Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.84847546924510.0
AFR287W611153673.2
Kwal_27.1183979858674.1
YDR026C57033648.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.848
         (469 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.848                                                           948   0.0  
AFR287W [3479] [Homologous to ScYIL150C (DNA43) - SH] complement...    30   3.2  
Kwal_27.11839                                                          30   4.1  
YDR026C (YDR026C) [878] chr4 complement(492552..494264) Protein ...    29   8.7  

>Kwal_14.848
          Length = 475

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/469 (97%), Positives = 457/469 (97%)

Query: 1   MEGYSLQEIIHLKETIEARHFHIGYLEYLLRHLKYDGLTEFCRCLESREYLLRYCHGNWA 60
           MEGYSLQEIIHLKETIEARHFHIGYLEYLLRHLKYDGLTEFCRCLESREYLLRYCHGNWA
Sbjct: 1   MEGYSLQEIIHLKETIEARHFHIGYLEYLLRHLKYDGLTEFCRCLESREYLLRYCHGNWA 60

Query: 61  VRRLTNNTSRTVLQATLESLENVGTFISKERLDLEERVRQLCFERLRYEKLRNARARGKN 120
           VRRLTNNTSRTVLQATLESLENVGTFISKERLDLEERVRQLCFERLRYEKLRNARARGKN
Sbjct: 61  VRRLTNNTSRTVLQATLESLENVGTFISKERLDLEERVRQLCFERLRYEKLRNARARGKN 120

Query: 121 FRYNRFYERGCNFELKYTDVHFRRLAGFHKSQLNRIVKSLKIPSNIAKFALTPLESFVIF 180
           FRYNRFYERGCNFELKYTDVHFRRLAGFHKSQLNRIVKSLKIPSNIAKFALTPLESFVIF
Sbjct: 121 FRYNRFYERGCNFELKYTDVHFRRLAGFHKSQLNRIVKSLKIPSNIAKFALTPLESFVIF 180

Query: 181 IVRQRSGCTYNVLAGICGREXXXXXXXXXXXXCYLFRLIKPALSATNAPWLSGRLAEFDQ 240
           IVRQRSGCTYNVLAGICGRE            CYLFRLIKPALSATNAPWLSGRLAEFDQ
Sbjct: 181 IVRQRSGCTYNVLAGICGREITTISKVISIVTCYLFRLIKPALSATNAPWLSGRLAEFDQ 240

Query: 241 ILVSTEKSISGSRIIGFIDGTHAEIARPYGGPNRSNRLQNSVFSGHKKTHIMKYQAVTTP 300
           ILVSTEKSISGSRIIGFIDGTHAEIARPYGGPNRSNRLQNSVFSGHKKTHIMKYQAVTTP
Sbjct: 241 ILVSTEKSISGSRIIGFIDGTHAEIARPYGGPNRSNRLQNSVFSGHKKTHIMKYQAVTTP 300

Query: 301 DGLCIDLTGPFSGSQHDSFMFMHSDLYDRLKQALRVGGSQYRIYGDPAYRSSDILTLGYK 360
           DGLCIDLTGPFSGSQHDSFMFMHSDLYDRLKQALRVGGSQYRIYGDPAYRSSDILTLGYK
Sbjct: 301 DGLCIDLTGPFSGSQHDSFMFMHSDLYDRLKQALRVGGSQYRIYGDPAYRSSDILTLGYK 360

Query: 361 GQRLTADQKKKLNKILSTSRVSIEWFFGAVKNNFQVFNAHGRLKVGGVRGCGAYFPIAVF 420
           GQRLTADQKKKLNKILSTSRVSIEWFFGAVKNNFQVFNAHGRLKVGGVRGCGAYFPIAVF
Sbjct: 361 GQRLTADQKKKLNKILSTSRVSIEWFFGAVKNNFQVFNAHGRLKVGGVRGCGAYFPIAVF 420

Query: 421 LTNVKHCLEGSQASQYFDVDPPSFEEYMSRLKFPKMECSLMLKEMKIFI 469
           LTNVKHCLEGSQASQYFDVDPPSFEEYMSRLKFPKMECSLMLKEMKIFI
Sbjct: 421 LTNVKHCLEGSQASQYFDVDPPSFEEYMSRLKFPKMECSLMLKEMKIFI 469

>AFR287W [3479] [Homologous to ScYIL150C (DNA43) - SH]
           complement(956961..958796) [1836 bp, 611 aa]
          Length = 611

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 63/153 (41%), Gaps = 31/153 (20%)

Query: 249 ISGSRIIGFIDGTHAEIARPYGGPNRSNRLQNSVFSGHKKTHIMKYQAVTTPDGLCIDLT 308
           I  S+ +GF    +     P G P   N+L+  V S H++TH+    A        I L 
Sbjct: 333 IGHSKELGFCPAMNKTKGAPCGAP--INKLKEQVCSYHQETHLRSVNAKRVELNGNISLR 390

Query: 309 GPF-SGSQHDSFMFMHS---------DLYDRLKQALRVGGSQ------------YRIYGD 346
            P   G Q   +M  +S         D+Y     A R  G++            +R Y D
Sbjct: 391 APTRDGIQQAGYMTRNSHGTKIGLLPDVY-----APRAPGAEQKFREHFASANAHRAYFD 445

Query: 347 PAYRSSDIL-TLGYKGQRLTADQK-KKLNKILS 377
             Y + D+L  L  K +++   +K +++NK LS
Sbjct: 446 SDYHNPDVLQNLESKRRKIQLSKKDQQINKQLS 478

>Kwal_27.11839
          Length = 798

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 12/58 (20%)

Query: 346 DPAYRSSDILTLGYKGQRLTADQKKKLNKILSTSRVSIEWFFGAVKNNFQVFNAHGRL 403
           D  YR+ ++  L     RL AD++ KL   LST+ +++E      +NN Q+F  HG+L
Sbjct: 15  DVFYRNRELCQL-----RLPADEEYKL--ALSTTVLAVE-----TENNIQIFQYHGKL 60

>YDR026C (YDR026C) [878] chr4 complement(492552..494264) Protein
           with similarity to Reb1p [1713 bp, 570 aa]
          Length = 570

 Score = 29.3 bits (64), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 98  VRQLCFERLRYEKLRNARARGKNFRYNRFYERG 130
           V ++  E  +Y++++   A  KN RYN+ Y RG
Sbjct: 412 VNEMIEEAHQYQRMKALEAANKNDRYNQMYSRG 444

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.139    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,460,724
Number of extensions: 591075
Number of successful extensions: 1908
Number of sequences better than 10.0: 5
Number of HSP's gapped: 1951
Number of HSP's successfully gapped: 5
Length of query: 469
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 364
Effective length of database: 12,961,219
Effective search space: 4717883716
Effective search space used: 4717883716
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 63 (28.9 bits)