Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.85243342721870.0
Kwal_23.47114163847004e-88
Kwal_23.3840784107750.35
Scas_710.0d27165645.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.852
         (427 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.852                                                           847   0.0  
Kwal_23.4711                                                          274   4e-88
Kwal_23.3840                                                           33   0.35 
Scas_710.0d                                                            29   5.6  

>Kwal_14.852
          Length = 433

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/427 (96%), Positives = 413/427 (96%)

Query: 1   MSGDAEERNRPLDNAIPCTAENLDIPPSPSPQENPAEINPDVLGAQSGSLRHTRHLAGTE 60
           MSGDAEERNRPLDNAIPCTAENLDIPPSPSPQENPAEINPDVLGAQSGSLRHTRHLAGTE
Sbjct: 1   MSGDAEERNRPLDNAIPCTAENLDIPPSPSPQENPAEINPDVLGAQSGSLRHTRHLAGTE 60

Query: 61  PQIAMEQNELFLEYFHSTIITDEFSNIRDPKRANMKMAKAIRELIKNKKYKSLEDGKQYK 120
           PQIAMEQNELFLEYFHSTIITDEFSNIRDPKRANMKMAKAIRELIKNKKYKSLEDGKQYK
Sbjct: 61  PQIAMEQNELFLEYFHSTIITDEFSNIRDPKRANMKMAKAIRELIKNKKYKSLEDGKQYK 120

Query: 121 FKWDNGSTFYLLKYCYEIGPFLGYESLKSKSFEKLEQSSLMSLKWSCVWFNLLMSIEFEN 180
           FKWDNGSTFYLLKYCYEIGPFLGYESLKSKSFEKLEQSSLMSLKWSCVWFNLLMSIEFEN
Sbjct: 121 FKWDNGSTFYLLKYCYEIGPFLGYESLKSKSFEKLEQSSLMSLKWSCVWFNLLMSIEFEN 180

Query: 181 YVIPTEGQLKSRFKYLLECAHPKTFTVTTGDERNPFEFTGNDKVDNILESLARLKNDAEV 240
           YVIPTEGQLKSRFKYLLECAHPKTFTVTTGDERNPFEFTGNDKVDNILESLARLKNDAEV
Sbjct: 181 YVIPTEGQLKSRFKYLLECAHPKTFTVTTGDERNPFEFTGNDKVDNILESLARLKNDAEV 240

Query: 241 RRSEIQKLEVERQRNKRNIGQAICNNSIPYVVENXXXXXXXXXXXXXXDVNRPNRRTIKR 300
           RRSEIQKLEVERQRNKRNIGQAICNNSIPYVVEN              DVNRPNRRTIKR
Sbjct: 241 RRSEIQKLEVERQRNKRNIGQAICNNSIPYVVENLDASESESSLSAIDDVNRPNRRTIKR 300

Query: 301 KRAAEPPCNLPLLNHIRNLQGGTSMITDELKLALTNSKSQAAEDRKRKDRKLEIQQELLE 360
           KRAAEPPCNLPLLNHIRNLQGGTSMITDELKLALTNSKSQAAEDRKRKDRKLEIQQELLE
Sbjct: 301 KRAAEPPCNLPLLNHIRNLQGGTSMITDELKLALTNSKSQAAEDRKRKDRKLEIQQELLE 360

Query: 361 IKRHRQKMDLVRQEMDLKRHEMDLKLQQMKIKSQESRNLIQLFELAGKSDEVERLRPRLT 420
           IKRHRQKMDLVRQEMDLKRHEMDLKLQQMKIKSQESRNLIQLFELAGKSDEVERLRPRLT
Sbjct: 361 IKRHRQKMDLVRQEMDLKRHEMDLKLQQMKIKSQESRNLIQLFELAGKSDEVERLRPRLT 420

Query: 421 SLLQKTL 427
           SLLQKTL
Sbjct: 421 SLLQKTL 427

>Kwal_23.4711
          Length = 416

 Score =  274 bits (700), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 165/384 (42%), Positives = 228/384 (59%), Gaps = 20/384 (5%)

Query: 11  PLDNAIPCTAENLDIPPSPSPQENPAEINPDVLGAQSGSLRHTRHLAGTEPQIAMEQNEL 70
           P      CT  +L        Q NPA+I+        G     R+LA T     M Q +L
Sbjct: 12  PASCETSCTETSLK-NGDDDAQANPAKIDNHSTETGRGIPSSPRNLAQTTSHNEMRQEQL 70

Query: 71  FLEYFHSTIITDEFSNIRDPKRANMKMAKAIRELIKNKKYKSLEDGKQYKFKWDNGSTFY 130
            LE+FHS II  E + I+  +  + K+ KAI+ELIK + YKS ++GK+Y+FKW + +T+Y
Sbjct: 71  LLEHFHSAIIPKELALIKHLRTEHGKIMKAIQELIKVEGYKSADNGKEYRFKWTDDATYY 130

Query: 131 LLKYCYEIGPFLGYESLKSKSFEKLEQSSLMSLKWSCVWFNLLMSIEFENYVIPTEGQLK 190
           LL+YC EIGPF G+E LK  S  KLEQSSL+SLKWSCVW++LLM + FEN +IPTE Q+K
Sbjct: 131 LLRYCLEIGPFYGFEHLKRNSLIKLEQSSLISLKWSCVWYDLLMKLHFENSIIPTESQIK 190

Query: 191 SRFKYLLECAHPKTFTVTTGDERNPFEFTGNDKVDNILESLARLKNDAEVRRSEIQKLEV 250
           S+ +YLL+ AHPK F    GDE+N F FTG DKVDNILE L RLKNDAE R+ EIQKLE 
Sbjct: 191 SKCRYLLDNAHPKLF---AGDEQNRFSFTGVDKVDNILEMLTRLKNDAEQRKVEIQKLEA 247

Query: 251 ERQRNKRNIGQAICNNSIPYVVENXXXXXXXXXXXXXXDVNRPNRRTIKRKRAAEPPCNL 310
           +RQ NKR + Q + +NSIP   E+               +NR N    + KR        
Sbjct: 248 DRQNNKRTLDQTLYSNSIPSERES-LSNFDSEESPPIYGINRRNSIMRRNKRTRR----- 301

Query: 311 PLLNHIRNLQGGTSMITDELKLALTNSKSQA-AEDRKRKDRKLEIQQELLEIKRHRQK-- 367
            LL  I       S++  +L+ +L +S   A  E++K KD++L ++Q+ LE+   R +  
Sbjct: 302 -LLKVIAKYSLSNSVLVGDLQESLKDSIEAALVEEKKYKDQELALKQKQLEMSLQRDQRM 360

Query: 368 --MDLVRQEMDLKRHEMDLKLQQM 389
             ++L RQ    KR ++D  ++++
Sbjct: 361 LELELERQ----KREQLDYDVKKI 380

>Kwal_23.3840
          Length = 784

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 16/107 (14%)

Query: 26  PPSPSPQENPAEINPDVLGAQSGSLRHTRHLAGTEPQIAMEQNELFLEYFHSTIITDEFS 85
           PPS   Q  P+   P  +    G+L +   L    P IA +   L +E+F +T+    F+
Sbjct: 438 PPSLDEQMKPS---PLKIVQIFGALTYVLDLHQVHPLIAQQCLSLAVEWFSATL----FN 490

Query: 86  NIRDPKRANMKMAKA---------IRELIKNKKYKSLEDGKQYKFKW 123
            I D K+ ++  A A         I++ IKN  +K+       +F W
Sbjct: 491 RIIDNKKKSLSRAHAVQIRLNISVIQDWIKNHDFKAAMPSMVDEFMW 537

>Scas_710.0d
          Length = 271

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 29  PSPQENPAEINPDVLGAQSGSLRHTRHLAGTEPQIAMEQNELFLEYFHSTIITDEFSNIR 88
           PS Q +   + P+V   Q    +H   + G  P+     + +F +Y    +  D+F NI 
Sbjct: 183 PSAQPSVTSVVPEVEDVQPERPKH--QVTGVAPEHDANIDAIF-KYPGPKVFKDQFGNIM 239

Query: 89  DPKRA 93
           DP+RA
Sbjct: 240 DPERA 244

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,517,932
Number of extensions: 581744
Number of successful extensions: 3108
Number of sequences better than 10.0: 120
Number of HSP's gapped: 3138
Number of HSP's successfully gapped: 127
Length of query: 427
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 323
Effective length of database: 12,995,837
Effective search space: 4197655351
Effective search space used: 4197655351
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)