR--NRLLMGTILQVLVQFTGINVILYYITYICEMAGLKE--ETKLLVSAVPYF 302

Query: 375 ----ASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPS------ 424
                S F  LY ++   R+   + GSA +S   +  A +  T     G ++        
Sbjct: 303 INAVLSCFPLLY-LDVVPRKLMTVIGSALLSTIMIAIAILMST----TGHEIEPIKGNKS 357

Query: 425 -----SKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWG 479
                 K  G  ++              A + ++   E  P+  + + + + +   W+  
Sbjct: 358 LIWIVPKVPGLFILCLCFLFVGIYALSIACVPWIYTCELLPVSARAKGLPICMAIGWLMN 417

Query: 480 FAIGFGTPFI 489
           F I    P +
Sbjct: 418 FCITMTGPLL 427

>YGR289C (MAL11) [2234] chr7 complement(1073968..1075818) Maltose
           permease, a general alpha-glucoside permease, member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1851 bp, 616 aa]
          Length = 616

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 101/396 (25%), Positives = 173/396 (43%), Gaps = 28/396 (7%)

Query: 26  DFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGGFVFGWDT 85
           D D  +    N+++    A +  S  E +   ++ L +Y       ++V+    + G+DT
Sbjct: 66  DSDEDNENVINEMNATDDANEANSE-EKSMTLKQALLKYPKAALWSILVSTTLVMEGYDT 124

Query: 86  GTISGFVNMTDFKRRFGNFDVGEQKY-VLSDVRTGLIVSIF---NIGCAIGGLTLGRLGD 141
             +S    +  F+R+FG  + GE  Y + S  + GL + +     IG  I    +  +G+
Sbjct: 125 ALLSALYALPVFQRKFGTLN-GEGSYEITSQWQIGLNMCVLCGEMIGLQITTYMVEFMGN 183

Query: 142 MYG--RRLGLMA--VILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISE 197
            Y     LGL+   + ++Y    +  IA         +G+I+S +  G    L+ T  SE
Sbjct: 184 RYTMITALGLLTAYIFILYYCKSLAMIA---------VGQILSAIPWGCFQSLAVTYASE 234

Query: 198 TAPKHLRGTCVSFYQLMITLG-IFM-GYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAG 255
             P  LR    S+  +    G IF  G   N      ++ + +KLP  L ++W   ++ G
Sbjct: 235 VCPLALRYYMTSYSNICWLFGQIFASGIMKNSQENLGNSDLGYKLPFALQWIWPAPLMIG 294

Query: 256 MIFVPESPRYLIEKGNFEEAKRSIAK--SNKLTVEDSGVLAEVELINAGVEAEKLAGNAS 313
           + F PESP +L+ K    EA++S+++  S K   +D  V   ++ I   +E E+L  + S
Sbjct: 295 IFFAPESPWWLVRKDRVAEARKSLSRILSGKGAEKDIQVDLTLKQIELTIEKERLLASKS 354

Query: 314 WGELFSP-KGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGM--KDSFQTSIVLG 370
            G  F+  KG   +R  + C+    Q  +G      Y T  F+  GM    +F  S++  
Sbjct: 355 -GSFFNCFKGVNGRRTRLACLTWVAQNSSG-AVLLGYSTYFFERAGMATDKAFTFSLIQY 412

Query: 371 VVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVV 406
            +  A T        R GR   L +G A   VC  +
Sbjct: 413 CLGLAGTLCSWVISGRVGRWTILTYGLAFQMVCLFI 448

>AGL277W [4035] [Homologous to NOHBY] complement(185070..187085)
           [2016 bp, 671 aa]
          Length = 671

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 106/473 (22%), Positives = 180/473 (38%), Gaps = 55/473 (11%)

Query: 112 VLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILV--YVVGIIIQI----- 164
           V  D   GL+     + CA+    L    D     LG   VI V  ++ G+   +     
Sbjct: 190 VREDWLIGLVNGAPYLCCAVAACWLT---DWANNVLGRKRVIFVTCFLSGLFCLLQGVGP 246

Query: 165 ASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYC 224
           A    W   F  R + G G+G  +      ++E APK LRG     +Q     G+  GY 
Sbjct: 247 AGPAGWRYLFAMRFLLGFGLGIKSATVNVYLAECAPKELRGIVCMNWQAFTAFGVMWGYV 306

Query: 225 TNY-----GTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSI 279
            +      G       + W+L L    L A+F++  +   PESPR+L+ KG + EA  ++
Sbjct: 307 ASLVFYRVGDAGIGGGLNWRLMLASAALPAVFVLFQLPHCPESPRWLMGKGRYPEAYAAL 366

Query: 280 AKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQ 339
            +  K  +     L    ++       +L+      E+F+ + +     +   +   +QQ
Sbjct: 367 LQLRKHRLLACRDLFYQHVLLVQESTLQLSYFTRLKEIFTVR-RNRNAFVAAFICAFMQQ 425

Query: 340 LTGNNYFFYYGTTIFDAVGMKD--SFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGS 397
               N   YY + IF   G  +  S  +S+  G++N        + ++R+GRR  LL   
Sbjct: 426 FCAINVIAYYSSVIFLQAGFSEIASLCSSLGFGIINTVFAIPAYFMIDRFGRRFLLLSTL 485

Query: 398 AAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSE 457
             + V  +V       K          +K++   +                 + +V   E
Sbjct: 486 PWLGVFLLVTGFAFWIK---------DTKASIGVISFGIYIFSAIYSFGMGVVPFVYAGE 536

Query: 458 TYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAI------GFYYGYVFMGCLXXXXXX 511
            +PL V+    ++     W + F +    P +  A+      GFY  + F+G        
Sbjct: 537 VFPLYVRAIGSSLFAVVLWGFNFILALTWPSMLRAMKPQGAFGFYAAWNFIGYFLVYFFL 596

Query: 512 XXXXXCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESY------DVNET 558
                 ETK LTLEE++E++            VP ++R + Y      D  ET
Sbjct: 597 P-----ETKQLTLEELDEVFS-----------VPLMKRADYYLSQMWPDFQET 633

>Scas_597.5
          Length = 489

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 88/398 (22%), Positives = 169/398 (42%), Gaps = 28/398 (7%)

Query: 113 LSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQ 172
           ++D + G I + F+IG  +G    G+L + YGR+   +   L+  +G  I   S N    
Sbjct: 79  MTDQQLGAITASFSIGGLVGSFVAGKLAEKYGRKYVSVVNCLIAFLGSFIMFFS-NSVLP 137

Query: 173 YFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTY 232
             +GR + G+  G   V++   I++ AP   RG+  +  QL I LGI +           
Sbjct: 138 MILGRTIVGIAAGVSVVVTSLFINDVAPVDWRGSLGTMNQLSINLGILLTQFAGLKFVRN 197

Query: 233 SNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGV 292
            +  +W+  + +  + AI  +   I V ESPR+L+ +G+   A++++      + +D  V
Sbjct: 198 EDDGKWRWVMFIGMVLAILNLVLWIRVAESPRWLLAQGDVIGAEKALFLLRIGSYQD--V 255

Query: 293 LAEVE--------LINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNN 344
             EV+          N   EA +   + S  E F        R  +  ++   QQ  G N
Sbjct: 256 KQEVQTWKNENNNSSNNDTEANQSTRDISLKEYFKESQFKKARTAITAILVG-QQFCGIN 314

Query: 345 YFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCF 404
              +YG  +   +  + +   ++ + ++N   TFV    ++++GR+  L+  ++ M+   
Sbjct: 315 SIIFYGVKVISQLLPQHAVLINLGISLLNVIFTFVSSTIIDKFGRKPLLITSTSIMAFSS 374

Query: 405 VVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVK 464
            + +   V K +P              ++               PI ++I+ E      K
Sbjct: 375 FIISISIVGK-FP------------IILVSSTYLYIVAFALGVGPIPFLIIGELSNKDDK 421

Query: 465 NRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFM 502
             A +     NWI  F +G+    +++   ++ GYV+M
Sbjct: 422 AVAQSYGTVCNWIATFVVGYTFAVLSN---WFSGYVYM 456

>Kwal_27.11079
          Length = 613

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 113/495 (22%), Positives = 204/495 (41%), Gaps = 52/495 (10%)

Query: 82  GWDTGTISGFVNMTDFKRRFGNFDVGEQKY-VLSDVRTGLIVSIFNIGCAIGGLTLGRLG 140
           G+DT  +S    +  F RRFG+++     Y V +  +T L + + N+G  IG    G   
Sbjct: 114 GYDTSLLSSLYALPAFARRFGSYNEVSGIYEVPARWQTALSMCV-NVGEIIGLQFAGIAA 172

Query: 141 DMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAP 200
           D  G R  L+A +L  V   I  +  +        G I+ G+  G    L+    +E  P
Sbjct: 173 DHLGYRRTLIASLLA-VFAFIFILFFATGCPMLAAGEILCGIPWGCFQTLTVAYATEVCP 231

Query: 201 KHLRGTCVSFYQLMITLGIFM--GYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIF 258
             LR    +F  +   LG  M  G   N       + + +++P  L ++W + +  G+  
Sbjct: 232 LALRYYLTTFVNVCWILGQIMAAGVLKNSQENLADSPLAYRIPFALQWVWPLPIALGIYL 291

Query: 259 VPESPRYLIEKGNFEEAKRSIAK-------SNKLTVEDSGVLAEVELINAGVEAEKLAGN 311
            PESP +L++K    +A  S+++       + K TV  + +L  ++L     + + L  N
Sbjct: 292 APESPWWLVKKERMADAAHSLSRLISGLPPAEKATVIGT-MLKRIQLTTQ--KEDILTKN 348

Query: 312 ASWGE-LFSPKGKILQRVIMGCVIQSLQQLTGNN---YFFYYGTTIFDAVGMKDS--FQT 365
           AS+ + L    G+  +       I SL  +T N        Y T  +   G+ +S  F  
Sbjct: 349 ASYRDCLIGSDGRRTR-------IASLTWVTQNACGVAMMTYSTYFYTKAGLSESYAFTF 401

Query: 366 SIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSS 425
           SI+        T +  +  + YGR +    G A  ++  ++  + G +       D  ++
Sbjct: 402 SIIQYCFGLIGTILSWFISKHYGRYEIFARGLALQTLLLIIIGASGFS-------DSKNA 454

Query: 426 KSAGNAMIXXXXXXXXXXXXXWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFG 485
           K     ++               P+ Y +V E    +++ + + +A     I G      
Sbjct: 455 KWVAGTLLLVFVFVYDVGV---GPVTYCLVPEIPSNKLRTKTVILARNCYNIMGIVNAIW 511

Query: 486 TPFITSAIGFYYGY---VFMGCLXXXXXXXXXXXC-ETKGLTLEEVNEMYQEGVLPWKSE 541
           TP++ ++  + +G    +F G +             ETKG T  E++E++ +G       
Sbjct: 512 TPYMLNSDQWNWGAKTGLFWGAISLVMLIWAYYELPETKGRTFGEIDELFSQG------- 564

Query: 542 TWVPALRRNESYDVN 556
             VPA R+ ES +VN
Sbjct: 565 --VPA-RKFESTEVN 576

>Scas_652.12
          Length = 478

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 89/369 (24%), Positives = 160/369 (43%), Gaps = 62/369 (16%)

Query: 59  KPLSEYILVMCLCLMVAFGGFVFGWDTGTI---SGFVNMTDFKRRFGNFDVG-------- 107
           K L   ILV CL      G   FG+  G +   S  ++ ++FK    N DV         
Sbjct: 6   KNLVASILVACL------GAIQFGYHLGIMNVPSQVLSCSEFK--VPNEDVPYVETWLGK 57

Query: 108 ---EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQI 164
              +Q   L D + G+  +IF +G  +G   +G + +MYGRR+  +   L+ ++G +I I
Sbjct: 58  SGFKQCIPLDDEQIGITNAIFCLGGIVGSFFVGTICNMYGRRIISLFNCLLSLIGALI-I 116

Query: 165 ASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYC 224
            S N +     GR+++G+  G   ++ P  I E  P H +G      Q+MI +GI +   
Sbjct: 117 FSGNSFSTLLWGRLLTGVACGATLIVGPLFIKEVTPPHWKGFLNVTNQVMIKVGILL--- 173

Query: 225 TNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIF---VPESPRYLIEKGN---------- 271
           T       +++ +W+    + F  AI  +  ++    + +SP++L  +G+          
Sbjct: 174 TQLIGIVLNDSYRWRW---IFFCGAIAALVNLVLWLEIDDSPKWLFSRGDTLGAEMALFN 230

Query: 272 -----FEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASW-----GELFSPK 321
                ++EA+  +    +  VE    LA VE +    E   + G +S+      EL+   
Sbjct: 231 LRGGLYQEAQEEVQTWQR-EVEQQNSLANVEPMG---EYNVMMGPSSFWQYIHKELYWRP 286

Query: 322 GKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFVGL 381
            +I+  ++MG      QQ  G +   +YG  + D V  K S + + ++ +     T +  
Sbjct: 287 RQIITILLMG------QQFCGISSIVFYGVKVIDQVDPKHSLEINFLIQLTTVFVTIITC 340

Query: 382 YTVERYGRR 390
             V    R+
Sbjct: 341 IMVPVMNRK 349

>KLLA0C19481g 1747623..1748795 similar to ca|CA3241|IPF7493 Candida
           albicans putative permease (by homology), hypothetical
           start
          Length = 390

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 79/334 (23%), Positives = 143/334 (42%), Gaps = 19/334 (5%)

Query: 221 MGYCTNYGTKTY---SNAVQWKLPLGLCFLWA-IFMIAGMIFVPESPRYLIEKGNFEEAK 276
           + Y  NYGT  +   ++ +QW  P  +  + A + ++   I+  ESPR+L++ G  ++A 
Sbjct: 2   LAYFANYGTALHVSNTSRLQWVAPTSIKIVLAGLILVGSFIWCIESPRWLMKMGKDDKAI 61

Query: 277 RSIAKSNKLTVEDSGVLAEVELINAGV--EAEKLAGNASWG---ELFSPKGKILQRVIMG 331
            ++AK   L+     +  EV  I   +  E E ++G        E+   K    +  ++ 
Sbjct: 62  INLAKLRNLSETHPFIAGEVADIRYQIIQEKETMSGTGYLDMVKEIIFVKSVRYRFFVIA 121

Query: 332 CVIQSLQQLTGNNYFFYYGTTIFDAVGMK--DSFQTSIVLGVVNFASTFV-GLYTVERYG 388
           C++Q L Q +G N    Y   +   VG+K  D  + + VLGVV F S ++   + ++  G
Sbjct: 122 CLVQILGQWSGANAITIYAPELLSLVGVKGVDKLKMTAVLGVVKFVSAYISAFFFIDFLG 181

Query: 389 RRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKS---AGNAMIXXXXXXXXXXXX 445
           R+K    G +   +  + FA            D   +KS   A  A I            
Sbjct: 182 RKKAAYIGISIQLLTLLYFALFLTIVPQATESDAILTKSQFHASQAAIAALFLSGTGWTM 241

Query: 446 XWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTP-FITSAIGFYYGYVFMGC 504
            +  I Y++ +E +P+++++ A +  +  ++   F      P  + S   F   Y F+G 
Sbjct: 242 GFNSIQYLLSAEVFPIKIRSFAQSCIMLLHFSNQFGNSKAVPKMLLSMNNFGAFYFFVGV 301

Query: 505 LXXXXXXXXXXXCETKGLTLEEVNEMYQEGVLPW 538
           L            E  G +LE + E++    LPW
Sbjct: 302 LFISLLWVHFFVPEITGRSLESMEELFS---LPW 332

>YFL040W (YFL040W) [1643] chr6 (51350..52972) Putative hexose
           transporter, member of the hexose transport family of
           the major facilitator superfamily (MFS) [1623 bp, 540
           aa]
          Length = 540

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 99/506 (19%), Positives = 210/506 (41%), Gaps = 55/506 (10%)

Query: 55  EIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLS 114
           ++P+  +++   V  +  ++   GF+ G +  +++ F+    F   F      +Q  ++ 
Sbjct: 13  KMPKIKITKTYEVTKITAILTLVGFIMGLEVPSLATFLTNKTFNEYFKYPTPLQQGLLMG 72

Query: 115 DVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKW--YQ 172
               G I     +GC I  +   R   +Y  + G++   +V ++   I       W    
Sbjct: 73  STPLGGI-----MGCFICCIMNDRFSRIYQFQSGIIIWNIVTLLNFCI-------WDILG 120

Query: 173 YFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTY 232
             I R++ G+ +G  ++L  +  +E  P+  RG+ +S+ QL +T+GI + +        +
Sbjct: 121 LLICRMIKGMILGNFSILVASYANEVIPRGKRGSTMSYIQLCLTIGILVMHYLCIALSLW 180

Query: 233 SNAVQWKLPLGLCFLWAIFMIAGMIF------VPESPRYLIEKGNFEEA---KRSIAKSN 283
            +   +++       W I +I G++F      +PES  +L+  G   EA   + ++AK  
Sbjct: 181 DSHFAFRIA------WCIGIIPGLLFWMASYALPESYHWLVLHGKMSEAQEIQHNLAKKF 234

Query: 284 KLTVEDSGV--LAEVELIN---AGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQ 338
             +     V  ++++EL      GV     +          P+G   + +I+G  +Q L 
Sbjct: 235 NESQPRDAVPEMSKIELAGDFWIGVNDLDFSKKL-------PRGS-FKPLILGMTLQLLV 286

Query: 339 QLTGNNYFFYYGTTIFDAVGMKDSFQ--TSIVLGVVNFASTFVGLYTVERYGRRKCLLWG 396
           Q +G N    Y T I + VG++ + +  TS +   +N   + + +  ++   R+   L G
Sbjct: 287 QFSGINIILGYITYICEIVGLEGNVKLFTSSIPYFINMVLSLLPITFIDYTSRKLITLLG 346

Query: 397 SAAMSVCFVVFASVGVTKLYPNGKDMPSSKS----------AGNAMIXXXXXXXXXXXXX 446
              +S   +   ++ V K   + K +  ++S           G  ++             
Sbjct: 347 GFPISGLLITIGALFV-KYGQDTKPIDGNRSLVWSIGENPFVGGWILTLCFLIVGIFAMS 405

Query: 447 WAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLX 506
            + I +V  +E  P RVK +  A+ V   W+  F + F  P +   +      +F     
Sbjct: 406 LSSIPWVYTNEMLPSRVKVKGFAICVTFGWLGNFILTFLCPVMIERLKGTTFIIFGSLTF 465

Query: 507 XXXXXXXXXXCETKGLTLEEVNEMYQ 532
                      ETKG+++E++++ ++
Sbjct: 466 LISLSVLIWFPETKGMSIEDIDKFFE 491

>Scas_105.1
          Length = 56

 Score = 62.8 bits (151), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 30/44 (68%)

Query: 518 ETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYDVNETQED 561
           ETKGL+LEEVN M++EGVLPWKS  WVP  RR   YD      D
Sbjct: 2   ETKGLSLEEVNTMWEEGVLPWKSSEWVPPSRRGADYDAAAMATD 45

>Kwal_27.11385
          Length = 222

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 86/208 (41%), Gaps = 23/208 (11%)

Query: 336 SLQQLTGNNYFFYYGTTIFDAVGM--KDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCL 393
           SL QLTG N   YY +T+   +G   K S   S+V G      T   +  ++R+GRR   
Sbjct: 4   SLGQLTGINAIMYYMSTLMGRIGFSKKRSVAMSMVGGAALLIGTIPAILWMDRFGRRA-- 61

Query: 394 LWGSAAMSVCFVV-FASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXWAPIAY 452
            W +    V F +    VGV  L P   ++P    A   +              ++ + +
Sbjct: 62  -WANTI--VLFSLGLVLVGVGYLIPLKSNLP----AAEGVYLTGQILYNMAFGSYSALTW 114

Query: 453 VIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSA-------IGFYYGYVFMGCL 505
           V+ SE++ L  ++  M       ++W F + +    +  A       +GFY G   +  L
Sbjct: 115 VLPSESFSLATRSVGMTCCSTMLYLWSFTVTYNFDRMQKAMTYTGLTLGFYGGLAIVIGL 174

Query: 506 XXXXXXXXXXXCETKGLTLEEVNEMYQE 533
                       ETK  TLEE+++++ +
Sbjct: 175 PYQLLFMP----ETKNRTLEEIDDIFSK 198

>YDL199C (YDL199C) [675] chr4 complement(101291..103354) Member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [2064 bp, 687 aa]
          Length = 687

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 104/470 (22%), Positives = 181/470 (38%), Gaps = 58/470 (12%)

Query: 51  LENNEIPQ-----KPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFD 105
           L+  EI Q     K  S  +L       V     + G D G ISG V    F++ F    
Sbjct: 99  LQQAEISQLRSKKKRHSSRVLRTSFISFVVLVSSLSGLDQGLISGNVMTLSFQKYF---- 154

Query: 106 VGEQKYVLSDVRTGLIVSIFNIGCAIGGL-TLGRLGDMYGRRLGLMAVILVYVVGIIIQI 164
                Y L+    G IVSI N+G  +  L     + +   R+  L    ++Y +G I+Q+
Sbjct: 155 ----HYPLTS-PLGNIVSIVNLGAFMASLFVYSGILEPCSRKKMLQISTMIYSLGAIVQV 209

Query: 165 ASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISE---TAPKHLRGTCVSFYQLMITLGIFM 221
            + N+W    +GR + G+G+G     S  +I +     P   + T +S   +   +    
Sbjct: 210 LALNQWC-LLLGRFLLGVGMG--FAFSMVIIYQFEFPLPCIRKRTLISIQCVSSVIAYSF 266

Query: 222 GYCTNYGTKTYSNAVQWKLPLGLCFLWAIFM-IAGMIFVPESPRYLIEKGNFEEAKRSIA 280
           G   N   +    A  W+ PL       I + +     + ESP +L+++ N  EA   I+
Sbjct: 267 GIWINCAFRYLGFA--WRYPLSTHVALGIILNLMSFYLILESPSWLLKQKNDVEALVLIS 324

Query: 281 KSNKLTVEDSGVLAEVEL-INAGVEAEKLAGNASWGELFSPKGKILQ------RVIMGCV 333
                 V D G   E +  +   V    +   +   +   P   IL+      ++++G  
Sbjct: 325 -----NVFDDGNFEENQTQLKFRVLKRDILLKSHLQKNSYPYAYILKDFSSIIKLLIG-- 377

Query: 334 IQSLQQLTGNNYFFYYGTTIFDAVG---MKDSFQT---SIVLGVVNFASTFVGLYTVERY 387
            Q L +  G + F YY   I   +G    K  + T   +++  +V  A  +V L   +R 
Sbjct: 378 FQLLTRTNGVDAFLYYSPLILQQMGRGERKSIYLTGLNALIYSIVILA--YVPLVLRKRK 435

Query: 388 GRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIXXXXXXXXXXXXXW 447
            +   LL GS  M  C ++F ++  T  +P        KS    +              W
Sbjct: 436 EKTNVLL-GSIVM--CALLF-TISFTDWFP--------KSTTRYISILFAVFLFTHFISW 483

Query: 448 APIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYY 497
             I +V+  E  P   +   + +     WI+ + +   TP +   + + +
Sbjct: 484 DSIGWVMTIELLPHLSQAPVILLVSNFYWIFKWFVSLITPILIDRLSWKF 533

>Sklu_1567.2 YPR198W, Contig c1567 1150-2859
          Length = 569

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 51/97 (52%), Gaps = 1/97 (1%)

Query: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG 176
           + G +++ +++  A+  L  GR   ++G +  LM  I+++ +G ++ IA SN       G
Sbjct: 56  KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLV-IAVSNSMDMIIGG 114

Query: 177 RIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQL 213
           R+++G G  GI  L   + +    +H RGT V+   L
Sbjct: 115 RVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSL 151

>Kwal_26.6669
          Length = 590

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 62/136 (45%), Gaps = 3/136 (2%)

Query: 120 LIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIV 179
           L+ + +   CAI     G+  D++GR+  L++  L++  G +    S   W+   +GR+V
Sbjct: 120 LVATSYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWW-LILGRLV 178

Query: 180 SGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNA--VQ 237
           +G+G GG+  +   +I++  P   R     F  L   LG   G         Y N   + 
Sbjct: 179 TGIGGGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNGWRMA 238

Query: 238 WKLPLGLCFLWAIFMI 253
           + + L  CFL  I +I
Sbjct: 239 FMIQLPFCFLSTISII 254

>KLLA0E03729g 349784..351613 similar to sgd|S0006360 Saccharomyces
           cerevisiae YPR156c, start by similarity
          Length = 609

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 122/305 (40%), Gaps = 32/305 (10%)

Query: 1   MSSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKP 60
           +S + T   DR ++++         D +     PS+   E  F T  T+  EN      P
Sbjct: 109 ISRTRTRQMDRQDASSS----EEKNDEEPDEELPSHIDKEVEFVTFVTNDPENPH--NWP 162

Query: 61  L----SEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDV 116
           L    S  IL+  L + VA+G       +  I+G           G F V E+ +V  +V
Sbjct: 163 LWIRWSYTILMSVLVIAVAYG-------SACITG-----------GLFTVEEKFHVSQEV 204

Query: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG 176
              L  S+  IG ++G L    + D+YGRR+     + +YV+   I  A +       + 
Sbjct: 205 AI-LSCSLMVIGFSLGPLIWSPVSDLYGRRVAYFISLGLYVI-FNIPCALAKNIGTLLVC 262

Query: 177 RIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAV 236
           R + G+       L    I++  P   RG  ++F+      G   G   N      +N +
Sbjct: 263 RFLCGVWSSSGLCLVGGSIADMFPAETRGRAIAFFAYAPYCGPVFGPLVNGFIAISTNRM 322

Query: 237 QWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEV 296
                + + F   +++I   I  PE+   +I K   +  +  +     +T +++  ++  
Sbjct: 323 DLIFWVNMAFAGVMWIIVSCI--PETYAPVILKKRAKRLRIELNNPKIMTEQEAQGMSVS 380

Query: 297 ELINA 301
           EL+ A
Sbjct: 381 ELVRA 385

>CAGL0B02475g 236029..237771 highly similar to sp|P25297
           Saccharomyces cerevisiae YML123c PHO84, start by
           similarity
          Length = 580

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 117/288 (40%), Gaps = 55/288 (19%)

Query: 81  FGWD---TGTISGFVNMTDFKRRFG-NFDVGEQKYVL------SDVRTGLIVSIFNIGCA 130
           FGWD   T  I+G   +TD    F  N  +    YV       +  +T L VS  ++G  
Sbjct: 59  FGWDQVRTILIAGVGFLTDSYDIFAINLSISMMSYVFWQGNMPNSTQTLLKVST-SVGTV 117

Query: 131 IGGLTLGRLGDMYGRR--LGLMAVILVYVVGIIIQIASS---NKWYQYFIGRIVSGLGVG 185
           IG L  G + D+ GR+   GL  ++++    +   I  S   N        RIV G+G+G
Sbjct: 118 IGQLGFGTMADIVGRKKIYGLELIVMIATTILQTTIGRSPGINFPAVLTFYRIVMGIGIG 177

Query: 186 GIAVLSPTLISETAPKHLRGTCV-------SFYQL---MITLGIFMGYCTNYGTKTYSNA 235
           G   LS  + SE A    RG  +       ++ Q+   ++ L +   Y    G   Y+N+
Sbjct: 178 GDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQIAGGLVALIVIRAY---KGDLIYANS 234

Query: 236 -------------VQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIE-------KGNFEEA 275
                          W++ +G   +  I  +   + +PESPRY ++         N E+ 
Sbjct: 235 GAECDYACQKACDQMWRILIGFGAVPGIIGLYFRLTIPESPRYALDVKEEVDLPSNIEKV 294

Query: 276 KRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPKGK 323
           + +    +   +E S  + E  ++   V   K    ASW +  S  GK
Sbjct: 295 RATADDEHLEDLERSSTVVEDGIV---VPPPK---KASWKDFRSHFGK 336

>KLLA0F13684g complement(1267367..1269082) similar to sp|Q04301
           Saccharomyces cerevisiae YMR088c, start by similarity
          Length = 571

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 2/114 (1%)

Query: 109 QKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSN 168
           +++  SD +  ++ S      A   L  G+L D+ GR+  LM     ++VG +    S N
Sbjct: 69  EEFEESDKKQWIVTSFLLTNTAFQPL-YGKLSDLAGRKTALMVAHSFFLVGCLFTALSRN 127

Query: 169 KWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMG 222
              ++ I R V G+G GGI+ LS   +S+      RG    +  ++   G  +G
Sbjct: 128 -LVEFSIARAVCGMGAGGISALSSISVSDICTPKERGVYQGYANVVFGTGSMLG 180

>Sklu_2405.6 YBR180W, Contig c2405 11289-13079 reverse complement
          Length = 596

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 73/165 (44%), Gaps = 3/165 (1%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRR-LGLMAVILVYVVGIIIQIAS 166
           ++ + +S       VS+F    ++G L      D  GR+ L +++++L  +V I++    
Sbjct: 167 QESFNVSATTINATVSVFMAVFSVGPLFWALFADFGGRKFLYIVSLLLTIIVNILLSAVP 226

Query: 167 SNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTN 226
           +N    +F+ RI    G   +  L    +S+  P   RG  VS++ L   +G  +     
Sbjct: 227 TNIGALFFL-RIAQAFGSSSVMSLGIGTVSDITPPKSRGRAVSYFMLGPNMGPILAPIIA 285

Query: 227 YGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGN 271
                 SN  +W     +C +  I +   ++ +PE+ R ++  G+
Sbjct: 286 GLILMSSNNWRWLFGF-ICIISGIALFLVVLLLPETLRCIVGNGD 329

>YML123C (PHO84) [3849] chr13 complement(24038..25801) High-affinity
           inorganic phosphate/H+ symporter, member of the
           phosphate:H[+] symporter (PHS) family of the major
           facilitator superfamily (MFS) [1764 bp, 587 aa]
          Length = 587

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 104/249 (41%), Gaps = 43/249 (17%)

Query: 81  FGWD---TGTISGFVNMTDFKRRFG-NFDVGEQKYVL------SDVRTGLIVSIFNIGCA 130
           FGW    T +I+G   +TD    F  N  +    YV          +T L VS  ++G  
Sbjct: 58  FGWQQVKTISIAGVGFLTDSYDIFAINLGITMMSYVYWHGSMPGPSQTLLKVST-SVGTV 116

Query: 131 IGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG-----RIVSGLGVG 185
           IG    G L D+ GR+      +++ +V  I+Q   ++     F+      RIV G+G+G
Sbjct: 117 IGQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAHSPAINFVAVLTFYRIVMGIGIG 176

Query: 186 GIAVLSPTLISETAPKHLRGTCV-------SFYQL---MITLGIFMGYCTNYGTKTYSNA 235
           G   LS  + SE A    RG  +       ++ Q+   +I L +   Y    G   Y+N+
Sbjct: 177 GDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQISGGIIALILVAAY---KGELEYANS 233

Query: 236 -------------VQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIE-KGNFEEAKRSIAK 281
                          W++ +GL  +  +  +   + +PESPRY ++     E A  +  +
Sbjct: 234 GAECDARCQKACDQMWRILIGLGTVLGLACLYFRLTIPESPRYQLDVNAKLELAAAAQEQ 293

Query: 282 SNKLTVEDS 290
             +  + D+
Sbjct: 294 DGEKKIHDT 302

>Kwal_27.12173
          Length = 567

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 76/171 (44%), Gaps = 15/171 (8%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRR-LGLMAVILVYVVGIIIQIAS 166
           ++ + +S       VS+F    A+G L      D  GR+ L +++++L  +V +++    
Sbjct: 138 QRIFGVSSTTINATVSVFMAVFAVGPLIWASFADFGGRKILYMISLLLTVIVNVLLAAVP 197

Query: 167 SNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLG-----IFM 221
            N    +F+ R++       +  L    +S+  P  +RG  ++++ L   +G     I  
Sbjct: 198 VNTGALFFL-RVMQAFASSSVMALGAGTVSDIRPPQVRGKAIAYFMLGPNMGPILAPIIA 256

Query: 222 GYCTNYGTKTYSNAVQWKLPLGLC-FLWAIFMIAGMIFVPESPRYLIEKGN 271
           G     G+        W+   G    L  I +IA ++F+PE+ R ++  G+
Sbjct: 257 GLILMRGS-------YWRWLFGFTSILSGIGLIAVIVFLPETLRCIVGNGD 300

>Scas_694.19
          Length = 581

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 72/162 (44%), Gaps = 7/162 (4%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           E+++ L + +  + V ++ +   I     G L D++GRR  ++  +L+YVV   I +A +
Sbjct: 118 EKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVA-SIGLACA 176

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNY 227
             +      RI+  +G+     +S  ++ +   KH RGT V     ++ LG   G     
Sbjct: 177 PSYGVIVFLRIIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGLVLLGQCFGSLIGA 236

Query: 228 GTKTYSN--AVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLI 267
                 N  A+ W L +G         I   + +PE+ R L+
Sbjct: 237 VLAAAWNWRAIFWFLTIGC----GTSFIIAFLLLPETKRTLV 274

>Scas_626.1
          Length = 570

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 97/242 (40%), Gaps = 47/242 (19%)

Query: 81  FGW---DTGTISGFVNMTDFKRRFG-NFDVGEQKYVL------SDVRTGLIVSIFNIGCA 130
           FGW    T  ++G   +TD    F  N  +    YV       +   T L VS  ++G  
Sbjct: 44  FGWAQIRTILVAGVGFLTDSYDIFAINLGIAMMSYVYWQDKMPASTATLLKVST-SVGTV 102

Query: 131 IGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG-----RIVSGLGVG 185
           IG +  G + D+ GR+      +++ +V  ++Q  +       F+      RIV G+G+G
Sbjct: 103 IGQVGFGTIADIVGRKKIYGLELIIMIVMSVLQTTTGESRAINFVAVLTFYRIVMGIGIG 162

Query: 186 GIAVLSPTLISETAPKHLRGT----------------------CVSFYQLMITLGIFMGY 223
           G   LS  + SE A    RG                       CV+ Y+  +        
Sbjct: 163 GDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQIAAGIVALVCVAAYKDQLIGAETAEM 222

Query: 224 CTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIF---VPESPRYLIE-KGNFEEAKRSI 279
           C     K       W++ +GL    A+  +AG+ F   +PESPRY ++ + N  +A   I
Sbjct: 223 CGPDCMKACDQ--MWRILVGLG---AVPGLAGLYFRLTIPESPRYTLDVETNAAQASEDI 277

Query: 280 AK 281
            K
Sbjct: 278 EK 279

>AGR076C [4386] [Homologous to ScYDR119W - SH] (871570..873630)
           [2061 bp, 686 aa]
          Length = 686

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 5/90 (5%)

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLIS 196
           G+L D++GRR  L+   LV+ +G +I   S N W    +GR V+G+G GG+  +     +
Sbjct: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254

Query: 197 ETAPKHLR----GTCVSFYQLMITLGIFMG 222
           +  P   R    G C  F+ L    G  +G
Sbjct: 255 DIVPLRSRALYQGICNVFFGLGTACGGLVG 284

>ADL258W [1483] [Homologous to ScYNL065W (AQR1) - SH; ScYIL121W -
           SH] complement(247674..249278) [1605 bp, 534 aa]
          Length = 534

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 104/243 (42%), Gaps = 29/243 (11%)

Query: 42  GFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRF 101
           G A  +TS  E ++IP   L      M + L+ + G   F    G+ + +  + + +R F
Sbjct: 46  GEACVSTS--EISKIPHSMLRYSQKWMMVALLTSAG---FWSSLGSPAVYPALRNLQREF 100

Query: 102 GNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGII 161
           G          +S+    + V ++ +   +       L D YGRR  ++  +L+++V   
Sbjct: 101 G----------VSEDLVNIAVVVYLLFQGVAPTVCSGLADTYGRRPVILMGMLIFIVS-S 149

Query: 162 IQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFM 221
           I IA SN +      R +   G+  I  ++  ++ +   K  RGT +     +  LG   
Sbjct: 150 IGIACSNSFALVIALRCIQSSGISPIIAINSGVVGDFTLKSERGTFIGAVSGLTLLGQAF 209

Query: 222 GYCTNYGTKTYSN--AVQWKLPL--GLCFLWAIFMIAGMIFVPESPRYLIEKGNFE-EAK 276
           G           N  AV W + +  G+CFL      A  +F+PE+ R ++  GN   + K
Sbjct: 210 GSLIGASLTAAYNWRAVFWFMTIGCGVCFL------ANFLFLPETHRCIV--GNLSLKPK 261

Query: 277 RSI 279
           R+I
Sbjct: 262 RNI 264

>YIL120W (QDR1) [2556] chr9 (134414..136105) Member of the
           multidrug-resistance 12-spanner (DHA12) family of the
           major facilitator superfamily (MFS-MDR) [1692 bp, 563
           aa]
          Length = 563

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/254 (20%), Positives = 108/254 (42%), Gaps = 25/254 (9%)

Query: 25  TDFDSQSRTPSNKLSE-DGFATKTTSPLENNE----IPQKPLSEYILVMCLCLMVAFGGF 79
           +D ++  R+ S+ +S+ D   + + S ++N      +P    S +   M L +  AF GF
Sbjct: 22  SDNNNVDRSSSDAISDNDAERSNSHSEIDNESNFDMVPYSRFS-HKQKMLLVVQCAFTGF 80

Query: 80  VFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRL 139
                  T++G +        +    + E+K+ +++    + + ++ I   +    +G L
Sbjct: 81  F-----STVAGSI-------YYPVLTIIERKFNITEELANVTIVVYFIFQGVAPSIMGGL 128

Query: 140 GDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETA 199
            D +GRR  ++  IL Y     I +A ++ + Q    R +   G+  +  ++  ++ +  
Sbjct: 129 ADTFGRRPIVLWAILAYFCA-CIGLACAHNYAQILALRCLQAAGISPVIAINSGIMGDVT 187

Query: 200 PKHLRGTCVSFYQLMITLGIFMGYCTNYG--TKTYSNAVQWKLPLGLCFLWAIFMIAGMI 257
            K  RG  V        +G   G     G  +K    A+ W L +G      I ++   +
Sbjct: 188 TKVERGGYVGLVAGFQVVGTAFGALIGAGLSSKWGWRAIFWFLAIG----SGICLVFSTL 243

Query: 258 FVPESPRYLIEKGN 271
            +PE+ R L+  G+
Sbjct: 244 LMPETKRTLVGNGS 257

>Kwal_56.23754
          Length = 589

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 6/140 (4%)

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLIS 196
           G+L D  GR+  L+   +V+ +G +I   S++ W+   +GR VSG+G  G+  L+  +IS
Sbjct: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVIS 196

Query: 197 ETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGM 256
           +  P   R         +  LG   G       + +  A   + P+ L    +  +I   
Sbjct: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA---SCALIVSY 253

Query: 257 IFVPESPRYLIEKGNFEEAK 276
           + +P  PR+  +K     +K
Sbjct: 254 LELP--PRHEDDKDRHWTSK 271

>AFR322C [3514] [Homologous to ScYGR138C (TPO2) - SH; ScYPR156C
           (TPO3) - SH] (1017695..1019473) [1779 bp, 592 aa]
          Length = 592

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 79/183 (43%), Gaps = 5/183 (2%)

Query: 109 QKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSN 168
           +KY +S     L  S+  +G  +G L    L D+YGRR+     + +YVV   I  A + 
Sbjct: 180 RKYDVSTEVAILSCSLVVLGYGVGQLVWAPLSDLYGRRITYFTSLFLYVV-FNIPCAVAP 238

Query: 169 KWYQYFIGRIVSG-LGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNY 227
                 + R + G L   G+ ++  +L ++  P  LRG  ++F+      G       N 
Sbjct: 239 NIQTLLVCRFICGVLSSSGLCLVGGSL-ADMFPADLRGLTIAFFAFAPYGGPVFAPLING 297

Query: 228 GTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTV 287
                +  +     + +    A++++  +  VPE+   +I K   E+ ++     N +T 
Sbjct: 298 FIAVRTERLDLIFWVNMALAGAVWLLVAL--VPETYAPIILKRRAEKLRKLTGNQNIMTE 355

Query: 288 EDS 290
           +++
Sbjct: 356 QEA 358

>Kwal_47.18919
          Length = 640

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 86/202 (42%), Gaps = 4/202 (1%)

Query: 102 GNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGII 161
           G F V ++ +V  +V   L  S+  IG ++G L    + D++GRR+     + +YV+   
Sbjct: 220 GLFTVSDKFHVSQEVSI-LTCSLMVIGFSLGPLIWSPVSDLFGRRVAYFVSLGLYVI-FN 277

Query: 162 IQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFM 221
           I  A +       + R + G+       L    I++  P   RG  ++F+      G   
Sbjct: 278 IPCALAPNIGCLLVCRFLCGVWSSSGLCLVGGSIADMFPPETRGRAIAFFAYAPYCGPVF 337

Query: 222 GYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAK 281
           G   N      ++ +     + + F   ++++   I  PE+   +I K    + +R    
Sbjct: 338 GPLVNGFISVSTHRMDLIFWVNMAFAGVMWLVVACI--PETFAPVILKRRAAKLRRETGN 395

Query: 282 SNKLTVEDSGVLAEVELINAGV 303
              +T +++  L+  E++NA V
Sbjct: 396 PKIMTEQEAQGLSVGEMVNACV 417

>YDR119W (YDR119W) [966] chr4 (688221..690527) Member of the
           14-spanner drug:[H+] antiporter (DHA14) family of
           multidrug-resistance (MFS-MDR) proteins in the major
           facilitator superfamily (MFS) [2307 bp, 768 aa]
          Length = 768

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 68/145 (46%), Gaps = 8/145 (5%)

Query: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG 176
           R  L++S + +  AIG L   +L  +   +L L      +++G  +  +S++ W  +   
Sbjct: 285 RLSLVISAYLLSNAIGQLVFLKLSLISSVKLLLCIAQFSFILGGYLSWSSAHFW-TFIFA 343

Query: 177 RIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMG-YCTNYGTKTYSNA 235
           R V+G G G +  L  T+++  + K+     +S   +   +G+ +G +  N    ++ + 
Sbjct: 344 RCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSG 403

Query: 236 VQWK----LPLGLCFLWAIFMIAGM 256
             W+    +P+  C + A  M+A M
Sbjct: 404 --WRNAFLIPVPFCLVNASIMLADM 426

>Sklu_2348.1 YNL065W, Contig c2348 581-2278 reverse complement
          Length = 565

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 67/150 (44%), Gaps = 5/150 (3%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           EQ + +++    + V ++ I   +     G L D+YGRR  ++A +L+YVV   I +A S
Sbjct: 125 EQVFNINEEMVNITVVVYFIFQGVAPTISGGLADVYGRRPIILAGMLIYVVA-SIGLACS 183

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNY 227
           N +      R V   G+  +  +   ++ +   K  RG+ V        +G   G     
Sbjct: 184 NSYGVIVFLRCVQSAGISPLIAIISGVVGDFTTKSERGSFVGAVSGFALMGQAFGSLIGA 243

Query: 228 G-TKTYS-NAVQWKLPLGL--CFLWAIFMI 253
           G T  Y   A+ W L +G   CF+   F++
Sbjct: 244 GLTAAYDWRAIFWFLTIGCGTCFVINFFLL 273

>Sklu_2304.5 , Contig c2304 8691-10388
          Length = 565

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 121 IVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIAS-SNKWYQYFIGRIV 179
           I + + + C+      G+L D++GR++ L+   L + +G  I  +  +N  +    GR V
Sbjct: 81  IATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVWVLSTGRFV 140

Query: 180 SGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLG 218
           +G+G GG A LS    S+  P   RG       +  +LG
Sbjct: 141 AGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLG 179

>Sklu_1959.3 , Contig c1959 3851-5446 reverse complement
          Length = 531

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 92/237 (38%), Gaps = 22/237 (9%)

Query: 54  NEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVL 113
           N IP   L  Y     L ++ AF  F   W+      F    + K+   +FDV   K V 
Sbjct: 61  NPIPALKLISY--KQWLFILSAFASFT--WEA--FDFFTVTLNVKKISHDFDV-TTKQVT 113

Query: 114 SDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQY 173
             +   L++ +      +G +  G +GD YGR++  +  +   +V  II     + +  +
Sbjct: 114 WGITLVLMLRV------VGAVLFGYIGDRYGRKVSFIINLFFMMVLEIITGFIKHNFKYF 167

Query: 174 FIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYS 233
            I R   G+ +GGI   S     +  P         F+Q   TLG  +           +
Sbjct: 168 LIARAFFGVVLGGIFGNSAAQCFDDCPPEAHSFISGFFQQGYTLGYLLAVIFTRALADTT 227

Query: 234 NAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDS 290
              +W+     CF +A    AG+ F+    R L+ + N    ++ I    KL  ED 
Sbjct: 228 KD-RWR----SCFWFA----AGITFLLIIFRALLPETNAFLERQRIKAEKKLNNEDD 275

>CAGL0I10384g 1016935..1018827 highly similar to sp|P53283
           Saccharomyces cerevisiae YGR138c, start by similarity
          Length = 630

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 97/237 (40%), Gaps = 22/237 (9%)

Query: 65  ILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSI 124
           +++ CL + VA+G       +  I+G           G F V EQ +V  +    L  S+
Sbjct: 189 VILSCLVICVAYG-------SACITG-----------GLFTVQEQYHVGLEAAI-LSCSL 229

Query: 125 FNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGV 184
             IG ++G L    + D+YGRRL     + +Y +   I  A S       + R + G+  
Sbjct: 230 MVIGFSLGPLIWSPVSDLYGRRLAYFISMGLYTI-FNIPCALSPNLGGLLVCRFLCGVFS 288

Query: 185 GGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGL 244
                L    I++  P   RG  ++F+      G  +G   N      +  +     + +
Sbjct: 289 SSGLCLVGGSIADMFPSETRGRAIAFFAFAPYTGPIIGPLVNGFVSVCTRRMDLIFWINM 348

Query: 245 CFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINA 301
            F   +++I    F+PE+   +I K    + ++       +T +++  ++  E++ A
Sbjct: 349 AFAGVMWIIVA--FIPETYAPVILKWRAAKLRKETGNPKIMTEQEAQGVSVNEMMKA 403

>KLLA0E14652g 1302073..1303992 similar to sp|P38724 Saccharomyces
           cerevisiae YHL047c TAF1 siderophore transporter for
           triacetylfusarinine C, hypothetical start
          Length = 639

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 81/191 (42%), Gaps = 23/191 (12%)

Query: 26  DFDSQSRTPSNKLSEDGF--ATKTTSPLENNEIPQKPLSEY-----------ILVMCLCL 72
           D   QSR+ S   +ED F  A K           Q+ L EY           +++  + +
Sbjct: 11  DRKIQSRSSSFDNNEDSFPNANKENLTFAEENHKQELLDEYGVPDKLRANRSLVIRKMEI 70

Query: 73  MVAFGGFVFGWDTGTISGFVNM--TDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCA 130
           M      VF       + F+    TD   +  N       Y  +  R+  ++S   +  +
Sbjct: 71  MRKQYTSVFAICVFLFTAFLAGVGTDLNSQLRN---NYTTYATNSYRSHSLLSTIGVVSS 127

Query: 131 I---GGLTL-GRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGG 186
           I   G LT+  RL D++GR    ++ +L +VVG IIQ + +N   +Y  G +   LG  G
Sbjct: 128 IISAGALTVYARLSDVFGRIRLYLSAMLFFVVGTIIQ-SQANNVQKYAAGTVFYSLGTAG 186

Query: 187 IAVLSPTLISE 197
           I V+   ++S+
Sbjct: 187 IQVMMFIIMSD 197

>CAGL0J01375g 127843..129537 similar to sp|Q04301 Saccharomyces
           cerevisiae YMR088c, start by similarity
          Length = 564

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLIS 196
           G+L D+ GR+  ++     + +G ++    +N   Q+ I R + G+G GGI  +S   +S
Sbjct: 93  GKLSDLTGRKFAVLTAHFFFGLGCLLT-CFANSVTQFAIARAICGVGGGGINAMSSITVS 151

Query: 197 ETAPKHLRGTCVSFYQLMITLGIFMG 222
           +   +  RG    +  ++  LG  +G
Sbjct: 152 DICTQRERGIYQGYANIVFGLGQILG 177

>KLLA0A04631g complement(415070..416809) similar to
           ca|CA1324|IPF6676 Candida albicans polytopic membrane
           protein involved in drug transport (by homology), start
           by similarity
          Length = 579

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLIS 196
           G++ D++GRR  ++   L +++G +I   S N W     GR ++G+G GG+  L     S
Sbjct: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLW-TLVAGRFIAGIGGGGVTSLGSITAS 175

Query: 197 ETAPKHLRG 205
           +  P   R 
Sbjct: 176 DIVPLRSRA 184

>YBR180W (DTR1) [364] chr2 (589698..591416) Dityrosine transporter,
           functions in maturation of the spore wall, member of the
           multidrug-resistance 12-spanner (DHA12) family of the
           major facilitator superfamily (MFS-MDR) [1719 bp, 572
           aa]
          Length = 572

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 51/117 (43%), Gaps = 12/117 (10%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRR------LGLMAVILVYVVGII 161
           +++Y +S       VS+F    ++G L  G L D  GR+      L LM ++ + +  + 
Sbjct: 138 QREYDVSATTINATVSVFMAVFSVGPLFWGALADFGGRKFLYMVSLSLMLIVNILLAAVP 197

Query: 162 IQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLG 218
           + IA+       F+ RI        +  L    +++  P   RG  ++++ +   +G
Sbjct: 198 VNIAA------LFVLRIFQAFASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPNMG 248

>Scas_705.26
          Length = 614

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 118/295 (40%), Gaps = 36/295 (12%)

Query: 1   MSSSATPMNDRSNSNTELAAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIPQKP 60
           +SS   P ND  +   EL   +S    +  S + ++  S  G      S + N EI  K 
Sbjct: 12  VSSDHVPAND--SGKVELTGKASAIKINELSSSAAS--STIGSEYIENSGVHNAEIYCKY 67

Query: 61  LS---EYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVR 117
            S   + I+V     ++AF    +G D    + +  M              Q  +LS V 
Sbjct: 68  YSHPIKRIMVFSSLFLIAFA---YGLDNSVRTTYQTMATSSY--------SQHSLLSTV- 115

Query: 118 TGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGR 177
                 I  +  A   L   R  DM+GR   L   I+ YV+G II+  + +   +Y  G 
Sbjct: 116 ----TCIKKVISAAAQLWFARSADMFGRPTILTISIIFYVIGTIIECRAFDV-SRYAAGA 170

Query: 178 IVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQ 237
            +  LG  GI ++S   +++ +  + R T  +   L   +  ++      G  T +    
Sbjct: 171 CIFSLGHAGIVLVSELYVADFSNLNWRVTAAAAQVLPNVITTWIS-----GNITGAIDKN 225

Query: 238 WKLPLGLCFLWA-IFMIA--GMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVED 289
           W+  +G   +WA IF ++   +I      RYL  K N E  K    K N +T ++
Sbjct: 226 WEWGIG---MWAFIFPLSCVPLIICIIHMRYLARKNN-ENLKVVFQKPNYMTWKE 276

>YNL065W (AQR1) [4525] chr14 (503723..505483) Member of the
           multidrug-resistance 12-spanner (DHA12) family of the
           major facilitator superfamily (MFS-MDR) [1761 bp, 586
           aa]
          Length = 586

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 79/180 (43%), Gaps = 14/180 (7%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           E+++ + +    + V ++ +   I     G L D +GRR  ++A +L+YV+   I +A +
Sbjct: 128 EKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVIA-SIGLACA 186

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTN- 226
             +      R +  +G+     +S  ++ +   KH RGT V      + LG   G     
Sbjct: 187 PSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGFVLLGQCFGSLIGA 246

Query: 227 -YGTKTYSNAVQWKLPLGL--CFLWAIFMIAGMIFVPESPRYLIEKGNFE-EAKRSIAKS 282
               +    A+ W L +G   CFL A  ++      PE+ R +   GN   + KR I ++
Sbjct: 247 VLTARWDWRAIFWFLTIGCGSCFLIAFLIL------PETKRTI--AGNLSIKPKRFINRA 298

>KLLA0F10043g complement(928691..930277) weakly similar to sp|P36035
           Saccharomyces cerevisiae YKL217w JEN1 carboxylic acid
           transporter protein singleton, start by similarity
          Length = 528

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 66/168 (39%), Gaps = 23/168 (13%)

Query: 131 IGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS--NKWYQYFIGRIVSGLGVGGIA 188
           IG L  G LGD YGR+      +L   + I+IQI +   N +  +   R + G+ +G + 
Sbjct: 129 IGALIFGYLGDRYGRKYSF---VLTMALIIVIQIGTGFVNSFSAFLGCRAIFGIIMGSVF 185

Query: 189 VLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLG-LCFL 247
            ++     E AP   +      +Q     G  +G         +  A+    P G     
Sbjct: 186 GVASATALENAPNKAKSILSGIFQEGYAFGYLLGV-------VFQRAIVDNSPHGWRAIF 238

Query: 248 W-----AIFMIAGMIFVPESPRYLIEKGNFE----EAKRSIAKSNKLT 286
           W      +  IA  + +PES  Y +E+   E    + K    K+ KL 
Sbjct: 239 WFSAGPPVLFIAWRLMLPESQHY-VERVRLEKLENDGKSQFWKNAKLA 285

>Scas_692.8
          Length = 625

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 72/327 (22%), Positives = 131/327 (40%), Gaps = 61/327 (18%)

Query: 23  SPTDFDSQSRTPSNK-LSEDGFAT---------KTTSPLENNEIPQKPLSEYILVMCLCL 72
           S T+ + +S+  + K L+E G A              PLE   +  + + E         
Sbjct: 39  STTELNQESQDNNVKYLTEGGNAAFHNYINDFAHIEDPLERRRLALQKIDET-------- 90

Query: 73  MVAFGGFVFGWD---TGTISGFVNMTDFKRRFG-NFDVGEQKYVL------SDVRTGLIV 122
                   FGW    T  I+G   +TD    F  N  +    YV       +   T L V
Sbjct: 91  -------AFGWSQIRTILIAGVGFLTDSYDIFAINLGITMMSYVHWKGNMPASTATLLKV 143

Query: 123 SIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG-----R 177
           S  ++G  IG +  G + D+ GR+      +++ ++  I+Q  + +     F+      R
Sbjct: 144 ST-SVGTVIGQVGFGTMADVIGRKKIYGMELILMIITTILQCTTGSSPGINFVAVLTFYR 202

Query: 178 IVSGLGVGGIAVLSPTLISETAPKHLRGTCV-------SFYQLM---ITLGIFMGYCT-- 225
           I+ G+G+GG   LS  + SE +    RG  +       ++ Q++   I L +   Y +  
Sbjct: 203 ILMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQILGGIIALVLVAAYKSSL 262

Query: 226 ---NYGTKTYSNAVQ-----WKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKR 277
              N G +     ++     W++ +GL  +  +  +   + +PESPRY ++     ++  
Sbjct: 263 IDANTGAECGYECMKACDQMWRILIGLGAVPGVIGLYFRLTIPESPRYSLDVDADLDSIE 322

Query: 278 SIAKSNKLTVEDSGVLAEVELINAGVE 304
               ++ +  E  G  A +E  N  VE
Sbjct: 323 VTKVTDNVMEEKLGDSASLERANTMVE 349

>CAGL0B02079g complement(191736..193610) similar to sp|P50080
           Saccharomyces cerevisiae YGR224w AZR1 or sp|P36172
           Saccharomyces cerevisiae YKR105c, hypothetical start
          Length = 624

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 133/307 (43%), Gaps = 59/307 (19%)

Query: 66  LVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIF 125
           LV+CL        F+   D  T+S  +   +  ++FG++            + G + + +
Sbjct: 49  LVLCL--------FLAALDVMTVSTIIE--EVSQKFGDYS-----------KVGWLFTGY 87

Query: 126 NIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVG 185
           ++  A+  L  GR+  + G +   +A I+++ VG ++  A +N       GR+++G+G  
Sbjct: 88  SLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVS-ALANSMDMLIGGRVIAGIGGS 146

Query: 186 GIA----VLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWK-- 239
           G+     V+S TL+ E     +     S + +   +G F+G         ++  V W+  
Sbjct: 147 GVQSLVFVISSTLVEERNRGLIIAVMSSSFGIASVVGPFLG-------GAFTTHVTWRWC 199

Query: 240 ----LPLG--LCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVL 293
               LP+G    FL+  F      + PE  ++++ K   E+      +   L++     +
Sbjct: 200 FYINLPVGGLAFFLFLTF------YNPE--KWVVNKDTAEDEVVGNGRLGLLSILGGQAV 251

Query: 294 AEVELINAGVEAEKLAGNASW----GELFSPKGKILQRVIM--GCVIQSLQ-QLTGNNYF 346
             V+  + GV+  KL    +W     ELF  +  I++ V M  G V+  L     GN Y 
Sbjct: 252 RFVK--SVGVQLAKLRYPGTWRIIARELFY-RFDIVEFVFMTLGSVLILLAFTFGGNKYK 308

Query: 347 FYYGTTI 353
           +  G+TI
Sbjct: 309 WNSGSTI 315

>KLLA0E24156g complement(2148115..2149842) similar to sp|P38125
           Saccharomyces cerevisiae YBR180w DTR1 dityrosine
           transporter, start by similarity
          Length = 575

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 59/309 (19%), Positives = 122/309 (39%), Gaps = 24/309 (7%)

Query: 4   SATPMNDRSNSNTELAAVSS--PTDFDS-QSRTPSNKLSEDGFATKTTSPLENNEIPQKP 60
           S  P  +R    +++  +S    TDFDS +S+   + +  +    +T       EI   P
Sbjct: 41  SINPNENRLEKESDMTDISEIKDTDFDSDKSKEEQSSIVRNEKHPETAFTALEPEIAYNP 100

Query: 61  ----LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDV 116
                S Y +V  L L++ + GF+     G ++G + +           + + ++  S  
Sbjct: 101 PYSAFSNYQVVSIL-LIIIYIGFL-----GPVTGNIYIPALP-------ILQSEFNTSTT 147

Query: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG 176
                V+ F    A+G        D  GR+   +  +++ ++  ++  A        +I 
Sbjct: 148 AINGTVAAFMGVFAVGPFLWAVHADFGGRKFLYIFSLMIALIANVLLAAVPKHLAALYIL 207

Query: 177 RIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAV 236
           R+   +G   +  L    +S+      R   VS++ L   +G  +G    +G     N  
Sbjct: 208 RVFQAIGTSAVIPLGVGTVSDLISPMNRAKGVSYFMLGPNMGPILGPI--FGGLILMNGN 265

Query: 237 QWKLPLGLCFLWA-IFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAE 295
           QW+   G   +   + +I  + F+PE+ R ++  G+    K        L++E+S    E
Sbjct: 266 QWRWLFGFTSITTGVGLILIVTFLPETLRCIVGNGD-PRWKEDSEFPASLSIEESSQTKE 324

Query: 296 VELINAGVE 304
             ++   ++
Sbjct: 325 ESVVKPHMQ 333

>Sklu_2253.3 , Contig c2253 3254-4825 reverse complement
          Length = 523

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 61/149 (40%), Gaps = 9/149 (6%)

Query: 131 IGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS-NKWYQYFIG-RIVSGLGVGGIA 188
           IG L  G LGD YGR++     +L+     IIQI +   K +  F+G R V G+ +G + 
Sbjct: 124 IGALIFGYLGDRYGRKIPYCISMLLIC---IIQIGTGFVKSFPAFLGCRAVFGIVMGSVF 180

Query: 189 VLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLW 248
            ++     E AP+  +      +Q     G  +G          S+   W+         
Sbjct: 181 GIASATSLENAPEESKSILSGIFQEGYAFGYLLGVVFQRAIVDNSSH-GWRAMFWFSSGP 239

Query: 249 AIFMIAGMIFVPESPRYLIEKGNFEEAKR 277
            I  IA  + +PES  Y   K    E KR
Sbjct: 240 PILFIAWRLLLPESEAYTRRKA---EEKR 265

>Kwal_23.4824
          Length = 553

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 78/176 (44%), Gaps = 15/176 (8%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           E+++ +S+    + V ++ I   +     G L D+YGRR  ++  +L+YV    I +A S
Sbjct: 114 EKQFSVSEELVNITVVVYLIFQGVAPTISGGLADVYGRRPVILIGMLIYVCA-SIGLACS 172

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGT---CVSFYQLM-ITLGIFMGY 223
           N +      R +   G+  I  ++  ++ +   K  RGT    VS + LM    G  +G 
Sbjct: 173 NSYGVIVFLRCLQSAGISPIIAINSGVVGDFTVKQERGTFVGAVSGFTLMGQAFGSLIGA 232

Query: 224 CTNYGTKTYS-NAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRS 278
                T  +   A+ W L +G        M+   + +PE+ R ++  GN     +S
Sbjct: 233 AL---TAAFDWRAIFWFLTIGC----GTCMLVNFLLLPETKRSIV--GNMSIKPKS 279

>Scas_660.3
          Length = 568

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLIS 196
           G+L D+ GR+  ++     + +G  +   + N   Q+ I R + G+G GG+  +S   +S
Sbjct: 96  GKLSDITGRKFAVLTSHFFFGLGCFLTCFAQNI-TQFSIARAICGIGAGGVNAMSSITVS 154

Query: 197 ETAPKHLRGTCVSFYQLMITLGIFMG 222
           +      RG    +  ++  LG  +G
Sbjct: 155 DICSTRERGIYQGYANIVFGLGQLLG 180

>Scas_721.15
          Length = 530

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 49/111 (44%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           ++ + +S       VS+F    A+G L  G   D+ GR++  +  IL+ V+  I+  +  
Sbjct: 96  QKDFNVSSTVINATVSVFMAVFAVGPLFWGLFADVGGRKVLYICSILLMVIVNILLASIP 155

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLG 218
                 F+ RIV   G   +  L    +++  P   RG  + ++ +   +G
Sbjct: 156 AHISSLFVLRIVQAFGSSSVITLGAGTVTDITPPKQRGRAIGYFMIGPNMG 206

>CAGL0M06281g 651932..653560 similar to sp|P38125 Saccharomyces
           cerevisiae YBR180w DTR1, hypothetical start
          Length = 542

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 70/164 (42%), Gaps = 1/164 (0%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           ++++ +S+      VS+F    +I  L  G L D  GR++  +  I + V+  I+  +  
Sbjct: 107 QKEFNVSETTINATVSVFMATFSISPLFWGALADKGGRKILYIISISLMVIINILLASVP 166

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNY 227
            K       RI+       +  L    +++  P   RG  ++++ L   LG  +      
Sbjct: 167 KKIGSLIFLRIIQAFASSSVISLGAGTVADLTPPKDRGKAMAYFMLGPNLGPILAPIIAG 226

Query: 228 GTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGN 271
                +N  +W     LC +  + +I  ++ +PE+ R ++  G+
Sbjct: 227 LILLDNNNWRWLFGF-LCIVSGLGLIMVILLLPETLRCIVGNGD 269

>YPR156C (TPO3) [5571] chr16 complement(837903..839771) Polyamine
           transport protein, member of the multidrug-resistance
           12-spanner (DHA12) family of the major facilitator
           superfamily (MFS-MDR) [1869 bp, 622 aa]
          Length = 622

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 41/200 (20%), Positives = 82/200 (41%), Gaps = 3/200 (1%)

Query: 102 GNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGII 161
           G     E+KY +      L VS+  IG ++G L    + D+YGRR+     + +YV+   
Sbjct: 201 GGLGTVEKKYHVGMEAAILSVSLMVIGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVI-FN 259

Query: 162 IQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFM 221
           I  A +         R + G+       L    I++  P   RG  ++F+     +G  +
Sbjct: 260 IPCALAPNLGSLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVV 319

Query: 222 GYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAK 281
           G   N      +  +     + + F   +++I+  I  PE+   +I K      ++    
Sbjct: 320 GPLVNGFISVSTGRMDLIFWVNMAFAGVMWIISSAI--PETYAPVILKRKAARLRKETGN 377

Query: 282 SNKLTVEDSGVLAEVELINA 301
              +T +++  ++  E++ A
Sbjct: 378 PKIMTEQEAQGVSMGEMMRA 397

>YIL121W (YIL121W) [2555] chr9 (132241..133869) Member of the
           multidrug-resistance 12-spanner (DHA12) family of the
           major facilitator superfamily (MFS-MDR) [1629 bp, 542
           aa]
          Length = 542

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 100/252 (39%), Gaps = 35/252 (13%)

Query: 26  DFD---SQSRTPSNKLSEDGFA-TKTTSPLENNEIPQKPLSEYI--LVMCLCLMVAFGGF 79
           DF+   ++S    N+ + D  A T+T S     EI   P S +       L    AF GF
Sbjct: 13  DFEDELAESMQSYNRETADKLALTRTESVKPEPEITAPPHSRFSRSFKTVLIAQCAFTGF 72

Query: 80  VFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLT---L 136
                  TI+G +        +    V E+K+   D+   L+     +     GL    +
Sbjct: 73  F-----STIAGAI-------YYPVLSVIERKF---DIDEELVNVTVVVYFVFQGLAPTFM 117

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLIS 196
           G   D  GRR  ++  I++Y  G  I +A +  + Q  + R +   G+  +  ++  ++ 
Sbjct: 118 GGFADSLGRRPVVLVAIVIY-FGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMG 176

Query: 197 ETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTY--SNAVQWKLPL--GLCFLWAIFM 252
           +   +  RG  V +      LG   G     G  +     A+ W L +  G+CFL     
Sbjct: 177 DVTTRAERGGYVGYVAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLAIGSGICFL----- 231

Query: 253 IAGMIFVPESPR 264
            A  + +PE+ R
Sbjct: 232 -ASFLILPETKR 242

>Scas_713.30
          Length = 630

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 63/133 (47%), Gaps = 16/133 (12%)

Query: 94  MTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVI 153
           + D  ++FG +            +TG I + +++  A+  L  GR+  + G +  ++A I
Sbjct: 102 IEDVAKKFGAYS-----------KTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAI 150

Query: 154 LVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCV----S 209
           +++ +G +I    +N       GR+++G+G  GI  L+  + S    +  RG  +    S
Sbjct: 151 IIFEIGSLIS-GVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSS 209

Query: 210 FYQLMITLGIFMG 222
            + +   +G F+G
Sbjct: 210 AFAVASVIGPFLG 222

>YPR198W (SGE1) [5610] chr16 (934028..935659) Crystal violet
           resistance protein, member of the multidrug-resistance
           14-spanner (DHA14) family of the major facilitator
           superfamily (MFS-MDR) [1632 bp, 543 aa]
          Length = 543

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 119 GLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRI 178
           G +V+ + +  A+  L  GRL ++ G +  LM  ++V+ +G +I  A SN       GR+
Sbjct: 46  GWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLIS-ALSNSMATLISGRV 104

Query: 179 VSGLGVGGIAVLSPTLISETAPKHLRGTCVS 209
           V+G G  GI  L+  + +    ++ RG  ++
Sbjct: 105 VAGFGGSGIESLAFVVGTSIVRENHRGIMIT 135

>Kwal_14.728
          Length = 568

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 67/147 (45%), Gaps = 25/147 (17%)

Query: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG 176
           ++G IV+ +++  A+  L  GR+    G R+ ++A I+++  G +I  A +        G
Sbjct: 79  KSGWIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSLIS-ALARSMNMLIAG 137

Query: 177 RIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSF----YQLMITLGIFMGYCTNYGTKTY 232
           R+VSG+G  G+  LS  +  +   +  R   +S     + +   +G F+G         +
Sbjct: 138 RVVSGVGGSGLQTLSLVIGCQLVDEKSRPLVLSLLNCTFAIASIIGPFIG-------GAF 190

Query: 233 SNAVQWK------LPLG-------LCF 246
           +  V W+      LP+G       LCF
Sbjct: 191 TTHVTWRWCFYINLPIGGVAILTFLCF 217

>Scas_712.56
          Length = 620

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 83/202 (41%), Gaps = 3/202 (1%)

Query: 102 GNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGII 161
           G F   E+K+ +S   + L  S+  IG ++G L    + D+YGRR+     + +YV+   
Sbjct: 198 GGFGTVEEKFHVSLEASILSCSLMVIGFSVGPLLWSPVSDLYGRRVAYFFSMGLYVI-FN 256

Query: 162 IQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFM 221
           I  A +         R + G+       L    I++  P   RG  ++F+      G   
Sbjct: 257 IPCALAPNLGCLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIAFFAYSPYCGPVF 316

Query: 222 GYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAK 281
           G   N      +  +     + + F   +++I+  I  PE+   +I K    + ++    
Sbjct: 317 GPLVNGFISVSTGRMDLIFWVNMAFAGVMWIISSAI--PETYAPVILKRRAAKLRKETGN 374

Query: 282 SNKLTVEDSGVLAEVELINAGV 303
              +T +++  +   E++ A V
Sbjct: 375 PKIMTEQEAQGITFNEMMTACV 396

>Sklu_1110.1 YDR119W, Contig c1110 22-1995
          Length = 657

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 5/90 (5%)

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLIS 196
           G++ D++GR+  L+   +++ +G +I   S   W     GR ++G+G GG+  +S    S
Sbjct: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWC-LVAGRFIAGIGGGGLTSMSSITTS 243

Query: 197 ETAPKHLR----GTCVSFYQLMITLGIFMG 222
           +  P   R    G C  F+ L    G  +G
Sbjct: 244 DIVPLRNRALYQGICNFFFGLGTACGGLVG 273

>Kwal_47.18976
          Length = 534

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 60/142 (42%), Gaps = 16/142 (11%)

Query: 131 IGGLTLGRLGDMYGRRLG-LMAVILVYVVGIIIQIASSNKWYQYFIG-RIVSGLGVGGIA 188
           IG +  G LGD YGR++   ++++L+ VV I      S   +  F+G R + G+ +G I 
Sbjct: 121 IGAIIFGYLGDRYGRKVPYCISMVLIVVVQIGTGFVKS---FPAFLGCRALFGIVMGSIF 177

Query: 189 VLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLW 248
            ++     E AP+  +      +Q    LG  +G          S+   W+      F W
Sbjct: 178 GVASATALEDAPQESKSILSGIFQEGYALGYLLGVVFKRAIVDNSSH-GWR-----AFFW 231

Query: 249 -----AIFMIAGMIFVPESPRY 265
                 +  I   + +PES  Y
Sbjct: 232 FSAGPPVLFIVWRLLLPESEAY 253

>Sklu_2289.2 , Contig c2289 5004-6585
          Length = 528

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 75/173 (43%), Gaps = 23/173 (13%)

Query: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG 176
           ++G IVS +++  A+  L  GR   ++G +L L+  IL++  G +I  A SN       G
Sbjct: 67  KSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLIS-AVSNSMNVLIGG 125

Query: 177 RIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSF----YQLMITLGIFMGYCTNYGTKTY 232
           R+V+G+G  GI  L   + S    +  RG  +S     Y +      FMG         +
Sbjct: 126 RVVAGIGGSGIQSLCFVIASTLTTERSRGVAISVLSCAYAVAAVASPFMG-------SAF 178

Query: 233 SNAVQWKLPLGLCFLWAIFM---IAGMIFVPESPRYLIEKGNFEEAKRSIAKS 282
           +  V W+        W  ++   I G+ F      Y   +GN   +  S+ KS
Sbjct: 179 TTHVTWR--------WCFYINLPIGGLAFAVLVLTYKPHEGNSARSIVSVLKS 223

>YMR088C (YMR088C) [4046] chr13 complement(443413..445101) Member of
           the multidrug-resistance 14-spanner (DHA14) family of
           the major facilitator superfamily (MFS-MDR) [1689 bp,
           562 aa]
          Length = 562

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLIS 196
           G+L D+ GR+  L+     + +G ++   + N   ++ I R + G+G GG+  +S   +S
Sbjct: 92  GKLSDITGRKSALLTAQFFFGLGCLLTCFARNV-TEFSIARAICGIGAGGLNAISSIAVS 150

Query: 197 ETAPKHLRGTCVSFYQLMITLGIFMG 222
           +      RG    +  ++   G  +G
Sbjct: 151 DICTARERGVYQGYANIVFGFGQLLG 176

>Scas_676.25
          Length = 634

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 83/202 (41%), Gaps = 3/202 (1%)

Query: 102 GNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGII 161
           G F   E+K+ +S     L  S+  IG ++G L    + D+YGRR+     + +YV+   
Sbjct: 212 GGFGTIEKKFHVSLEAAILSCSLMVIGFSVGPLLWSPVSDLYGRRVAYFFSMGLYVI-FN 270

Query: 162 IQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFM 221
           I  A +         R + G+       L    I++  P   RG  ++F+      G   
Sbjct: 271 IPCAIAPNLGCLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIAFFAYSPYCGPVF 330

Query: 222 GYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAK 281
           G   N      +  +     + + F   +++I+  I  PE+   +I K    + ++    
Sbjct: 331 GPLVNGFISVSTGRMDLIFWVNMAFAGVMWIISSAI--PETYAPVILKRRAAKLRKETGN 388

Query: 282 SNKLTVEDSGVLAEVELINAGV 303
              +T +++  +   E+++A V
Sbjct: 389 PKIMTEQEAQGITFNEMMSACV 410

>KLLA0F17776g complement(1627198..1628859) similar to
           ca|CA1324|IPF6676 Candida albicans polytopic membrane
           protein involved in drug transport (by homology), start
           by similarity
          Length = 553

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 121 IVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNK-WYQYFIGRIV 179
           I + + + C+      G+L D++GR+  L+   L +  G I+  A   K  +   IGR +
Sbjct: 72  IATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCGAPFTKSLWMLCIGRFI 131

Query: 180 SGLGVGGIAVLSPTLISETAPKHLRG 205
           +G+G GG+  LS    S+  P   RG
Sbjct: 132 AGVGGGGLNSLSTITTSDIIPLRQRG 157

>YGR138C (TPO2) [2094] chr7 complement(763765..765609) Polyamine
           transport protein, member of the multidrug-resistance
           12-spanner (DHA12) family of the major facilitator
           superfamily (MFS-MDR) [1845 bp, 614 aa]
          Length = 614

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 40/200 (20%), Positives = 81/200 (40%), Gaps = 3/200 (1%)

Query: 102 GNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGII 161
           G     E+KY +      L  S+  IG ++G L    + D+YGRR+     + +YV+   
Sbjct: 192 GGLGTVEKKYHVGMEAAILSCSLMVIGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVI-FN 250

Query: 162 IQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFM 221
           I  A +         R + G+       L    I++  P   RG  ++F+     +G  +
Sbjct: 251 IPCALAPNLGCLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVV 310

Query: 222 GYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAK 281
           G   N      +  +     + + F   +++I+  I  PE+   +I K      ++    
Sbjct: 311 GPLVNGFISVSTGRMDLIFWVNMAFAGVMWIISSAI--PETYAPVILKRKAARLRKETGN 368

Query: 282 SNKLTVEDSGVLAEVELINA 301
              +T +++  ++  E++ A
Sbjct: 369 PKIMTEQEAQGVSMSEMMRA 388

>KLLA0C19459g 1746987..1747436 some similarities with
           ca|CA3241|IPF7493 Candida albicans putative permease (by
           homology), hypothetical start
          Length = 149

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 60/139 (43%), Gaps = 14/139 (10%)

Query: 28  DSQSRTPSNKLSEDGFATKTTSPLE-----------NNEIPQKPLSEYILVMCLCLMVAF 76
           D Q    S  + +D  A++ T  +            +NE P + +  + L M + L+   
Sbjct: 14  DVQYENDSQSVQDDDQASQITPKIAAEKKKFRWRVVDNESPPE-VYNWTLYMSI-LIFGI 71

Query: 77  GGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTL 136
            G   G+D G +SG V    F+ +FG  D  +    L+++++  I S+  +G   G L  
Sbjct: 72  LGAARGYDEGNVSGSVAQVSFQNQFGLADKTKSASYLANLKSN-ITSMVQLGSIGGTLIA 130

Query: 137 GRLGDMYGRRLGLMAVILV 155
               + +GR   L  V ++
Sbjct: 131 MYTVEKFGRIKALQGVCVL 149

>Kwal_26.7984
          Length = 612

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 113 LSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQ 172
           LSD+    +V    +  A G +       ++G+R+  +  I+V+  G I   + S+ +  
Sbjct: 113 LSDI--SYLVGGMMLALAFGSIIASPSAVLFGKRILYLIGIIVFFFGSI-GCSVSHSYES 169

Query: 173 YFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMI 215
               RIVSGLGV  I  L    ++E    H R   +  Y L++
Sbjct: 170 LLASRIVSGLGVATIESLPSATVAEIYFAHERAYRLGVYTLLL 212

>AGR195W [4506] [Homologous to ScYBR180W (DTR1) - SH]
           complement(1120603..1122462) [1860 bp, 619 aa]
          Length = 619

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 72/166 (43%), Gaps = 5/166 (3%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRR-LGLMAVILVYVVGIIIQIAS 166
           EQ + +S       VS+F    ++G L      D  GR+ L ++++ L  +V +++ +  
Sbjct: 187 EQDFAVSTTTINGTVSVFMAVFSVGPLLWALHADFGGRKLLYVLSMGLNVIVNVLLAVMP 246

Query: 167 SNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTN 226
           + +    F+ R+V          L    +S+  P   RG  ++++ L    G  +     
Sbjct: 247 A-RIGALFVLRVVQAFASSSALSLGAGTVSDITPPKNRGKAIAYFMLGPNAGPILAPIIA 305

Query: 227 YGTKTYSNAVQWKLPLGLCFLWA-IFMIAGMIFVPESPRYLIEKGN 271
            G   + N  +W+   G   + A I  +   +F+PE+ R ++  G+
Sbjct: 306 -GLILFDND-RWRWLFGFTSIMAGIGFLLVCVFLPETLRCIVGNGD 349

>YEL065W (SIT1) [1363] chr5 (27657..29543) Ferrioxamine B permease,
           member of the yeast-specific multidrug-resistance
           (MFS-MDR) family of the major facilitator superfamily
           (MFS) [1887 bp, 628 aa]
          Length = 628

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 76/202 (37%), Gaps = 38/202 (18%)

Query: 102 GNFDVGEQKYVLSDVRTGLIVSIFN----IGCAIGGLTLGRLGDMYGRRLGLMAVILVYV 157
           GN     Q Y  S      ++S  N    +  A+G +   RL D++GR   ++  I+ Y 
Sbjct: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYS 147

Query: 158 VGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITL 217
           +G II+  + N   ++ +G     LG+ GI ++   + S+ +  + R   +    L   +
Sbjct: 148 MGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFII 206

Query: 218 GIFMGYCTNYGTKTYSNAVQWK--------------LPLGLCFLWAIFMIAGMIFVPESP 263
             ++      G  T +    WK              +PLG+C L                
Sbjct: 207 NTWIS-----GNVTSAIDANWKWGIGMWAFILPLACIPLGICML--------------HM 247

Query: 264 RYLIEKGNFEEAKRSIAKSNKL 285
           RYL  K   +  K      NKL
Sbjct: 248 RYLARKHAKDRLKPEFEALNKL 269

>Kwal_23.4853
          Length = 603

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 130 AIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAV 189
           A G +   R  D++GR   L   +L+YVVG I++   SN   ++  G  +  LG  GI +
Sbjct: 96  AAGLIAYARASDIFGRMTMLAIAVLLYVVGTIVE-CQSNTVSKFATGASIFQLGKAGIVL 154

Query: 190 L 190
           L
Sbjct: 155 L 155

>Sklu_2348.2 YIL121W, Contig c2348 2640-4442 reverse complement
          Length = 600

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 72/177 (40%), Gaps = 8/177 (4%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           E+ + +S     + V ++ I   +  + +G L D  GRR  ++  I +Y V   I +AS+
Sbjct: 107 EEDFNISQEMVNITVVVYFILQGLAPMLMGGLADKVGRRPIVLCSIALYAVA-CIGLASA 165

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNY 227
             + +    R +   G+  +  ++  +I +   K  RG  +        +G   G     
Sbjct: 166 QNYGEVLFLRCLQSAGISPVVAVNNGIIGDITTKAERGGYLGLMAGTQVIGSAFGALIGA 225

Query: 228 GTKTY--SNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKS 282
           G        A+ W L +G  F  A+        +PE+ R ++  G+    K  + KS
Sbjct: 226 GITARWGWRAIFWFLAIGSGFSLAV----ASFLLPETKRTVVGNGSI-VPKNPVCKS 277

>YKR105C (YKR105C) [3356] chr11 complement(658352..660100) Member of
           the multidrug-resistance 14-spanner (DHA14) family of
           the major facilitator superfamily (MFS-MDR) [1749 bp,
           582 aa]
          Length = 582

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 66/138 (47%), Gaps = 19/138 (13%)

Query: 53  NNEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYV 112
           +N+ P   LS Y+ +  L L++    F+   D   +   +++     +FGN+        
Sbjct: 27  SNDSPMG-LSLYLCLASLTLVL----FITALDILIVGTIIDVV--AEQFGNYS------- 72

Query: 113 LSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQ 172
               +TG +V+ +++  AI  L  GR   + G +  L+  IL++  G +I   +S+    
Sbjct: 73  ----KTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLIAALASSMNML 128

Query: 173 YFIGRIVSGLGVGGIAVL 190
            F GR+V+G+G  G+  L
Sbjct: 129 IF-GRVVAGVGGSGLQTL 145

>KLLA0F18106g 1657556..1659325 similar to sgd|S0003951 Saccharomyces
           cerevisiae YLL028w TPO1 polyamine transport protein,
           hypothetical start
          Length = 589

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 75/181 (41%), Gaps = 43/181 (23%)

Query: 57  PQKPLSEY------ILVMCL-----CLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFD 105
           P  PL  +       LV+C+     C+ +  G  +F     TIS                
Sbjct: 132 PNDPLHPFNWPLKKKLVICIMLGLDCIAITMGSSIFASAVTTIS---------------- 175

Query: 106 VGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIII--- 162
              + Y +++V + L ++++ +G A   +    L ++YGR+     V+L+   G  +   
Sbjct: 176 ---EIYEVANVVSILGITLYVLGFAASPVIYAPLSELYGRQ----GVLLIASFGFALFQF 228

Query: 163 QIASSNKWYQYFIGRIVSG-LGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFM 221
            +A++       I R   G +G   +AV+ P   S+      RGT V+    M  LG+F+
Sbjct: 229 AVATAENLQTILICRFFGGFIGAAPLAVV-PASFSDMFDNTQRGTAVT----MFALGVFV 283

Query: 222 G 222
           G
Sbjct: 284 G 284

>YHR048W (YHR048W) [2336] chr8 (204599..206143) Member of the
           multidrug-resistance 12-spanner (DHA12) family of the
           major facilitator superfamily (MFS-MDR) [1545 bp, 514
           aa]
          Length = 514

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 86/206 (41%), Gaps = 30/206 (14%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           E  ++  +V T L ++++  G  IG L L  L ++YGRR+  +  + + ++   + I S 
Sbjct: 102 EHFHISHEVST-LGITLYVFGLGIGPLFLSPLSELYGRRITFLYALTLSIIWQCLTIWSK 160

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNY 227
                 F GR +SG        ++   I++   K   G  ++ Y     LG  +G     
Sbjct: 161 TITGVMF-GRFLSGFFGSAFLSVAGGAIADIFDKDQIGIPMAIYTTSAFLGPSLGPII-- 217

Query: 228 GTKTYSNAVQWK-----LPLGLCFLWAIFMIAGMIFVPES--PRYLIEKGNFEEAKRSIA 280
           G   Y  + +W      +  G C +  IF I      PE+  P  LI K     AKR   
Sbjct: 218 GGALYHQSYKWTFITLLITSGCCLVMIIFTI------PETYKPMLLIRK-----AKRLRK 266

Query: 281 KSN--------KLTVEDSGVLAEVEL 298
           + N        ++T E + +L+ + L
Sbjct: 267 EKNDQRYYAVLEVTREQTSLLSAIFL 292

>YCR023C (YCR023C) [557] chr3 complement(158533..160368) Member of
           the multidrug-resistance 12-spanner (DHA12) family of
           the major facilitator superfamily (MFS-MDR) [1836 bp,
           611 aa]
          Length = 611

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 50/107 (46%), Gaps = 5/107 (4%)

Query: 118 TGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGR 177
           +G + S F +   I     GR  + +GR++ L   ++   V ++I +  S  +YQ  + R
Sbjct: 61  SGYLSSSFALCQVISAYHWGRFSEKHGRKITLTCGLIGTSVSLLI-LGFSRNFYQALVAR 119

Query: 178 IVSGLGVGGIAVLSPTLISE--TAPKHLRGTCVSFYQLMITLGIFMG 222
            + GL  G + V+  T+I E  T  KH +    S   L+   G  +G
Sbjct: 120 SLMGLLNGNVGVIR-TIIGEIATERKH-QALAFSTMPLLFQFGAVVG 164

>AGL069C [4242] [Homologous to ScYNR055C (HOL1) - NSH]
           (578235..580019) [1785 bp, 594 aa]
          Length = 594

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG 176
           +   +V    +  AIG +       ++G+R+  +  IL+++ G  I  A SN +    I 
Sbjct: 116 QVSFLVGPMMLALAIGSVVASPTAVLFGKRMVYLMGILIFLGG-SIGCALSNSFASLLIF 174

Query: 177 RIVSGLGVGGIAVLSPTLISETAPKHLRG 205
           R+VSG G+  +  L    I+E    H R 
Sbjct: 175 RMVSGFGLSTVESLPSATIAEIYFAHERA 203

>CAGL0I09702g complement(925113..926678) similar to tr|Q08777
           Saccharomyces cerevisiae YOR306c, hypothetical start
          Length = 521

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 18/111 (16%)

Query: 109 QKYVLSDVRT---GLIVSIF---NIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIII 162
           QKY LSDV+T   G I S+F   N  C I     G   D  G R  ++   +++V G+I 
Sbjct: 134 QKYQLSDVKTSTIGWIFSLFLFINYSCCIFS---GTYFDRNGYRDPVILGTVLHVAGLIA 190

Query: 163 QIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHL----RGTCVS 209
               +  W+      IV G G G   +L   L++   P H     RGT V+
Sbjct: 191 TANCTKVWHFILAFSIVCGFGNG---ILIAPLVA--VPAHYFCRRRGTAVA 236

>KLLA0C00220g 13632..15506 similar to sp|P38724 Saccharomyces
           cerevisiae YHL047c TAF1 siderophore transporter for
           triacetylfusarinine C, start by similarity
          Length = 624

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 122 VSIFNIGC-AIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVS 180
           +SI N+   A+  L    L D++GR   ++  IL YVVG +IQ + +    +Y  G +  
Sbjct: 114 ISIINMMISAVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVIQ-SQAYDIQRYAAGSVFY 172

Query: 181 GLGVGGIAVLSPTLISETAPKHLR 204
            +GV G+ +     +++ +    R
Sbjct: 173 NIGVVGVMLQVSLFLADNSSLKWR 196

>Kwal_14.1585
          Length = 570

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 137 GRLGDMYGRRLGLMAVILVYVVGIII-QIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLI 195
           G+  D+ GR+  L+   +V+++G+++  +A + K  +  I R + G+G  G+  +   ++
Sbjct: 107 GKTSDLLGRKKCLLFAEVVFIIGLVLCGMARTVK--ELAIARAICGIGGSGLGAMCNIIL 164

Query: 196 SETAPKHLR 204
           S+ AP   R
Sbjct: 165 SDLAPLSQR 173

>Sklu_2394.9 YHR048W, Contig c2394 13885-15486
          Length = 533

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 93/230 (40%), Gaps = 26/230 (11%)

Query: 109 QKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSN 168
           + + +S   + L +S++  G   G L L  L +MYGR++  +  + + +V  ++ + S  
Sbjct: 119 EHFHISHEVSVLGISLYIFGLGFGPLFLSPLSEMYGRKITFVMSLSMSIVWQVLTVWSPT 178

Query: 169 KWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTN-- 226
               +F GR ++G        ++  +IS+   +   G  ++ Y     LG  +G   +  
Sbjct: 179 IVGMFF-GRFLAGFFGSSFLSVAGGVISDIFTRQEIGIPMTVYTTSPFLGPALGPVVSGA 237

Query: 227 -YGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPES--PRYLIEKGNFEEAKRSIAKSN 283
            YG       +   +  G+C +   F       VPE+  P  LI K          AK  
Sbjct: 238 LYGVSYKWTFIALLIASGVCLVLIAFT------VPETYQPVLLIGK----------AKRM 281

Query: 284 KLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCV 333
           +    D G  A +E+    V  E    +A       P G +L+  +MG +
Sbjct: 282 RQETGDHGYFAPLEI----VRRETNITSAVLLSTRRPFGLLLKDPMMGVL 327

>KLLA0A10439g complement(913342..915246) similar to sp|P38731
           Saccharomyces cerevisiae YHL040c ARN1 ferrichrome-type
           siderophore transporter, start by similarity
          Length = 634

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 130 AIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAV 189
           A   +   RL D+YGR    +  I+ YVVG II+ + ++   +Y  G +   +G  G+ +
Sbjct: 130 AASQIVYARLSDVYGRFTLFVTAIVFYVVGTIIE-SQAHDVQRYAAGAVFYNIGYVGVIL 188

Query: 190 LSPTLISE 197
           +   ++S+
Sbjct: 189 IVLLILSD 196

>KLLA0E14520g complement(1279788..1280543) similar to sp|P38724
           Saccharomyces cerevisiae YHL047c TAF1 siderophore
           transporter for triacetylfusarinine C, start by
           similarity
          Length = 251

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 130 AIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAV 189
           A+  L    L D++GR   ++  I+ YVVG +IQ + +    +Y  G +   +G+ G+ +
Sbjct: 121 AVAQLFFAGLSDVFGRLSLMIVAIVFYVVGTVIQ-SQAYDIQKYCAGSVFYNVGLVGVML 179

Query: 190 LSPTLISETAPKHLR 204
                +S+ +    R
Sbjct: 180 QVTLFLSDNSSLRWR 194

>YJL163C (YJL163C) [2758] chr10 complement(111661..113328) Protein
           that contains ten potential transmembrane segments [1668
           bp, 555 aa]
          Length = 555

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 14/84 (16%)

Query: 169 KWYQYFIGRIVSGLGVGG---IAVLSPTLIS--ETAPKHLRGT-------CVSFYQLMIT 216
           KW+   +G  +S LG+G    + V+SPTL+   +   +HL  +       C+ F  ++IT
Sbjct: 383 KWHAVELGYFISILGIGRGVVLLVVSPTLLYTLKRIYQHLNHSIDKIDIFCIQFSMIVIT 442

Query: 217 LGIFMGYCTNYGTKTYSNAVQWKL 240
           L +F+     +G KT ++ + + L
Sbjct: 443 LSLFV--MIRFGEKTPTSMIIFAL 464

>Kwal_23.2794
          Length = 619

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 10/75 (13%)

Query: 111 YVLSDVRTGLIVSIFNIGC----AIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIAS 166
           Y + D     ++S  N+      A+G +    L D++GR    +  I+ YVVG IIQ  +
Sbjct: 96  YAMDDYAEHSLLSTVNVVSLMISAVGQIFFAGLSDVFGRLSLFVVAIIFYVVGTIIQSQA 155

Query: 167 SNKWYQYFIGRIVSG 181
                 Y +GR V+G
Sbjct: 156 ------YDVGRYVAG 164

>Sklu_2083.1 YKL217W, Contig c2083 424-2220
          Length = 598

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 24/38 (63%)

Query: 113 LSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLM 150
            S+    +I+++ N+G   GG+  G++ ++ GRRL L+
Sbjct: 385 FSEDAITVIITVVNLGAICGGMIFGQIMEVTGRRLALL 422

>Kwal_14.722
          Length = 611

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 55/105 (52%), Gaps = 10/105 (9%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           E+  +LS ++  +I S+  +G  I   +  RL D++GR    +   ++YVVG IIQ + +
Sbjct: 96  EKHSLLSTIQ--VINSVVGVGAQI---SFARLSDVFGRLQMFVVGTILYVVGTIIQ-SQA 149

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQ 212
           +    Y +G I    G  G+++L   ++S+ +P   R     FYQ
Sbjct: 150 HDVKVYAVGAIFYNTGFVGVSLLLILVLSDMSPLRWR----LFYQ 190

>CAGL0J09944g 974150..975928 similar to sp|P53943 Saccharomyces
           cerevisiae YNL065w, hypothetical start
          Length = 592

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 75/182 (41%), Gaps = 14/182 (7%)

Query: 108 EQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASS 167
           E+++ + +    + V ++ +   +     G L D +GRR  L+  +L+YVV   I +A +
Sbjct: 127 EKQFDIDENMVNITVVVYLLFQGLAPTCSGGLADKFGRRPVLLIGMLIYVVA-SIGLACA 185

Query: 168 NKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNY 227
             +      R V  +G+     +S  ++ +   K  RGT V      + LG   G     
Sbjct: 186 PSYGVIVFLRCVQSIGISPSIAISSGVVGDFTVKSERGTFVGATSGFVLLGQAFGSLIGA 245

Query: 228 GTKTYSN--AVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKL 285
                 +  A+ W L +G    +AI        +PE+ R ++  GN      SI   N L
Sbjct: 246 ALAAAWDWRAIFWFLTIGCGASFAI----CFALLPETKRSIV--GNL-----SIRPKNPL 294

Query: 286 TV 287
            +
Sbjct: 295 NI 296

>Kwal_56.22298
          Length = 610

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 136 LGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLI 195
             RL D++GR    +  I  YVVG IIQ + +    +Y +G +   +G  GI ++   ++
Sbjct: 113 FARLSDVFGRLSLFVTAIAFYVVGTIIQ-SQAYDIQRYAVGSVFWSIGYVGILLMLILIV 171

Query: 196 SETAPKHLR 204
           S+ +    R
Sbjct: 172 SDFSSLRWR 180

>YER051W (YER051W) [1479] chr5 (254655..256133) Protein containing a
           PHD-finger, which may be involved in chromatin-mediated
           transcriptional regulation, and a Jumonji (jmjC) domain,
           has low similarity to uncharacterized C. albicans
           Orf6.8281p [1479 bp, 492 aa]
          Length = 492

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 83  WDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDM 142
           W  G  S  +N  DF  +F N DV  +  ++  + +G+ V   N+G   G LT+  + +M
Sbjct: 141 WKNG--SNIINAADFAEKFDNIDVPYK--IIDPLNSGVYVP--NVGTDNGCLTVNYITEM 194

Query: 143 YGR 145
            G 
Sbjct: 195 IGE 197

>Scas_663.28*
          Length = 620

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 65/169 (38%), Gaps = 27/169 (15%)

Query: 1   MSSSATP----MNDRSNSNTEL--AAVSSPTDFDSQSRTPSNKLSEDGFATKTTSPLENN 54
           MSS ++P     N  S+   ++    + S  D D+QS  P        FA K +  ++  
Sbjct: 1   MSSQSSPEVHEKNHLSSKGNDIFTKEIESQND-DTQSSVPD-------FAVKRSLVIKKT 52

Query: 55  EIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLS 114
           EI      ++   + L       G+ +G +        N+      +      E   +LS
Sbjct: 53  EIMSAVYDKWYHHVILLFSAFVCGYAYGLE-------CNIRYIYTGYATSSYAEHS-LLS 104

Query: 115 DVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQ 163
            V       I  +  A   +   RL D +GR    +  I++YVVG IIQ
Sbjct: 105 TVNV-----INAVVSAASQIIYSRLSDFFGRLTLFIIAIVLYVVGTIIQ 148

>Kwal_23.5241
          Length = 591

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 130 AIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAV 189
           A G L   R  D++GR   ++  IL YVVG II  + +    +Y  G  +  LG  GI +
Sbjct: 93  AAGQLCFARAADIFGRISIIIVSILFYVVGTIID-SQATTVSKYAAGACIYQLGYTGIIL 151

Query: 190 L 190
           +
Sbjct: 152 I 152

>Sklu_2183.3 YCR098C, Contig c2183 6694-8208
          Length = 504

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 62/289 (21%), Positives = 106/289 (36%), Gaps = 62/289 (21%)

Query: 127 IGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNK-----WYQYFIGRIVSG 181
           +G  +G + +G   D  GR+  ++   L  V+G I+  AS        ++   + R V+G
Sbjct: 80  VGTILGQVFIGAACDYMGRKWSILVATLFLVIGTILCAASHGSTVPGMFWMLTVMRGVTG 139

Query: 182 LGVGGIAVLSPTLISETAPKHLR----GTCVSFYQLMITLG------IFMGYCTNYGTKT 231
            G+G     S    +E A +H      G  V    L ++LG      +F+   +  GTK 
Sbjct: 140 FGIGAEYPCSSVSANEAANEHSEKRRGGIMVLVTNLPLSLGGPFASIVFLVVYSICGTKH 199

Query: 232 YSNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSG 291
                       L  LW I M A   F P S  Y   K    E  +  A  N++      
Sbjct: 200 ------------LEALWRI-MFALGCFWPLSVFYFRWKMATNELYKKGAIKNRVPYW--- 243

Query: 292 VLAEVELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGT 351
                           L     W           +R++  C +  +          + GT
Sbjct: 244 ----------------LVVKYCW-----------KRLLGTCGVWFIYDFVVFPNSIFSGT 276

Query: 352 TIFDAVG----MKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWG 396
            I   +     +K+  + +++LG++     FVG +  +R GR+  L++G
Sbjct: 277 IISSVINNTTDLKEICEWNLLLGIIAIPGCFVGAWLCDRIGRKYTLMFG 325

>YHL047C (ARN2) [2242] chr8 complement(8298..10211)
           Triacetylfusarinine C transporter, member of the
           yeast-specific putative multidrug-resistance family of
           the major facilitator superfamily (MFS) [1914 bp, 637
           aa]
          Length = 637

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 130 AIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAV 189
           A+  +  G L D++GR    +  I++Y+VG IIQ + +    +Y  G +   +G+ G+ +
Sbjct: 119 AVSQVIFGGLSDIFGRLTLFLVSIVLYIVGTIIQ-SQAYDVQRYAAGAVFYYVGLVGVML 177

Query: 190 LSPTLISETAPKHLR 204
               ++S+ +    R
Sbjct: 178 QVVLMLSDNSSLKWR 192

>YML116W (ATR1) [3855] chr13 (38196..39824) Membrane transporter
           conferring aminotriazole and 4-nitroquinoline-1-oxide
           (4NQO) resistance, member of the multidrug-resistance
           14-spanner (DHA14) family of the major facilitator
           superfamily (MFS-MDR) [1629 bp, 542 aa]
          Length = 542

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 11/112 (9%)

Query: 134 LTLGRLGDMYG-RRLGLMAVILVYVVGIIIQIASSNKWYQYF-IGRIVSGLGVGGIAVLS 191
           L  GRLGD+YG +++ L+  +LV +  +I  I   +    +F I R   GL   GIA + 
Sbjct: 123 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGL---GIAFVL 179

Query: 192 PTLISETAPKHLRGT-----CVSFYQLMITLGIFMGYCTNYGTKTYSNAVQW 238
           P ++      ++ GT      +SF   M  +G  +G C   G     +  QW
Sbjct: 180 PNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTEDPKQW 230

>Scas_680.7
          Length = 364

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 5/64 (7%)

Query: 227 YGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFVPESP-----RYLIEKGNFEEAKRSIAK 281
           YG  T+S+  Q+K+PL     W  F  A  +  P S        +IEKG +     SI K
Sbjct: 280 YGKPTFSSVFQYKIPLRTYNPWRKFNFAFFLTEPRSDFMELGSRMIEKGTYVPPIDSIYK 339

Query: 282 SNKL 285
            ++ 
Sbjct: 340 FDQF 343

>KLLA0F03311g 311639..313267 similar to sp|P53943 Saccharomyces
           cerevisiae YNL065w, start by similarity
          Length = 542

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 62/160 (38%), Gaps = 17/160 (10%)

Query: 97  FKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVY 156
            K     FDV E+          + V ++ +   I     G L D+YGRR  ++  +L+Y
Sbjct: 106 LKELEAEFDVNEE-------LINITVVVYLLFQGIAPTISGGLADVYGRRPIILLGMLIY 158

Query: 157 VVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMIT 216
           V+   I +A S  +      R +   G+  I  ++  +  +   K  RGT V        
Sbjct: 159 VIA-SIGLACSKSYGAVVFLRCLQSAGISPIIAINSGVAGDFTVKSERGTFVGAVSGFTL 217

Query: 217 LGIFMGYCTNYG-TKTYS-NAVQWKLPLG-------LCFL 247
           +G   G       T  Y   A+ W L +G       LCFL
Sbjct: 218 MGQAFGSLIGAALTAAYDWRAIFWFLVIGCGTCMIILCFL 257

>YKR106W (YKR106W) [3357] chr11 (661078..662925) Member of the
           yeast-specific putative multidrug-resistance family of
           the major facilitator superfamily (MFS) [1848 bp, 615
           aa]
          Length = 615

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 8/93 (8%)

Query: 122 VSIFNIGCAIGG-LTLGRLGDMYGR-RLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIV 179
           V + N   ++G  +   RL D +GR RL L+A I  Y++G IIQ + + +   Y  G + 
Sbjct: 100 VQVINAVVSVGSQVVYSRLSDHFGRLRLFLVATIF-YIMGTIIQ-SQATRLTMYAAGSVF 157

Query: 180 SGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQ 212
              G  G  +L   ++S+ +    R     FYQ
Sbjct: 158 YNCGYVGTNLLLTLILSDFSSLKWR----MFYQ 186

>ADR336C [2077] [Homologous to ScYNR055C (HOL1) - NSH]
           (1299396..1301102) [1707 bp, 568 aa]
          Length = 568

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 9/95 (9%)

Query: 132 GGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNK----WYQYFIGRIVSGLGVGGI 187
           G L    L  +YGR++  M  I   ++G I   ++SN     W Q  +G  VS       
Sbjct: 117 GTLVFAPLSSLYGRKITYMICIGFGLLGAIWFASTSNTNDAIWSQALVG--VSEACAEAQ 174

Query: 188 AVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMG 222
             LS   +S+   +H  G+ ++ Y L  ++G F+G
Sbjct: 175 VQLS---LSDIFFQHQLGSVLTVYILCTSIGTFLG 206

>YGR224W (AZR1) [2173] chr7 (942807..944648) Protein involved in
           resistance to azoles and acetic acid, member of the
           major facilitator superfamily (MFS) multidrug-resistance
           (MFS-MDR) protein family [1842 bp, 613 aa]
          Length = 613

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 58/124 (46%), Gaps = 18/124 (14%)

Query: 130 AIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAV 189
           A+  L  GR+    G +  ++  I+++ +G +I  A +N       GR+++G+G  GI  
Sbjct: 116 ALLALIWGRIATPIGFKETMLFAIVIFEIGSLIS-ALANSMSMLIGGRVIAGVGGCGIQS 174

Query: 190 LSPTLISETAPKHLRGTCVSF----YQLMITLGIFMGYCTNYGTKTYSNAVQWK------ 239
           LS  + S    +  RG  ++     + +   +G F+G         ++++V W+      
Sbjct: 175 LSFVIGSTLVEESQRGILIAVLSCSFAIASVVGPFLG-------GVFTSSVTWRWCFYVN 227

Query: 240 LPLG 243
           LP+G
Sbjct: 228 LPIG 231

>YHL040C (ARN1) [2247] chr8 complement(19085..20968) Protein
           involved in the transport of ferrichromes, member of the
           yeast-specific putative multidrug-resistance family of
           the major facilitator superfamily (MFS) [1884 bp, 627
           aa]
          Length = 627

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 130 AIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQ 163
           A   +   RL D++GR    ++ +++YVVG IIQ
Sbjct: 124 AASQIIYARLSDVFGRLYLFISAVILYVVGTIIQ 157

>YCL073C (YCL073C) [479] chr3 complement(6479..8326) Member of the
           yeast-specific multidrug-resistance (MFS-MDR) family of
           the major facilitator superfamily (MFS) [1848 bp, 615
           aa]
          Length = 615

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 8/93 (8%)

Query: 122 VSIFNIGCAIGG-LTLGRLGDMYGR-RLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIV 179
           V + N   ++G  +   RL D +GR RL L+A I  Y++G IIQ + + +   Y  G + 
Sbjct: 100 VQVINAVVSVGSQVVYSRLSDHFGRLRLFLVATIF-YIMGTIIQ-SQATRLTMYAAGSVF 157

Query: 180 SGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQ 212
              G  G  +L   ++S+ +    R     FYQ
Sbjct: 158 YNCGYVGTNLLLTLILSDFSSLKWR----MFYQ 186

>CAGL0L02519g complement(295558..297147) similar to tr|Q08902
           Saccharomyces cerevisiae YOR378w, start by similarity
          Length = 529

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 89/203 (43%), Gaps = 14/203 (6%)

Query: 108 EQKYVLSDVRTGLI---VSIFNIGCAIGGLTLGRLGDMYG-RRLGLMAVILVYVVGIIIQ 163
            ++Y +   + GL+    + + +G A+  L  G+LGD+ G +R+ +   I + +  +I  
Sbjct: 67  RERYRIEPAKGGLVGWANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITG 126

Query: 164 IASSNKWYQ--YFIGRIVSGLGVGGIAVLSPTLISET--APKHLRGTCVSFYQLMITLGI 219
            +  ++  Q  Y+  R + G+G G I   S  ++  T   P   +    S + +M + G 
Sbjct: 127 FSYYDRGNQAFYYTARALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGF 186

Query: 220 FMGYCTNYGTKTYSNAVQWKLPL-GLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRS 278
            +G  T + +  ++   +W      L  +  ++ +  ++F+P  P  ++ K N +   + 
Sbjct: 187 VIG--TTF-SSLFAQLTKWAWNYWALACVCVLYTVGAILFIP--PDNIVHKPNSKPLYKR 241

Query: 279 IAKSNKLTVEDSGVLAEVELINA 301
                 +T     VL +V    A
Sbjct: 242 FDYLGAITGVSGLVLFDVAFTQA 264

>KLLA0E09856g complement(874102..875994) similar to sp|P36172
           Saccharomyces cerevisiae YKR105c, hypothetical start
          Length = 630

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/110 (20%), Positives = 56/110 (50%), Gaps = 5/110 (4%)

Query: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG 176
           ++G +++ +++  ++  L  GR   + G +  ++  I ++ VG I+  A++       +G
Sbjct: 111 KSGWLITGYSLPNSLLSLIWGRATSLLGFQSSMLISIFIFEVGSIVS-ATATSMNNLVVG 169

Query: 177 RIVSGLGVGGIAVLS----PTLISETAPKHLRGTCVSFYQLMITLGIFMG 222
           R+V+G+G  G+  +S     +L+ E     +    +S + +   +G F+G
Sbjct: 170 RVVAGIGGSGLQTVSMIIGCSLVEERNRTIVIAVIMSAFAVSSLIGPFIG 219

>KLLA0A01694g complement(149587..151293) similar to ca|CA1136|CaIFN2
           Candida albicans glycerophosphoinositol transporter (by
           homology), start by similarity
          Length = 568

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 121 IVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKW 170
           + SI  +G  +G L+ G + D Y RRL   A+++  ++ I+  I ++  W
Sbjct: 137 VSSIAFVGIVLGQLSFGYIADYYSRRL---AMLMGNIILIVFSILAAGAW 183

>KLLA0C10692g complement(916718..918280) weakly similar to
          sp|P21147 Saccharomyces cerevisiae YGL055w OLE1
          stearoyl-CoA desaturase singleton, hypothetical start
          Length = 520

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%)

Query: 26 DFDSQSRTPSNKLSEDGFATKTTSPLENNEIP 57
          +FD      S  L E G AT+   PLENN IP
Sbjct: 12 EFDFTQLLQSQGLDEPGVATRREIPLENNIIP 43

>CAGL0I09086g complement(878737..880593) similar to sp|P53918
           Saccharomyces cerevisiae YNL125c ESBP6, hypothetical
           start
          Length = 618

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 6/90 (6%)

Query: 113 LSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGR---RLGLMAVILVYVVGIIIQIASSNK 169
           LS      + ++ N   AIG   +G  GD +GR    + L  ++ +Y+    I    S+ 
Sbjct: 394 LSAHDASTLTAVLNGSQAIGRPLMGLAGDRFGRTNVTISLTTLLAIYLFAFWI---PSHT 450

Query: 170 WYQYFIGRIVSGLGVGGIAVLSPTLISETA 199
           + Q     I++G  VG   V+S  LI++ A
Sbjct: 451 FVQLLFFSIMTGSCVGVANVMSTVLIADMA 480

>Sklu_2143.1 YHL047C, Contig c2143 1127-2989
          Length = 620

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 46/98 (46%), Gaps = 5/98 (5%)

Query: 111 YVLSDVRTGLIVSIFNIGC----AIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIAS 166
           Y ++D +T  ++S  ++      A+  +    L D++GR    +  I  YVVG IIQ + 
Sbjct: 98  YAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSDVFGRLSIFIVAIAFYVVGTIIQ-SQ 156

Query: 167 SNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLR 204
           +    +Y  G I   +G+ G       ++S+++    R
Sbjct: 157 AYDVQRYAAGSIFYNIGLVGAMFQVTLMLSDSSSLKWR 194

>AEL057C [2449] [Homologous to ScYCR023C - SH] (528384..530057)
           [1674 bp, 557 aa]
          Length = 557

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 57/122 (46%), Gaps = 6/122 (4%)

Query: 103 NFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIII 162
           +FDV   +  ++   +G + S+F +   +  +  G   + YGR+  L+   L     +++
Sbjct: 49  DFDVSSNESQIA-AYSGWLGSVFALCQVVSAMNWGHFAERYGRKWALILGQLGTCCSLLL 107

Query: 163 QIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSF--YQLMITLGIF 220
            +  +  +YQ  + R + GL  G   V+  T++ E A +  R   ++F   QL+   G  
Sbjct: 108 -LGFAGNYYQALLARSLMGLLNGNAGVVR-TVVGELASQE-RHQALAFSTMQLLWQFGAV 164

Query: 221 MG 222
           +G
Sbjct: 165 LG 166

>Kwal_33.14268
          Length = 569

 Score = 29.3 bits (64), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 238 WKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVE 297
           W++ +GL  +  +F +   + +PESPRY ++  N     ++ A  +K +  + G  AE E
Sbjct: 241 WRILVGLGCVPGVFALYFRLTIPESPRYTLDVEN--RVNKAAADVSKFSSGEHGN-AEAE 297

Query: 298 LI 299
            I
Sbjct: 298 EI 299

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,006,955
Number of extensions: 692248
Number of successful extensions: 2796
Number of sequences better than 10.0: 268
Number of HSP's gapped: 2451
Number of HSP's successfully gapped: 283
Length of query: 562
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 455
Effective length of database: 12,891,983
Effective search space: 5865852265
Effective search space used: 5865852265
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)