Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.8335841937371e-89
Kwal_5.48213161163253e-31
Kwal_55.222097291163234e-31
Kwal_55.2220115241163245e-31
Kwal_47.168344731163157e-31
KLLA0B14916g5501162549e-23
Kwal_5.4928941162505e-22
Kwal_56.222781621202253e-21
Kwal_55.195043911182374e-21
Kwal_45.165122771162272e-20
Kwal_38.163812571162262e-20
Kwal_55.195133201202256e-20
Kwal_38.163725011072306e-20
Kwal_27.128602621162217e-20
Kwal_57.248762791162211e-19
Kwal_38.163766931152301e-19
Kwal_45.165102791162211e-19
Kwal_54.194944501162262e-19
Kwal_10.6284501162262e-19
Kwal_45.165145141162253e-19
CAGL0I07293g16951162283e-19
Kwal_27.128556451162245e-19
Kwal_37.163523381032179e-19
Kwal_40.164562401072111e-18
Kwal_55.195147651202221e-18
Kwal_40.164442641072084e-18
KLLA0A11935g11181262184e-18
Kwal_40.164405231162121e-17
Kwal_47.16796209961992e-17
Kwal_47.168133391112026e-17
KLLA0C19162g4331162031e-16
AFL092C9351042015e-16
CAGL0E06600g9651182015e-16
KLLA0C19316g6991162005e-16
Kwal_27.128466411071844e-14
Kwal_47.168203031071785e-14
Kwal_47.167906471071811e-13
KLLA0B00308g4491041782e-13
Kwal_11.640114951613e-13
KLLA0C19151g5951181755e-13
KLLA0E14586g1224601775e-13
Kwal_29.12877105581578e-13
Kwal_18.26976051001739e-13
Kwal_29.128756051001739e-13
Kwal_54.19493134581581e-12
Kwal_45.16518134581581e-12
Kwal_10.632134581581e-12
Kwal_44.16501130941571e-12
Kwal_55.195065331051692e-12
Kwal_11.643280581643e-12
Kwal_27.9651438971673e-12
Kwal_28.12868429971673e-12
Sklu_2424.59671161542e-10
Kwal_40.164492021501443e-10
Kwal_47.16805128891394e-10
Kwal_22.2754411521479e-10
KLLA0D00275g3911321469e-10
Kwal_44.16506484521461e-09
Kwal_44.16504129821306e-09
AFL095W2535951427e-09
YHR211W (FLO5)10751131401e-08
YAR050W (FLO1)15371131391e-08
KLLA0E25113g338731308e-08
Kwal_56.222774171031246e-07
Kwal_55.19510274471217e-07
Kwal_38.16383110461121e-06
Kwal_29.12878271401154e-06
Kwal_47.16802159721053e-05
YAL063C (FLO9)13221141088e-05
Scas_694.1*1109491042e-04
CAGL0I00220g864120740.64
Kwal_54.1948432716692.5
Kwal_60.2493727916682.7
YHR213W19829664.1
CAGL0I10362g121734674.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.833
         (576 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.833                                                           288   1e-89
Kwal_5.482                                                            129   3e-31
Kwal_55.22209                                                         129   4e-31
Kwal_55.22201                                                         129   5e-31
Kwal_47.16834                                                         125   7e-31
KLLA0B14916g 1315518..1317170 weakly similar to sp|P38894 Saccha...   102   9e-23
Kwal_5.492                                                            100   5e-22
Kwal_56.22278                                                          91   3e-21
Kwal_55.19504                                                          96   4e-21
Kwal_45.16512                                                          92   2e-20
Kwal_38.16381                                                          92   2e-20
Kwal_55.19513                                                          91   6e-20
Kwal_38.16372                                                          93   6e-20
Kwal_27.12860                                                          90   7e-20
Kwal_57.24876                                                          90   1e-19
Kwal_38.16376                                                          93   1e-19
Kwal_45.16510                                                          90   1e-19
Kwal_54.19494                                                          92   2e-19
Kwal_10.628                                                            92   2e-19
Kwal_45.16514                                                          91   3e-19
CAGL0I07293g complement(703325..708370) some similarities with s...    92   3e-19
Kwal_27.12855                                                          91   5e-19
Kwal_37.16352                                                          88   9e-19
Kwal_40.16456                                                          86   1e-18
Kwal_55.19514                                                          90   1e-18
Kwal_40.16444                                                          85   4e-18
KLLA0A11935g 1031062..1034418 some similarities with sp|P32768 S...    89   4e-18
Kwal_40.16440                                                          86   1e-17
Kwal_47.16796                                                          81   2e-17
Kwal_47.16813                                                          82   6e-17
KLLA0C19162g 1705537..1706838 weakly similar to sp|P32768 Saccha...    83   1e-16
AFL092C [3101] [Homologous to ScYHR211W (FLO5) - NSH] (269106..2...    82   5e-16
CAGL0E06600g 658198..661095 some similarities with sp|P38894 Sac...    82   5e-16
KLLA0C19316g 1722987..1725086 weakly similar to sp|P32768 Saccha...    82   5e-16
Kwal_27.12846                                                          75   4e-14
Kwal_47.16820                                                          73   5e-14
Kwal_47.16790                                                          74   1e-13
KLLA0B00308g complement(18349..19698) weakly similar to sp|P3276...    73   2e-13
Kwal_11.640                                                            67   3e-13
KLLA0C19151g 1702106..1703893 weakly similar to sp|P38894 Saccha...    72   5e-13
KLLA0E14586g complement(1290917..1294591) some similarities with...    73   5e-13
Kwal_29.12877                                                          65   8e-13
Kwal_18.2697                                                           71   9e-13
Kwal_29.12875                                                          71   9e-13
Kwal_54.19493                                                          65   1e-12
Kwal_45.16518                                                          65   1e-12
Kwal_10.632                                                            65   1e-12
Kwal_44.16501                                                          65   1e-12
Kwal_55.19506                                                          70   2e-12
Kwal_11.643                                                            68   3e-12
Kwal_27.9651                                                           69   3e-12
Kwal_28.12868                                                          69   3e-12
Sklu_2424.5 , Contig c2424 17833-20731                                 64   2e-10
Kwal_40.16449                                                          60   3e-10
Kwal_47.16805                                                          58   4e-10
Kwal_22.2754                                                           61   9e-10
KLLA0D00275g complement(24448..25623) no similarity, hypothetica...    61   9e-10
Kwal_44.16506                                                          61   1e-09
Kwal_44.16504                                                          55   6e-09
AFL095W [3100] [Homologous to ScYHR211W (FLO5) - NSH] complement...    59   7e-09
YHR211W (FLO5) [2496] chr8 (525390..528617) Flocculin, member of...    59   1e-08
YAR050W (FLO1) [84] chr1 (203396..208009) Flocculin, cell wall p...    58   1e-08
KLLA0E25113g 2227131..2228147 no similarity, hypothetical start        55   8e-08
Kwal_56.22277                                                          52   6e-07
Kwal_55.19510                                                          51   7e-07
Kwal_38.16383                                                          48   1e-06
Kwal_29.12878                                                          49   4e-06
Kwal_47.16802                                                          45   3e-05
YAL063C (FLO9) [7] chr1 complement(24001..27969) Member of the F...    46   8e-05
Scas_694.1*                                                            45   2e-04
CAGL0I00220g complement(12309..14903) some similarities with sp|...    33   0.64 
Kwal_54.19484                                                          31   2.5  
Kwal_60.24937                                                          31   2.7  
YHR213W (YHR213W) [2497] chr8 (539149..539745) Protein containin...    30   4.1  
CAGL0I10362g 1011132..1014743 some similarities with sp|P32768 S...    30   4.6  

>Kwal_14.833
          Length = 584

 Score =  288 bits (737), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 154/193 (79%), Positives = 154/193 (79%)

Query: 1   MVSQLLRLSTMLRPQPSPLRALCTPHGLVPRPPPSLLTCLHSLALTVFQLPRPXXXXXXX 60
           MVSQLLRLSTMLRPQPSPLRALCTPHGLVPRPPPSLLTCLHSLALTVFQLPRP       
Sbjct: 1   MVSQLLRLSTMLRPQPSPLRALCTPHGLVPRPPPSLLTCLHSLALTVFQLPRPSTTSKLQ 60

Query: 61  XXXXXXXXXXXXXVLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXX 120
                        VLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVY      
Sbjct: 61  LLALSLPPTLSGLVLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYTPWTGT 120

Query: 121 XXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGT 180
                        GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGT
Sbjct: 121 ETSTYSTELSTFTGSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGT 180

Query: 181 DGIQTTETLYFVE 193
           DGIQTTETLYFVE
Sbjct: 181 DGIQTTETLYFVE 193

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 51/104 (49%)

Query: 473 ITGRGSTTTLALTQHESTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPDTPYTSK 532
           ITGRGSTTTLALTQHESTP                                MPDTPYTSK
Sbjct: 473 ITGRGSTTTLALTQHESTPAGSQVQSVASSSHTLVSSQVFSASVSSSTVTSMPDTPYTSK 532

Query: 533 PGHAWXXXXXXXXXXXXXXXXXXXXXQSVSTYEGSANRLGFGLL 576
           PGHAW                     QSVSTYEGSANRLGFGLL
Sbjct: 533 PGHAWSSQSQVVSSSLSTAYAPSSSLQSVSTYEGSANRLGFGLL 576

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETP 105
           STYST+V T TG+DG+ TTET+Y+VETP
Sbjct: 168 STYSTDVLTLTGTDGIQTTETLYFVETP 195

>Kwal_5.482
          Length = 1316

 Score =  129 bits (325), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 74/116 (63%), Positives = 82/116 (70%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STYST V+TFTGSDG+PTTETIYYVETP   TQST                     GSDG
Sbjct: 1169 STYSTAVSTFTGSDGIPTTETIYYVETPVVETQSTTITGWTGSFTSTYSTAVSTFTGSDG 1228

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            +PTTETIYYVETPVV  +STT T WTG +TSTYST V T TG+DGI TTET+Y+VE
Sbjct: 1229 IPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETIYYVE 1284

 Score =  129 bits (324), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/116 (62%), Positives = 82/116 (70%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STYST ++TFTGSDG+PTTETIYYVETP   TQST                     GSDG
Sbjct: 899  STYSTAISTFTGSDGIPTTETIYYVETPVVETQSTTITGWTGSFTSTYSTAVSTFTGSDG 958

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            +PTTETIYYVETPVV  +STT T WTG +TSTYST V T TG+DGI TTET+Y+VE
Sbjct: 959  IPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETIYYVE 1014

 Score =  127 bits (320), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 82/116 (70%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTGSDG+PTTETIYYVETP   TQST                     GSDG
Sbjct: 809 STYSTAISTFTGSDGIPTTETIYYVETPVVETQSTTITGWTGSFTSTYSTAVSTFTGSDG 868

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +PTTETIY+VETPVV  +STT T WTG +TSTYST + T TG+DGI TTET+Y+VE
Sbjct: 869 IPTTETIYFVETPVVESLSTTITGWTGSFTSTYSTAISTFTGSDGIPTTETIYYVE 924

 Score =  126 bits (316), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 73/116 (62%), Positives = 80/116 (68%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTGSDG+PTTETIYYVETP   + ST                     GSDG
Sbjct: 764 STYSTAVSTFTGSDGIPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAISTFTGSDG 823

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +PTTETIYYVETPVV   STT T WTG +TSTYST V T TG+DGI TTET+YFVE
Sbjct: 824 IPTTETIYYVETPVVETQSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETIYFVE 879

 Score =  125 bits (314), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 81/116 (69%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STYST V+TFTGSDG+PTTETIYYVETP   + ST                     GSDG
Sbjct: 944  STYSTAVSTFTGSDGIPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDG 1003

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            +PTTETIYYVETPVV  +STT T WTG +TSTYST V T TG+DGI TTET+Y+VE
Sbjct: 1004 IPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETIYYVE 1059

 Score =  125 bits (314), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 81/116 (69%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STYST V+TFTGSDG+PTTETIYYVETP   + ST                     GSDG
Sbjct: 989  STYSTAVSTFTGSDGIPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDG 1048

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            +PTTETIYYVETPVV  +STT T WTG +TSTYST V T TG+DGI TTET+Y+VE
Sbjct: 1049 IPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETIYYVE 1104

 Score =  125 bits (314), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 81/116 (69%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STYST V+TFTGSDG+PTTETIYYVETP   + ST                     GSDG
Sbjct: 1034 STYSTAVSTFTGSDGIPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDG 1093

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            +PTTETIYYVETPVV  +STT T WTG +TSTYST V T TG+DGI TTET+Y+VE
Sbjct: 1094 IPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETIYYVE 1149

 Score =  124 bits (312), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 80/116 (68%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STYST V+TFTGSDG+PTTETIYYVETP   + ST                     GSDG
Sbjct: 1079 STYSTAVSTFTGSDGIPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDG 1138

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            +PTTETIYYVETPVV   STT T WTG +TSTYST V T TG+DGI TTET+Y+VE
Sbjct: 1139 IPTTETIYYVETPVVETQSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETIYYVE 1194

 Score =  117 bits (294), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/116 (58%), Positives = 79/116 (68%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           ST+ST V+TFTG DG+ TTETIYYVETP   + ST                     GSDG
Sbjct: 674 STFSTAVSTFTGDDGLATTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDG 733

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +PTTETIY+VETPVV  +STT T WTG +TSTYST V T TG+DGI TTET+Y+VE
Sbjct: 734 IPTTETIYFVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETIYYVE 789

 Score =  104 bits (260), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 67/102 (65%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STYST V+TFTGSDG+PTTETIYYVETP   + ST                     GSDG
Sbjct: 1214 STYSTAVSTFTGSDGIPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDG 1273

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTG 179
            +PTTETIYYVETPVV   STT T WTG +TSTYST V T TG
Sbjct: 1274 IPTTETIYYVETPVVETQSTTITGWTGSFTSTYSTAVSTFTG 1315

 Score = 98.6 bits (244), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 67/107 (62%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG+ TTETIYYVETPT A  S                      G DG+ TTETIYY
Sbjct: 593 FTGDDGLATTETIYYVETPTKAITSYTTRPYEGQDTTTYSTQVTTFTGDDGLATTETIYY 652

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP + + STT T WTG +TST+ST V T TG DG+ TTET+Y+VE
Sbjct: 653 VETPKIEISSTTITGWTGSFTSTFSTAVSTFTGDDGLATTETIYYVE 699

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 71/115 (61%)

Query: 79  TYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGV 138
           T ST+V+TFTG+DGV TT+TIYYVETPT A  S                      G DG+
Sbjct: 450 TVSTKVSTFTGTDGVLTTDTIYYVETPTKAITSFTTRPYEGQDTTTYSTQVTTFTGDDGI 509

Query: 139 PTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            TTETIYYVETP   + S T   + G+ T+TYST V T TG DGI TTET+Y+VE
Sbjct: 510 ATTETIYYVETPTKAITSFTTRPYEGQDTTTYSTQVTTFTGDDGIATTETIYYVE 564

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 63/107 (58%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG+ TTETIYYVETPT A  S                      G DG+ TTETIYY
Sbjct: 503 FTGDDGIATTETIYYVETPTKAITSFTTRPYEGQDTTTYSTQVTTFTGDDGIATTETIYY 562

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP   + S T   + G+ T+TYST V T TG DG+ TTET+Y+VE
Sbjct: 563 VETPTKAITSFTTRPYEGQDTTTYSTQVTTFTGDDGLATTETIYYVE 609

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           ST+ST   T  G+DG  T ETIYY++TPT    ST                     G+DG
Sbjct: 404 STFSTTRLTTVGTDGSTTVETIYYIQTPTHGRTSTTTAPGSGTATKTVSTKVSTFTGTDG 463

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           V TT+TIYYVETP   + S T   + G+ T+TYST V T TG DGI TTET+Y+VE
Sbjct: 464 VLTTDTIYYVETPTKAITSFTTRPYEGQDTTTYSTQVTTFTGDDGIATTETIYYVE 519

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 54/104 (51%)

Query: 90  SDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVET 149
           SDG  T ET+  VE PT+   S V                    G+DG  T ETIYY++T
Sbjct: 371 SDGNLTPETVIVVEVPTYDETSYVTTAATGSATSTFSTTRLTTVGTDGSTTVETIYYIQT 430

Query: 150 PVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           P     STT    +G  T T ST V T TGTDG+ TT+T+Y+VE
Sbjct: 431 PTHGRTSTTTAPGSGTATKTVSTKVSTFTGTDGVLTTDTIYYVE 474

>Kwal_55.22209
          Length = 729

 Score =  129 bits (323), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTGSDGVPTTET+YYVETPTF T+STV+                   GSDG
Sbjct: 78  STYSTAVSTFTGSDGVPTTETVYYVETPTFVTESTVFTHWTGTETSTYSTAVSTFTGSDG 137

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VPTTET+YYVETP     ST +T WTG +TS+YSTDV T TG+DG+ TT+T+Y+VE
Sbjct: 138 VPTTETVYYVETPTFVTESTVFTHWTGSFTSSYSTDVSTFTGSDGVPTTKTVYYVE 193

 Score =  120 bits (302), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 80/116 (68%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTGSDGVPTTET+YYVETPT   +STV+                   GSDG
Sbjct: 33  STYSTAVSTFTGSDGVPTTETVYYVETPTNGAESTVFTHWTGTETSTYSTAVSTFTGSDG 92

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VPTTET+YYVETP     ST +T WTG  TSTYST V T TG+DG+ TTET+Y+VE
Sbjct: 93  VPTTETVYYVETPTFVTESTVFTHWTGTETSTYSTAVSTFTGSDGVPTTETVYYVE 148

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 63/96 (65%)

Query: 98  TIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVST 157
           T+YYVETPTF T+STV+                   GSDGVPTTET+YYVETP     ST
Sbjct: 8   TVYYVETPTFVTESTVFTHWTGTETSTYSTAVSTFTGSDGVPTTETVYYVETPTNGAEST 67

Query: 158 TYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            +T WTG  TSTYST V T TG+DG+ TTET+Y+VE
Sbjct: 68  VFTHWTGTETSTYSTAVSTFTGSDGVPTTETVYYVE 103

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 68/111 (61%), Gaps = 2/111 (1%)

Query: 83  EVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTE 142
           +++TFTG DG  TT+TIYYVETPT    S                      G DG  TT+
Sbjct: 432 DLSTFTGEDGKTTTQTIYYVETPTAG--SIEMTGWTGSYTSTYSTGLSTFTGEDGKTTTQ 489

Query: 143 TIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           T+YYVETP V ++ TT T WT R+TST+ST V T TGTDG  TTETLY+VE
Sbjct: 490 TVYYVETPTVGLIFTTLTGWTDRFTSTFSTAVSTFTGTDGKLTTETLYYVE 540

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 81/158 (51%), Gaps = 42/158 (26%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTGSDGVPTTET+YYVETPTF T+STV+                   GSDG
Sbjct: 123 STYSTAVSTFTGSDGVPTTETVYYVETPTFVTESTVFTHWTGSFTSSYSTDVSTFTGSDG 182

Query: 138 VPTT------------------------------------------ETIYYVETPVVNVV 155
           VPTT                                           T+YYV+TP  ++ 
Sbjct: 183 VPTTKTVYYVETPDRISTTHAKWTRSFTTTVSTIVTVFTLDGVPTTSTLYYVQTPDNDIE 242

Query: 156 STTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           STTYT WTG  TSTY+T V T TG D   TT+T+Y+VE
Sbjct: 243 STTYTYWTGTETSTYTTAVSTFTGEDCKTTTQTVYYVE 280

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 65/110 (59%), Gaps = 4/110 (3%)

Query: 84  VTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTET 143
           V+TFTG D   TT+T+YYVETPT  T ST                     G DG  TT+T
Sbjct: 261 VSTFTGEDCKTTTQTVYYVETPT--TGSTEVTGWTGTFTSTYSTGLSTFTGEDGKTTTQT 318

Query: 144 IYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +YYVETP V   ST  T WTG YT+TYST + T TG DG  TT+T+Y+VE
Sbjct: 319 VYYVETPTVG--STEMTGWTGSYTNTYSTGLSTFTGDDGKTTTQTVYYVE 366

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 71/116 (61%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +TYST ++TFTG DG  TT+T+YYVETPT    ST                     G DG
Sbjct: 341 NTYSTGLSTFTGDDGKTTTQTVYYVETPTVG--STEVTGWTGTYTSTYSTGLSTFTGEDG 398

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     S +YT WTG YTSTYSTD+ T TG DG  TT+T+Y+VE
Sbjct: 399 KTTTQTVYYVETPTSG--SNSYTGWTGTYTSTYSTDLSTFTGEDGKTTTQTIYYVE 452

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 72/135 (53%), Gaps = 19/135 (14%)

Query: 74  VLRPSTYSTEVT---------------TFTGSDGVPTTETIYYVETPTFATQSTVYXXXX 118
           V  P+T STEVT               TFTG DG  TT+T+YYVETPT    ST      
Sbjct: 279 VETPTTGSTEVTGWTGTFTSTYSTGLSTFTGEDGKTTTQTVYYVETPTVG--STEMTGWT 336

Query: 119 XXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLT 178
                          G DG  TT+T+YYVETP V   ST  T WTG YTSTYST + T T
Sbjct: 337 GSYTNTYSTGLSTFTGDDGKTTTQTVYYVETPTVG--STEVTGWTGTYTSTYSTGLSTFT 394

Query: 179 GTDGIQTTETLYFVE 193
           G DG  TT+T+Y+VE
Sbjct: 395 GEDGKTTTQTVYYVE 409

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETPT     T                     G+DG
Sbjct: 470 STYSTGLSTFTGEDGKTTTQTVYYVETPTVGLIFTTLTGWTDRFTSTFSTAVSTFTGTDG 529

Query: 138 VPTTETIYYVETPV 151
             TTET+YYVETP 
Sbjct: 530 KLTTETLYYVETPA 543

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/31 (70%), Positives = 26/31 (83%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFA 108
           ST+ST V+TFTG+DG  TTET+YYVETP  A
Sbjct: 515 STFSTAVSTFTGTDGKLTTETLYYVETPASA 545

>Kwal_55.22201
          Length = 1524

 Score =  129 bits (324), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 74/116 (63%), Positives = 82/116 (70%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STYST V+TFTGSDG+PTTETIYYVETP   TQST                     GSDG
Sbjct: 1351 STYSTAVSTFTGSDGIPTTETIYYVETPVVETQSTTITGWTGSFTSTYFTAVSTFTGSDG 1410

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            +PTTETIYYVETPVV  +STT T WTG +TSTYST V T TG+DGI TTET+Y+VE
Sbjct: 1411 IPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETIYYVE 1466

 Score =  125 bits (313), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 81/116 (69%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STYST V+TFTGSDG+PTTETIYYVETP   + ST                     GSDG
Sbjct: 1261 STYSTAVSTFTGSDGIPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAISTFTGSDG 1320

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            +PTTETIYYVETPVV  +STT T WTG +TSTYST V T TG+DGI TTET+Y+VE
Sbjct: 1321 IPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETIYYVE 1376

 Score =  122 bits (306), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 80/116 (68%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STY T V+TFTGSDG+PTTETIYYVETP   + ST                     GSDG
Sbjct: 1396 STYFTAVSTFTGSDGIPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAVSTFTGSDG 1455

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            +PTTETIYYVETPVV  +STT T WTG +TSTYST + T TG+DGI TTET+Y+VE
Sbjct: 1456 IPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAISTFTGSDGIPTTETIYYVE 1511

 Score =  107 bits (268), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 75/116 (64%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            ST+ST V++FTG DG+ TTETIYYVETPT A  S                      G DG
Sbjct: 1171 STFSTAVSSFTGDDGLATTETIYYVETPTKAITSYTTRPYEGQDTTTYSTEVTTFTGDDG 1230

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
              TTETIYYVETP + + STT T WTG +TSTYST V T TG+DGI TTET+Y+VE
Sbjct: 1231 FATTETIYYVETPKIEISSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETIYYVE 1286

 Score =  105 bits (263), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 72/115 (62%)

Query: 79   TYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGV 138
            TYST  TT +G+DG  TTETIYYVETPT+   ST Y                   GSDG 
Sbjct: 947  TYSTGYTTISGTDGAQTTETIYYVETPTYRRDSTQYTLWNGSDISTFSTHVSTLTGSDGK 1006

Query: 139  PTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TTETIYYV+TP + V  TT   WTG  TSTYSTD+ T  G DGI+TTETL+FVE
Sbjct: 1007 VTTETIYYVKTPTIGVEVTTLRPWTGSGTSTYSTDITTFVGDDGIKTTETLFFVE 1061

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 72/116 (62%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STY+ EVTTF G DG  TTETIYYVETPT A  S                      G DG
Sbjct: 1081 STYAIEVTTFIGDDGTATTETIYYVETPTKAITSFTTRPYEGQDTTTYSTEVTTFTGDDG 1140

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
              TTETIYYVETP + + STT T WTG +TST+ST V + TG DG+ TTET+Y+VE
Sbjct: 1141 FATTETIYYVETPKIEISSTTITGWTGSFTSTFSTAVSSFTGDDGLATTETIYYVE 1196

 Score =  101 bits (252), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 71/116 (61%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST+++TFTG DG  T ETIYYVETP     S V                    G DG
Sbjct: 588 STYSTDLSTFTGEDGKQTVETIYYVETPIIQLTSEVTTAYSGDATSTYSTDLSTFTGEDG 647

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T ETIYYVETP++ + S   T+++G  TSTYSTDVLT TG DG QT ET+Y+VE
Sbjct: 648 KQTVETIYYVETPIIQLTSEVTTAYSGDATSTYSTDVLTFTGEDGKQTVETIYYVE 703

 Score = 98.6 bits (244), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 71/116 (61%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST+++TFTG DG  T ETIYYV+TP     S V                    G DG
Sbjct: 723 STYSTDLSTFTGEDGKQTVETIYYVKTPIVQLTSEVTTAYSGDATSTYSTDLSTFTGEDG 782

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T ETIYYV+TP+V + S   T+++G  TSTYSTDVLT TG DG QT ET+Y+VE
Sbjct: 783 KQTVETIYYVKTPIVQLTSEVTTAYSGDVTSTYSTDVLTFTGEDGKQTVETIYYVE 838

 Score = 97.8 bits (242), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST+++TFTG DG  T ETIYYVETP     S V                    G DG
Sbjct: 498 STYSTDLSTFTGEDGKQTVETIYYVETPIIQLTSEVTTAYSGDATSTYSTDVLTFTGEDG 557

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T ETIYYVETP++ + S   T+++G  TSTYSTD+ T TG DG QT ET+Y+VE
Sbjct: 558 KQTVETIYYVETPIIQLTSEVTTAYSGDVTSTYSTDLSTFTGEDGKQTVETIYYVE 613

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 72/116 (62%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           ST+ T+   + GSDG+ TTETIY+VETPT   QST++                   G DG
Sbjct: 856 STFFTDTAVYLGSDGISTTETIYFVETPTVGIQSTIFRPWSGSGISTFSVDFTSFTGIDG 915

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           + TT+TIY+V TP V + ST Y  W+G  T TYST   T++GTDG QTTET+Y+VE
Sbjct: 916 IETTKTIYHVATPKVELNSTIYFPWSGAMTHTYSTGYTTISGTDGAQTTETIYYVE 971

 Score = 95.9 bits (237), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 69/120 (57%)

Query: 74  VLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXX 133
           V   +T+ST V T  GS G P  ETIYYV TP     ST++                   
Sbjct: 449 VSETTTFSTSVNTIIGSGGKPLVETIYYVATPVAEETSTIFIAKDISSTSTYSTDLSTFT 508

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           G DG  T ETIYYVETP++ + S   T+++G  TSTYSTDVLT TG DG QT ET+Y+VE
Sbjct: 509 GEDGKQTVETIYYVETPIIQLTSEVTTAYSGDATSTYSTDVLTFTGEDGKQTVETIYYVE 568

 Score = 94.7 bits (234), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 69/115 (60%), Gaps = 2/115 (1%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST+V TFTG DG  T ETIYYVETP  A  S  Y                   GSDG
Sbjct: 813 STYSTDVLTFTGEDGKQTVETIYYVETPIIARTSFTY--WTGTATSTFFTDTAVYLGSDG 870

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
           + TTETIY+VETP V + ST +  W+G   ST+S D  + TG DGI+TT+T+Y V
Sbjct: 871 ISTTETIYFVETPTVGIQSTIFRPWSGSGISTFSVDFTSFTGIDGIETTKTIYHV 925

 Score = 94.0 bits (232), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 69/116 (59%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST+++TFTG DG  T ETIYYVETP     S V                    G DG
Sbjct: 633 STYSTDLSTFTGEDGKQTVETIYYVETPIIQLTSEVTTAYSGDATSTYSTDVLTFTGEDG 692

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T ETIYYVETP++ + S    +++G  TSTYSTD+ T TG DG QT ET+Y+V+
Sbjct: 693 KQTVETIYYVETPIIQLTSGVTIAYSGDLTSTYSTDLSTFTGEDGKQTVETIYYVK 748

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 67/116 (57%), Gaps = 2/116 (1%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST+++TFTG DG  T ETIYYV+TP     S V                    G DG
Sbjct: 768 STYSTDLSTFTGEDGKQTVETIYYVKTPIVQLTSEVTTAYSGDVTSTYSTDVLTFTGEDG 827

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T ETIYYVETP++   S TY  WTG  TST+ TD     G+DGI TTET+YFVE
Sbjct: 828 KQTVETIYYVETPIIARTSFTY--WTGTATSTFFTDTAVYLGSDGISTTETIYFVE 881

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 69/116 (59%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            ST+ST V+T TGSDG  TTETIYYV+TPT   + T                     G DG
Sbjct: 991  STFSTHVSTLTGSDGKVTTETIYYVKTPTIGVEVTTLRPWTGSGTSTYSTDITTFVGDDG 1050

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            + TTET+++VETP +   ST+Y  W G  +STY+ +V T  G DG  TTET+Y+VE
Sbjct: 1051 IKTTETLFFVETPTIETKSTSYKPWIGTASSTYAIEVTTFIGDDGTATTETIYYVE 1106

 Score = 82.0 bits (201), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 53/83 (63%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            STYST V+TFTGSDG+PTTETIYYVETP   + ST                     GSDG
Sbjct: 1441 STYSTAVSTFTGSDGIPTTETIYYVETPVVESLSTTITGWTGSFTSTYSTAISTFTGSDG 1500

Query: 138  VPTTETIYYVETPVVNVVSTTYT 160
            +PTTETIYYVETPVV   STT T
Sbjct: 1501 IPTTETIYYVETPVVETQSTTIT 1523

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 36/59 (61%)

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
           G DG  T ETIYY+ETP+   +STT        T+T+ST V T+ G+ G    ET+Y+V
Sbjct: 419 GKDGTVTVETIYYIETPIARTISTTEIPQKVSETTTFSTSVNTIIGSGGKPLVETIYYV 477

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +  P V   S +YT+WTG  TSTYST + ++ G DG  T ET+Y++E
Sbjct: 387 IAVPTVGTTSLSYTAWTGIETSTYSTSLSSIEGKDGTVTVETIYYIE 433

>Kwal_47.16834
          Length = 473

 Score =  125 bits (315), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 82/116 (70%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTGSDGVPTTET+YYVETPTF T+STV+                   GSDG
Sbjct: 230 STYSTAVSTFTGSDGVPTTETVYYVETPTFVTESTVFTHWTGTETSTYSTAVSTFTGSDG 289

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VPTTET+YYVETP     ST +T WTG  TSTYST V T TG+DG+ TTET+Y+VE
Sbjct: 290 VPTTETVYYVETPTNGAESTVFTHWTGTETSTYSTAVSTFTGSDGVPTTETVYYVE 345

 Score =  125 bits (313), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 82/116 (70%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTGSDGVPTTET+YYVETPTF T+STV+                   GSDG
Sbjct: 320 STYSTAVSTFTGSDGVPTTETVYYVETPTFVTESTVFTHWTGTETSTYSTAVSTFTGSDG 379

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VPTTET+YYVETP     ST +T WTG  TSTYST V T TG+DG+ TTET+Y+VE
Sbjct: 380 VPTTETVYYVETPTFVTESTVFTHWTGTETSTYSTAVSTFTGSDGVPTTETVYYVE 435

 Score =  120 bits (301), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 80/116 (68%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTGSDG+PTTETIYYVETP   + ST                     GSDG
Sbjct: 53  STYSTAISTFTGSDGIPTTETIYYVETPVVESLSTTITGWTGFFTSTYSTAISTFTGSDG 112

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +PTTETIYYVETPVV   STT T WTG +TSTYST V T TG+DGI TTET+Y+VE
Sbjct: 113 IPTTETIYYVETPVVETQSTTITGWTGSFTSTYSTAVSTFTGSDGIPTTETVYYVE 168

 Score =  120 bits (300), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 80/116 (68%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTGSDGVPTTET+YYVETPT   +STV+                   GSDG
Sbjct: 275 STYSTAVSTFTGSDGVPTTETVYYVETPTNGAESTVFTHWTGTETSTYSTAVSTFTGSDG 334

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VPTTET+YYVETP     ST +T WTG  TSTYST V T TG+DG+ TTET+Y+VE
Sbjct: 335 VPTTETVYYVETPTFVTESTVFTHWTGTETSTYSTAVSTFTGSDGVPTTETVYYVE 390

 Score =  112 bits (279), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 73/106 (68%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTGSDGVPTTET+YYVETPTF T+STV+                   GSDG
Sbjct: 365 STYSTAVSTFTGSDGVPTTETVYYVETPTFVTESTVFTHWTGTETSTYSTAVSTFTGSDG 424

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGI 183
           VPTTET+YYVETP     ST +T WTG  T+TYST V T TG+DG+
Sbjct: 425 VPTTETVYYVETPTFVTESTVFTHWTGTETATYSTAVSTFTGSDGV 470

 Score = 99.4 bits (246), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 78/117 (66%), Gaps = 5/117 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPT-FATQSTVYXXXXXXXXXXXXXXXXXXXGSD 136
           STYST V+TFTGSDG+PTTET+YYVETP   +T  T +                     D
Sbjct: 143 STYSTAVSTFTGSDGIPTTETVYYVETPDRVSTTHTKWTGSFTTTVSTVVTVFTL----D 198

Query: 137 GVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           GVPTT T+YYV+TP  ++ STTYT WTG  TSTYST V T TG+DG+ TTET+Y+VE
Sbjct: 199 GVPTTSTLYYVQTPNNDIESTTYTYWTGTETSTYSTAVSTFTGSDGVPTTETVYYVE 255

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%)

Query: 153 NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             +STT T WTG +TSTYST + T TG+DGI TTET+Y+VE
Sbjct: 38  EFLSTTITGWTGSFTSTYSTAISTFTGSDGIPTTETIYYVE 78

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%)

Query: 78  STYSTEVTTFTGSDGVP 94
           +TYST V+TFTGSDGVP
Sbjct: 455 ATYSTAVSTFTGSDGVP 471

>KLLA0B14916g 1315518..1317170 weakly similar to sp|P38894
           Saccharomyces cerevisiae YHR211w FLO5 member of the
           FLO1P family of flocculation proteins, hypothetical
           start
          Length = 550

 Score =  102 bits (254), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 74/116 (63%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           S YST+VTTFTG++G+PT  TIYYVETP     +TV                    GS+G
Sbjct: 403 SMYSTDVTTFTGTNGLPTINTIYYVETPEVEVSTTVVTPWTGAITSTYSTDVTTITGSNG 462

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +PT +TIY+V+TP +   +T +T WTG  TSTYSTD+ T TG+DGI T ET Y+VE
Sbjct: 463 IPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVE 518

 Score = 99.4 bits (246), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 72/116 (62%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           ST +TE++T TG+DGV T +TIY+VETP F T ST +                   GSDG
Sbjct: 313 STIATELSTTTGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDG 372

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VPT  TIYYVETP V   +T +T WTG   S YSTDV T TGT+G+ T  T+Y+VE
Sbjct: 373 VPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYVE 428

 Score = 84.0 bits (206), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 63/99 (63%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST+VTT TGS+G+PT +TIY+V+TP   T +TV+                   GSDG
Sbjct: 448 STYSTDVTTITGSNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDG 507

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLT 176
           +PT ET YYVE P V+  +T +T WTG +TSTYST+  T
Sbjct: 508 IPTVETKYYVEFPQVDPTTTVFTPWTGTFTSTYSTEFTT 546

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 64/105 (60%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G DG+ T +TIY+VETP    ++TV+                   G+DG+ T +TIY+VE
Sbjct: 234 GKDGIKTVKTIYHVETPEVDQKTTVFTPWTGTITSTFATDVTTTTGADGIETVKTIYHVE 293

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP V+  +T +T WTG  TST +T++ T TG DG++T +T+Y VE
Sbjct: 294 TPEVDQKTTVFTPWTGTITSTIATELSTTTGADGVETVKTIYHVE 338

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 66/105 (62%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G+DGVPT +TIY+VETP    ++TV+                   G DG+ T +TIY+VE
Sbjct: 189 GADGVPTVKTIYHVETPEVDQKTTVFTPWTGTITSTFATDVTTTTGKDGIKTVKTIYHVE 248

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP V+  +T +T WTG  TST++TDV T TG DGI+T +T+Y VE
Sbjct: 249 TPEVDQKTTVFTPWTGTITSTFATDVTTTTGADGIETVKTIYHVE 293

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 61/105 (58%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G +G  +   +  VETP   T +TV+                   G+DGVPT +TIY+VE
Sbjct: 144 GQNGGTSPGNLVVVETPEVQTATTVFTPWTGVSTVTIATDLTTTTGADGVPTVKTIYHVE 203

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP V+  +T +T WTG  TST++TDV T TG DGI+T +T+Y VE
Sbjct: 204 TPEVDQKTTVFTPWTGTITSTFATDVTTTTGKDGIKTVKTIYHVE 248

>Kwal_5.492
          Length = 894

 Score =  100 bits (250), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 75/116 (64%), Gaps = 2/116 (1%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 374 STYSTGLSTFTGEDGKTTTQTIYYVETPTAG--STEVTGWTGTYTSTYSTGQSFFTGEDG 431

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP + +VSTT+T W GR++STYST V T+TG+DG  T ETLYFV+
Sbjct: 432 KTTTQTVYYVETPTLGLVSTTFTGWKGRFSSTYSTGVTTVTGSDGNPTVETLYFVK 487

 Score = 91.7 bits (226), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 71/116 (61%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 117 STYSTGLSTFTGEDGKTTTQTIYYVETPTAG--STEVTGWTGTFTSTYSTGLSTFTGEDG 174

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     ST+YT WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 175 KTTTQTVYYVETPTAG--STSYTGWTGTHTSTYSTGLSTFTGEDGKTTTQTVYYVE 228

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETPT  + S  Y                   G DG
Sbjct: 31  STYSTGLSTFTGEDGKTTTQTVYYVETPTSGSNS--YTGWTGTYTSTYSTGLSTFTGEDG 88

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 89  KTTTQTVYYVETPTAG--STEVTGWTGSFTSTYSTGLSTFTGEDGKTTTQTIYYVE 142

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 69/116 (59%), Gaps = 5/116 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETP  A+ S  +                     DG
Sbjct: 203 STYSTGLSTFTGEDGKTTTQTVYYVETPAEASTSQTHWTGSYTSTYSTAVTTYTI---DG 259

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VPTT TIYYVETP     ST  T WTG +TSTYST + T  G DG  TT+T+Y+VE
Sbjct: 260 VPTTRTIYYVETPTAG--STEMTGWTGSFTSTYSTGLSTFIGEDGKTTTQTVYYVE 313

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 68/116 (58%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TF G DG  TT+T+YYVETPT    ST                     G DG
Sbjct: 288 STYSTGLSTFIGEDGKTTTQTVYYVETPTAG--STEVTGWTGSFTSTYSTGLSTFTGEDG 345

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVET  +   ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 346 KTTTQTVYYVET--LTAGSTEVTGWTGSFTSTYSTGLSTFTGEDGKTTTQTIYYVE 399

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 36/65 (55%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TT+T+YYVETPT    ST +                   GSDG PT ET+Y+
Sbjct: 426 FTGEDGKTTTQTVYYVETPTLGLVSTTFTGWKGRFSSTYSTGVTTVTGSDGNPTVETLYF 485

Query: 147 VETPV 151
           V+TPV
Sbjct: 486 VKTPV 490

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/31 (70%), Positives = 25/31 (80%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFA 108
           STYST VTT TGSDG PT ET+Y+V+TP  A
Sbjct: 462 STYSTGVTTVTGSDGNPTVETLYFVKTPVSA 492

>Kwal_56.22278
          Length = 162

 Score = 91.3 bits (225), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 61/120 (50%), Positives = 72/120 (60%), Gaps = 4/120 (3%)

Query: 74  VLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXX 133
           V   +TYST  TTFTGSDG  TT+TIYYVETP  A  ST Y                   
Sbjct: 17  VSAATTYSTGATTFTGSDGKTTTQTIYYVETP--AIVSTQYTAGSVSAATTYSTGATTFT 74

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           GSDG  TT+TIYYVETP   +VST YT+ +    +TYST   T TG+DG  TT+T+Y+VE
Sbjct: 75  GSDGKTTTQTIYYVETPA--IVSTEYTAGSVSAATTYSTGATTFTGSDGKTTTQTIYYVE 132

 Score = 67.8 bits (164), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 51/88 (57%), Gaps = 4/88 (4%)

Query: 74  VLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXX 133
           V   +TYST  TTFTGSDG  TT+TIYYVETP  A  ST Y                   
Sbjct: 60  VSAATTYSTGATTFTGSDGKTTTQTIYYVETP--AIVSTEYTAGSVSAATTYSTGATTFT 117

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTS 161
           GSDG  TT+TIYYVETP   +VST YT+
Sbjct: 118 GSDGKTTTQTIYYVETPA--IVSTEYTA 143

>Kwal_55.19504
          Length = 391

 Score = 95.9 bits (237), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 62/118 (52%), Positives = 78/118 (66%), Gaps = 9/118 (7%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST+++TFTG+DG  TT+T+YYVETPT AT  TV+                   GSDG
Sbjct: 165 STYSTDLSTFTGADGKATTKTVYYVETPTAAT--TVFTPGTGSVTATLSTGSTTFTGSDG 222

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYST--DVLTLTGTDGIQTTETLYFVE 193
            PTT+T+YYVETP     S  YT WTG +TSTYST  DV+T+   DG+ TT+T+Y+VE
Sbjct: 223 KPTTQTVYYVETPSSG--SNVYTPWTGSFTSTYSTAIDVVTI---DGVATTKTVYYVE 275

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 99/202 (49%), Gaps = 21/202 (10%)

Query: 1   MVSQLLRLSTMLRPQPSPLRAL---CTPHGLVPRPPPSLLTCLHSLALTVFQLPRPXXXX 57
           M  QL+ L  + R   S L  +   CT HGLV   PP      HS  L+ F         
Sbjct: 1   MSLQLMALPRLRRSTTSKLHQVALTCTLHGLVASRPP------HSTDLSTFT--GADGKP 52

Query: 58  XXXXXXXXXXXXXXXXVLRPSTYS------TEVTTFTGSDGVPTTETIYYVETPTFATQS 111
                           V  P T S      T  TTFTGSDG PTT+T+YYVETPT AT  
Sbjct: 53  TTKTVYYVETPTAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVETPTAAT-- 110

Query: 112 TVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYS 171
           TV+                   GSDG PTT+T+YYVETP     S  YT WTG +TSTYS
Sbjct: 111 TVFTPGTGSVTATLSTGTTTFTGSDGKPTTKTVYYVETPSSG--SNVYTPWTGSFTSTYS 168

Query: 172 TDVLTLTGTDGIQTTETLYFVE 193
           TD+ T TG DG  TT+T+Y+VE
Sbjct: 169 TDLSTFTGADGKATTKTVYYVE 190

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 64/110 (58%), Gaps = 5/110 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST +   T  DGV TT+T+YYVETP  ++ S VY                   G+DG
Sbjct: 251 STYSTAIDVVT-IDGVATTKTVYYVETP--SSGSNVYTPWTGSYTSTYSTDLSTFTGADG 307

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTE 187
            PTT+T+YYVETP     S  YT WTG +TSTYSTD+ T TG DG  TT 
Sbjct: 308 KPTTKTVYYVETPSSG--SNVYTPWTGSFTSTYSTDLSTFTGADGKPTTN 355

>Kwal_45.16512
          Length = 277

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 71/116 (61%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 116 STYSTGLSTFTGEDGKTTTQTIYYVETPTVG--STEVTGWTGSFTSTYSTGLSTFTGEDG 173

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT++IYYVETP     ST+YT WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 174 KTTTQSIYYVETPTGG--STSYTGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVE 227

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 70/116 (60%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT++IYYVETPT    ST Y                   G DG
Sbjct: 159 STYSTGLSTFTGEDGKTTTQSIYYVETPTGG--STSYTGWTGTFTSTYSTGVSTFTGEDG 216

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     ST  T WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 217 KTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVE 270

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 68/116 (58%), Gaps = 5/116 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST VTT+   DGV TT TIYYVETPT    ST                     G DG
Sbjct: 74  STYSTAVTTYI-IDGVATTRTIYYVETPTAG--STEVTGWTGTFTSTYSTGLSTFTGEDG 130

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYVETP V   ST  T WTG +TSTYST + T TG DG  TT+++Y+VE
Sbjct: 131 KTTTQTIYYVETPTVG--STEVTGWTGSFTSTYSTGLSTFTGEDGKTTTQSIYYVE 184

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+T+YYVETPT    ST                     G DG
Sbjct: 202 STYSTGVSTFTGEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDG 259

Query: 138 VPTTETIYYVETP 150
             TT+T+YYVETP
Sbjct: 260 KTTTQTVYYVETP 272

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 25/29 (86%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPT 106
           STYST V+TFTG DG  TT+T+YYVETPT
Sbjct: 245 STYSTGVSTFTGEDGKTTTQTVYYVETPT 273

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 164 GRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           G YTSTYST V T    DG+ TT T+Y+VE
Sbjct: 70  GSYTSTYSTAVTTYI-IDGVATTRTIYYVE 98

>Kwal_38.16381
          Length = 257

 Score = 91.7 bits (226), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 70/116 (60%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETPT    ST                     G DG
Sbjct: 117 STYSTGLSTFTGEDGKTTTQTVYYVETPTVG--STEMTGWTGSYTSTYSTGLSTFTGEDG 174

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     ST+YT WTG + STYST V T TG DG  TT+T+Y+VE
Sbjct: 175 KTTTQTVYYVETPTAG--STSYTGWTGTFASTYSTGVSTFTGEDGKTTTQTIYYVE 228

 Score = 91.3 bits (225), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 71/116 (61%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+T+YYVETPT  T +T                     G DG
Sbjct: 74  STYSTGVSTFTGEDGKTTTQTVYYVETPT--TGATEVTGWTGSYTSTYSTGLSTFTGEDG 131

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP V   ST  T WTG YTSTYST + T TG DG  TT+T+Y+VE
Sbjct: 132 KTTTQTVYYVETPTVG--STEMTGWTGSYTSTYSTGLSTFTGEDGKTTTQTVYYVE 185

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 58/103 (56%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG  TT+T+YYVETPT    ST                     G DG  TT+T+YYVETP
Sbjct: 44  DGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVETP 101

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T  T WTG YTSTYST + T TG DG  TT+T+Y+VE
Sbjct: 102 TTG--ATEVTGWTGSYTSTYSTGLSTFTGEDGKTTTQTVYYVE 142

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 48/85 (56%), Gaps = 4/85 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETPT    ST Y                   G DG
Sbjct: 160 STYSTGLSTFTGEDGKTTTQTVYYVETPTAG--STSYTGWTGTFASTYSTGVSTFTGEDG 217

Query: 138 VPTTETIYYVETPVVNVVSTTYTSW 162
             TT+TIYYVETPV    ST+ T W
Sbjct: 218 KTTTQTIYYVETPV--EASTSQTQW 240

>Kwal_55.19513
          Length = 320

 Score = 91.3 bits (225), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 61/120 (50%), Positives = 72/120 (60%), Gaps = 4/120 (3%)

Query: 74  VLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXX 133
           V   +TYST  TTFTGSDG  TT+TIYYVETP  A  ST Y                   
Sbjct: 17  VSAATTYSTGATTFTGSDGKTTTQTIYYVETP--AIVSTQYTAGSVSAATTYSTGATTFT 74

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           GSDG  TT+TIYYVETP   +VST YT+ +    +TYST   T TG+DG  TT+T+Y+VE
Sbjct: 75  GSDGKTTTQTIYYVETPA--IVSTEYTAGSVSAATTYSTGATTFTGSDGKTTTQTIYYVE 132

 Score = 73.2 bits (178), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 70/120 (58%), Gaps = 4/120 (3%)

Query: 74  VLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXX 133
           V   +TYST  TTFTGSDG  TT+TIYYVETP  A  ST Y                   
Sbjct: 103 VSAATTYSTGATTFTGSDGKTTTQTIYYVETP--AIVSTEYTAGSVTATTTYSTGASTFT 160

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           GSDG  TT+TIYYVETP     +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 161 GSDGKTTTQTIYYVETP--TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 218

 Score = 60.8 bits (146), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 66/111 (59%), Gaps = 4/111 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +TYST  +TFTGSDG  TT+TIYYVETPT AT  TV+                   GSDG
Sbjct: 150 TTYSTGASTFTGSDGKTTTQTIYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDG 207

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTET 188
            PTT+T+YYVETP     +T +T   G  T+T ST   T TG+DG  TT+T
Sbjct: 208 KPTTQTVYYVETP--TAATTVFTPGMGSVTATLSTGTTTFTGSDGKPTTQT 256

>Kwal_38.16372
          Length = 501

 Score = 93.2 bits (230), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTGSDG  TT+TIYYVETPT AT  TV+                   G+DG PTT+T+YY
Sbjct: 330 FTGSDGKTTTQTIYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGADGKPTTKTVYY 387

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+  + S+ +T WTG++TSTYST     TG+DGI +T+T+Y++E
Sbjct: 388 VETPI--LASSVFTRWTGKFTSTYSTSYAAFTGSDGIVSTQTVYYIE 432

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTGSDG PTT+T+YYVETPT AT  TV+                   GSDG PTT+T+YY
Sbjct: 30  FTGSDGKPTTQTVYYVETPTAAT--TVFIPGTGSVTATLSTGTTTFTGSDGKPTTKTVYY 87

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP     S  YT WTG +TSTYSTD+ T TG DG  TT+T+Y+VE
Sbjct: 88  VETPSSG--SNVYTPWTGSFTSTYSTDLSTFTGADGKATTKTVYYVE 132

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/118 (52%), Positives = 78/118 (66%), Gaps = 9/118 (7%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST+++TFTG+DG  TT+T+YYVETPT AT  TV+                   GSDG
Sbjct: 107 STYSTDLSTFTGADGKATTKTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDG 164

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYST--DVLTLTGTDGIQTTETLYFVE 193
            PTT+T+YYVETP     S  YT WTG +TSTYST  DV+T+   DG+ TT+T+Y+VE
Sbjct: 165 KPTTQTVYYVETPSSG--SNVYTPWTGSFTSTYSTAIDVVTI---DGVATTKTVYYVE 217

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 72/116 (62%), Gaps = 5/116 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST +   T  DGV TT+T+YYVETP  ++ S VY                   G+DG
Sbjct: 193 STYSTAIDVVT-IDGVATTKTVYYVETP--SSGSNVYTPWTGSFTSTYSTDLSTFTGADG 249

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            PTT+T+YYVETP +   S  YT WTG +TSTYSTD+ T TG DG  TT+T+Y+VE
Sbjct: 250 KPTTKTVYYVETPSIG--SNVYTPWTGSFTSTYSTDLSTFTGADGKPTTQTVYYVE 303

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G+DG PTT+T+YYVETP  A  S+V+                   GSDG+ +T+T+YY+E
Sbjct: 375 GADGKPTTKTVYYVETPILA--SSVFTRWTGKFTSTYSTSYAAFTGSDGIVSTQTVYYIE 432

Query: 149 TPV 151
           TPV
Sbjct: 433 TPV 435

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFA 108
           STYST    FTGSDG+ +T+T+YY+ETP  A
Sbjct: 407 STYSTSYAAFTGSDGIVSTQTVYYIETPVSA 437

>Kwal_27.12860
          Length = 262

 Score = 89.7 bits (221), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 70/116 (60%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETPT  T S  Y                   G DG
Sbjct: 31  STYSTGLSTFTGEDGKTTTQTVYYVETPT--TGSNSYTGWTGTFTSTYSTGVSTFTGEDG 88

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 89  KTTTQTVYYVETPTAG--STEVTGWTGSFTSTYSTGLSTFTGEDGKTTTQTIYYVE 142

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+T+YYVETPT    ST                     G DG
Sbjct: 74  STYSTGVSTFTGEDGKTTTQTVYYVETPTAG--STEVTGWTGSFTSTYSTGLSTFTGEDG 131

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYVETP     ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 132 KTTTQTIYYVETPTAG--STEMTGWTGSFTSTYSTGLSTFTGEDGKTTTQTIYYVE 185

 Score = 87.8 bits (216), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 117 STYSTGLSTFTGEDGKTTTQTIYYVETPTAG--STEMTGWTGSFTSTYSTGLSTFTGEDG 174

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYVETP     ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 175 KTTTQTIYYVETPTAG--STEMTGWTGSFTSTYSTGLSTFTGEDGKTTTQTIYYVE 228

 Score = 77.8 bits (190), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 60/105 (57%), Gaps = 4/105 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 160 STYSTGLSTFTGEDGKTTTQTIYYVETPTAG--STEMTGWTGSFTSTYSTGLSTFTGEDG 217

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDG 182
             TT+TIYYVETP     ST  T WTG YTSTYST + T TG DG
Sbjct: 218 KTTTQTIYYVETPTAG--STEMTGWTGSYTSTYSTGLSTFTGEDG 260

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 57/99 (57%), Gaps = 4/99 (4%)

Query: 95  TTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNV 154
           TT++IYYVETPT    ST                     G DG  TT+T+YYVETP    
Sbjct: 5   TTQSIYYVETPTAG--STEMKGWTGTFTSTYSTGLSTFTGEDGKTTTQTVYYVETPTTG- 61

Query: 155 VSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            S +YT WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 62  -SNSYTGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVE 99

>Kwal_57.24876
          Length = 279

 Score = 89.7 bits (221), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 70/116 (60%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETPT    ST                     G DG
Sbjct: 139 STYSTGLSTFTGEDGKTTTQTVYYVETPTVG--STEMTGWTGSYTSTYSTGLSTFTGEDG 196

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     ST+YT WTG + STYST V T TG DG  TT+T+Y+VE
Sbjct: 197 KTTTQTVYYVETPTAG--STSYTGWTGTFASTYSTGVSTFTGEDGKTTTQTIYYVE 250

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+T+YYVETPT    ST                     G DG
Sbjct: 53  STYSTGVSTFTGEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDG 110

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     +T  T WTG YTSTYST + T TG DG  TT+T+Y+VE
Sbjct: 111 KTTTQTVYYVETPTTG--ATEVTGWTGSYTSTYSTGLSTFTGEDGKTTTQTVYYVE 164

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 59/105 (56%), Gaps = 4/105 (3%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G DG  TT+T+YYVETPT    ST                     G DG  TT+T+YYVE
Sbjct: 21  GEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVE 78

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP     ST  T WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 79  TPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVE 121

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 48/85 (56%), Gaps = 4/85 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETPT    ST Y                   G DG
Sbjct: 182 STYSTGLSTFTGEDGKTTTQTVYYVETPTAG--STSYTGWTGTFASTYSTGVSTFTGEDG 239

Query: 138 VPTTETIYYVETPVVNVVSTTYTSW 162
             TT+TIYYVETPV    ST+ T W
Sbjct: 240 KTTTQTIYYVETPV--EASTSQTQW 262

>Kwal_38.16376
          Length = 693

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 5/115 (4%)

Query: 79  TYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGV 138
           TYSTE++TFTGSDG PTT+T+YYVETP+ A+   VY                     DGV
Sbjct: 548 TYSTELSTFTGSDGQPTTQTVYYVETPSSASH--VYTPWTGSFTSTYSTAIDVVT-IDGV 604

Query: 139 PTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            TT+T+YY+ETP     S  YT WTG +TSTYSTD+ T TG DG  TT+T+Y+VE
Sbjct: 605 ATTKTVYYIETPSSG--SNVYTPWTGSFTSTYSTDLSTFTGADGKPTTKTVYYVE 657

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 93/198 (46%), Gaps = 18/198 (9%)

Query: 1   MVSQLLRLSTMLRPQPSPLRALCTPHGLVPRPPPSLLTCL-----HSLALTVFQLPRPXX 55
           MV  LL+LST LRPQP     +    G       + L+        +   TV+ +  P  
Sbjct: 259 MVRPLLKLSTTLRPQPHGATEVTGWTGSYTSTYSTGLSTFTGEDGKTTTQTVYYVETPTS 318

Query: 56  XXXXXXXXXXXXXXXXXXVLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYX 115
                                    ST+++TFTG DG  TT+T+YYVETPT    ST   
Sbjct: 319 GSNSYTGWTGTYTSTY---------STDLSTFTGEDGKTTTQTVYYVETPTVG--STEMT 367

Query: 116 XXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVL 175
                             G DG  TT+TIYYVETP     ST+YT WTG +TSTYST + 
Sbjct: 368 GWTGSYTSTYSTGVSTFTGEDGKTTTQTIYYVETPTAG--STSYTGWTGTFTSTYSTGLS 425

Query: 176 TLTGTDGIQTTETLYFVE 193
           T TG DG  TT+T+Y+VE
Sbjct: 426 TFTGEDGKTTTQTIYYVE 443

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 84  VTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTET 143
           ++TFTG DG  TT++IYYVETPT AT  TV+                   GSDG  TT+T
Sbjct: 467 LSTFTGEDGKTTTQSIYYVETPTVAT--TVFTPGTGSVAATFSTGTTTFTGSDGQTTTQT 524

Query: 144 IYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +YYVETP     S  YTSWTG +T TYST++ T TG+DG  TT+T+Y+VE
Sbjct: 525 VYYVETPSSG--SNVYTSWTGSFTYTYSTELSTFTGSDGQPTTQTVYYVE 572

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 68/116 (58%), Gaps = 5/116 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST VTT+   DGV TT TIYYVETPT    ST                     G DG
Sbjct: 74  STYSTAVTTYI-IDGVATTRTIYYVETPTAG--STEVTGWTGTFTSTYSTGLSTFTGEDG 130

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYVETP V   ST  T WTG +TSTYST + T TG DG  TT+++Y+VE
Sbjct: 131 KTTTQTIYYVETPTVG--STEVTGWTGSFTSTYSTGLSTFTGEDGKTTTQSIYYVE 184

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/112 (51%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 116 STYSTGLSTFTGEDGKTTTQTIYYVETPTVG--STEVTGWTGSFTSTYSTGLSTFTGEDG 173

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETL 189
             TT++IYYVETP     ST+YT WTG +TSTYST V T TG DG  TT  L
Sbjct: 174 KTTTQSIYYVETPTGG--STSYTGWTGTFTSTYSTGVSTFTGEDGKTTTVKL 223

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 71/116 (61%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+TIYYVETPT    ST Y                   G DG
Sbjct: 375 STYSTGVSTFTGEDGKTTTQTIYYVETPTAG--STSYTGWTGTFTSTYSTGLSTFTGEDG 432

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYVETP V   ST  T WTG YTSTYST + T TG DG  TT+++Y+VE
Sbjct: 433 KTTTQTIYYVETPTVG--STEVTGWTGTYTSTYSTGLSTFTGEDGKTTTQSIYYVE 486

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 30/32 (93%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFAT 109
           STYST+++TFTG+DG PTT+T+YYVETPT AT
Sbjct: 632 STYSTDLSTFTGADGKPTTKTVYYVETPTAAT 663

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 164 GRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           G YTSTYST V T    DG+ TT T+Y+VE
Sbjct: 70  GSYTSTYSTAVTTYI-IDGVATTRTIYYVE 98

>Kwal_45.16510
          Length = 279

 Score = 89.7 bits (221), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 70/116 (60%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETPT    ST                     G DG
Sbjct: 139 STYSTGLSTFTGEDGKTTTQTVYYVETPTVG--STEMTGWTGSYTSTYSTGLSTFTGEDG 196

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     ST+YT WTG + STYST V T TG DG  TT+T+Y+VE
Sbjct: 197 KTTTQTVYYVETPTAG--STSYTGWTGTFASTYSTGVSTFTGEDGKTTTQTIYYVE 250

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+T+YYVETPT    ST                     G DG
Sbjct: 53  STYSTGVSTFTGEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDG 110

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     +T  T WTG YTSTYST + T TG DG  TT+T+Y+VE
Sbjct: 111 KTTTQTVYYVETPTTG--ATEVTGWTGSYTSTYSTGLSTFTGEDGKTTTQTVYYVE 164

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 59/105 (56%), Gaps = 4/105 (3%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G DG  TT+T+YYVETPT    ST                     G DG  TT+T+YYVE
Sbjct: 21  GEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVE 78

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP     ST  T WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 79  TPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVE 121

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 49/86 (56%), Gaps = 4/86 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETPT    ST Y                   G DG
Sbjct: 182 STYSTGLSTFTGEDGKTTTQTVYYVETPTAG--STSYTGWTGTFASTYSTGVSTFTGEDG 239

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWT 163
             TT+TIYYVETPV    ST+ T WT
Sbjct: 240 KTTTQTIYYVETPV--EASTSQTQWT 263

>Kwal_54.19494
          Length = 450

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 71/116 (61%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+TIYYVETPT    ST Y                   G DG
Sbjct: 10  STYSTGVSTFTGEDGKTTTQTIYYVETPTAG--STSYTGWTGTFTSTYSTGLSTFTGEDG 67

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYVETP V   ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 68  KTTTQTIYYVETPTVG--STEVTGWTGTHTSTYSTGLSTFTGEDGKTTTQTVYYVE 121

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 76/116 (65%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT++IYYVETPT AT  TV+                   GSDG
Sbjct: 310 STYSTGLSTFTGEDGKTTTQSIYYVETPTVAT--TVFTPGTGSVAATFSTGTTTFTGSDG 367

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     S  YTSWTG +TSTYST++ T TG+DG  TT+T+Y+VE
Sbjct: 368 QTTTQTVYYVETPSSG--SNVYTSWTGSFTSTYSTELSTFTGSDGQPTTQTVYYVE 421

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 70/116 (60%), Gaps = 5/116 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETP  A+ S  +                     DG
Sbjct: 96  STYSTGLSTFTGEDGKTTTQTVYYVETPAEASTSQTHWTGSYTSTYSTAVTTYTI---DG 152

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VPTT TIYYVETP     ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 153 VPTTRTIYYVETPTAG--STEVTGWTGSFTSTYSTGLSTFTGEDGKTTTQTIYYVE 206

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 181 STYSTGLSTFTGEDGKTTTQTIYYVETPTAG--STEVTGWTGTFTSTYSTSATTFTGEDG 238

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     ST  T WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 239 KTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKATTQTVYYVE 292

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 59/105 (56%), Gaps = 4/105 (3%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G DG  TT+T+YYVETPT    ST                     G DG  TT+T+YYVE
Sbjct: 235 GEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKATTQTVYYVE 292

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP     +T  T WTG YTSTYST + T TG DG  TT+++Y+VE
Sbjct: 293 TPTTG--ATEVTGWTGSYTSTYSTGLSTFTGEDGKTTTQSIYYVE 335

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/33 (72%), Positives = 30/33 (90%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQ 110
           STYSTE++TFTGSDG PTT+T+YYVETP+ A+ 
Sbjct: 396 STYSTELSTFTGSDGQPTTQTVYYVETPSSASH 428

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/34 (67%), Positives = 26/34 (76%)

Query: 160 TSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           T WTG YTSTYST V T TG DG  TT+T+Y+VE
Sbjct: 2   TGWTGSYTSTYSTGVSTFTGEDGKTTTQTIYYVE 35

>Kwal_10.628
          Length = 450

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 71/116 (61%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+TIYYVETPT    ST Y                   G DG
Sbjct: 10  STYSTGVSTFTGEDGKTTTQTIYYVETPTAG--STSYTGWTGTFTSTYSTGLSTFTGEDG 67

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYVETP V   ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 68  KTTTQTIYYVETPTVG--STEVTGWTGTHTSTYSTGLSTFTGEDGKTTTQTVYYVE 121

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 76/116 (65%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT++IYYVETPT AT  TV+                   GSDG
Sbjct: 310 STYSTGLSTFTGEDGKTTTQSIYYVETPTVAT--TVFTPGTGSVAATFSTGTTTFTGSDG 367

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     S  YTSWTG +TSTYST++ T TG+DG  TT+T+Y+VE
Sbjct: 368 QTTTQTVYYVETPSSG--SNVYTSWTGSFTSTYSTELSTFTGSDGQPTTQTVYYVE 421

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 70/116 (60%), Gaps = 5/116 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETP  A+ S  +                     DG
Sbjct: 96  STYSTGLSTFTGEDGKTTTQTVYYVETPAEASTSQTHWTGSYTSTYSTAVTTYTI---DG 152

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VPTT TIYYVETP     ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 153 VPTTRTIYYVETPTAG--STEVTGWTGSFTSTYSTGLSTFTGEDGKTTTQTIYYVE 206

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 181 STYSTGLSTFTGEDGKTTTQTIYYVETPTAG--STEVTGWTGTFTSTYSTSATTFTGEDG 238

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     ST  T WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 239 KTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKATTQTVYYVE 292

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 59/105 (56%), Gaps = 4/105 (3%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G DG  TT+T+YYVETPT    ST                     G DG  TT+T+YYVE
Sbjct: 235 GEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKATTQTVYYVE 292

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP     +T  T WTG YTSTYST + T TG DG  TT+++Y+VE
Sbjct: 293 TPTTG--ATEVTGWTGSYTSTYSTGLSTFTGEDGKTTTQSIYYVE 335

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/33 (72%), Positives = 30/33 (90%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQ 110
           STYSTE++TFTGSDG PTT+T+YYVETP+ A+ 
Sbjct: 396 STYSTELSTFTGSDGQPTTQTVYYVETPSSASH 428

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/34 (67%), Positives = 26/34 (76%)

Query: 160 TSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           T WTG YTSTYST V T TG DG  TT+T+Y+VE
Sbjct: 2   TGWTGSYTSTYSTGVSTFTGEDGKTTTQTIYYVE 35

>Kwal_45.16514
          Length = 514

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 71/116 (61%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+TIYYVETPT    ST Y                   G DG
Sbjct: 74  STYSTGVSTFTGEDGKTTTQTIYYVETPTAG--STSYTGWTGTFTSTYSTGLSTFTGEDG 131

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYVETP V   ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 132 KTTTQTIYYVETPTVG--STEVTGWTGTHTSTYSTGLSTFTGEDGKTTTQTVYYVE 185

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 76/116 (65%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT++IYYVETPT AT  TV+                   GSDG
Sbjct: 374 STYSTGLSTFTGEDGKTTTQSIYYVETPTVAT--TVFTPGTGSVAATFSTGTTTFTGSDG 431

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     S  YTSWTG +TSTYST++ T TG+DG  TT+T+Y+VE
Sbjct: 432 QTTTQTVYYVETPSSG--SNVYTSWTGSFTSTYSTELSTFTGSDGQPTTQTVYYVE 485

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 70/116 (60%), Gaps = 5/116 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+T+YYVETP  A+ S  +                     DG
Sbjct: 160 STYSTGLSTFTGEDGKTTTQTVYYVETPAEASTSQTHWTGSYTSTYSTAVTTYTI---DG 216

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VPTT TIYYVETP     ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 217 VPTTRTIYYVETPTAG--STEVTGWTGSFTSTYSTGLSTFTGEDGKTTTQTIYYVE 270

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST ++TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 245 STYSTGLSTFTGEDGKTTTQTIYYVETPTAG--STEVTGWTGTFTSTYSTSATTFTGEDG 302

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETP     ST  T WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 303 KTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKATTQTVYYVE 356

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 67/111 (60%), Gaps = 4/111 (3%)

Query: 83  EVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTE 142
           +++TFTG DG  TT+T+YYVETPT    ST                     G DG  TT+
Sbjct: 36  DLSTFTGEDGKTTTQTVYYVETPTVG--STEMTGWTGSYTSTYSTGVSTFTGEDGKTTTQ 93

Query: 143 TIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TIYYVETP     ST+YT WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 94  TIYYVETPTAG--STSYTGWTGTFTSTYSTGLSTFTGEDGKTTTQTIYYVE 142

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 59/105 (56%), Gaps = 4/105 (3%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G DG  TT+T+YYVETPT    ST                     G DG  TT+T+YYVE
Sbjct: 299 GEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKATTQTVYYVE 356

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP     +T  T WTG YTSTYST + T TG DG  TT+++Y+VE
Sbjct: 357 TPTTG--ATEVTGWTGSYTSTYSTGLSTFTGEDGKTTTQSIYYVE 399

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 55/96 (57%), Gaps = 4/96 (4%)

Query: 98  TIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVST 157
           T+YYVETPT  + S  Y                   G DG  TT+T+YYVETP V   ST
Sbjct: 8   TVYYVETPTSGSNS--YTGWTGTYTSTYSTDLSTFTGEDGKTTTQTVYYVETPTVG--ST 63

Query: 158 TYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T WTG YTSTYST V T TG DG  TT+T+Y+VE
Sbjct: 64  EMTGWTGSYTSTYSTGVSTFTGEDGKTTTQTIYYVE 99

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/33 (72%), Positives = 30/33 (90%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQ 110
           STYSTE++TFTGSDG PTT+T+YYVETP+ A+ 
Sbjct: 460 STYSTELSTFTGSDGQPTTQTVYYVETPSSASH 492

>CAGL0I07293g complement(703325..708370) some similarities with
           sp|P32768 Saccharomyces cerevisiae YAR050w FLO1,
           hypothetical start
          Length = 1695

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 439 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 498

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 499 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 554

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 484 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 543

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 544 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 599

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 529 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 588

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 589 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 644

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 574 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 633

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 634 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 689

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 619 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 678

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 679 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 734

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 664 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 723

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 724 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 779

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 709 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 768

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 769 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 824

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 754 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 813

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 814 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 869

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 799 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 858

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 859 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 914

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 844 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 903

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 904 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 959

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 889  NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 948

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
              T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 949  SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 1004

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 934  NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 993

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
              T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 994  SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 1049

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 979  NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 1038

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
              T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 1039 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 1094

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 67/116 (57%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 1024 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 1083

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
              T E IYYV+TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 1084 SETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 1139

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 53/105 (50%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G DG  T +    ++TP     +T +                   GSDG  T E IYYV+
Sbjct: 405 GPDGFDTIKETIIIQTPIEKRTTTKFEGWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 464

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP+ N  +T   +WTG  T+T STD  T TG+DG +T E +Y+V+
Sbjct: 465 TPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ 509

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 40/74 (54%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            +T ST+ +TFTGSDG  T E IYYV+TP   T +TV                    GSDG
Sbjct: 1069 NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDG 1128

Query: 138  VPTTETIYYVETPV 151
              T E IYYV+TP+
Sbjct: 1129 SETIEAIYYVQTPI 1142

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (72%)

Query: 78   STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVY 114
            +T ST+ +TFTGSDG  T E IYYV+TP F + S ++
Sbjct: 1114 NTRSTDFSTFTGSDGSETIEAIYYVQTPIFVSSSDIH 1150

>Kwal_27.12855
          Length = 645

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 71/116 (61%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+T+Y+VETP     ST Y                   G DG
Sbjct: 462 STYSTGVSTFTGEDGKTTTQTVYHVETPIAG--STSYTGWTDSFTSTYSTGVSTFTGEDG 519

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETPV    ST+ T WTG YTSTYST V T TG DG  TT+T+Y+VE
Sbjct: 520 KTTTQTVYYVETPVE--ASTSQTQWTGSYTSTYSTGVSTFTGEDGKTTTQTIYYVE 573

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 68/116 (58%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 376 STYSTGVSTFTGEDGKTTTQTIYYVETPTAG--STEVTGWTGSYTSTYSTGVSTFTGEDG 433

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYVETP     ST  T WTG YTSTYST V T TG DG  TT+T+Y VE
Sbjct: 434 KTTTQTIYYVETPTAG--STEVTGWTGSYTSTYSTGVSTFTGEDGKTTTQTVYHVE 487

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+T+YYVETP  A  ST                     G DG
Sbjct: 505 STYSTGVSTFTGEDGKTTTQTVYYVETPVEA--STSQTQWTGSYTSTYSTGVSTFTGEDG 562

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYVETP     ST  T WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 563 KTTTQTIYYVETPTAG--STEVTGWTGTFTSTYSTGVSTFTGEDGKTTTQTIYYVE 616

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 66/116 (56%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYSTE  T+ G DG   T+ +Y+VETP  AT  T Y                   G DG
Sbjct: 290 STYSTEFITYPGEDGSTFTDIVYHVETPIVAT--TTYSGWTGSETTTVSTELTTFTGEDG 347

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYVETP     ST  T WTG YTSTYST V T TG DG  TT+T+Y+VE
Sbjct: 348 KTTTQTIYYVETPTAG--STEMTGWTGSYTSTYSTGVSTFTGEDGKTTTQTIYYVE 401

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 61/107 (57%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TT+TIYYVETPT    ST                     G DG  TT+TIYY
Sbjct: 342 FTGEDGKTTTQTIYYVETPTAG--STEMTGWTGSYTSTYSTGVSTFTGEDGKTTTQTIYY 399

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP     ST  T WTG YTSTYST V T TG DG  TT+T+Y+VE
Sbjct: 400 VETPTAG--STEVTGWTGSYTSTYSTGVSTFTGEDGKTTTQTIYYVE 444

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 72/135 (53%), Gaps = 19/135 (14%)

Query: 74  VLRPSTYSTEVT---------------TFTGSDGVPTTETIYYVETPTFATQSTVYXXXX 118
           V  P+  STEVT               TFTG DG  TT+TIYYVETPT    ST      
Sbjct: 400 VETPTAGSTEVTGWTGSYTSTYSTGVSTFTGEDGKTTTQTIYYVETPTAG--STEVTGWT 457

Query: 119 XXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLT 178
                          G DG  TT+T+Y+VETP+    ST+YT WT  +TSTYST V T T
Sbjct: 458 GSYTSTYSTGVSTFTGEDGKTTTQTVYHVETPIAG--STSYTGWTDSFTSTYSTGVSTFT 515

Query: 179 GTDGIQTTETLYFVE 193
           G DG  TT+T+Y+VE
Sbjct: 516 GEDGKTTTQTVYYVE 530

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  AT  T Y                   G DG  TTETIY+
Sbjct: 126 FTGEDGKTTTETIYHVETPIVAT--TTYSGWTGSETTTVSTELTTFTGEDGKATTETIYH 183

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   +TTY+ WTG  T+T ST+V T TG DG  TTET+Y VE
Sbjct: 184 VETPIV--ATTTYSGWTGSETTTVSTEVTTFTGEDGKATTETIYHVE 228

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  AT  T Y                   G DG  TTETIY+
Sbjct: 169 FTGEDGKATTETIYHVETPIVAT--TTYSGWTGSETTTVSTEVTTFTGEDGKATTETIYH 226

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   +TTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 227 VETPIV--ATTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 271

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 63/107 (58%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP     ST Y                   G DG  TTETIY+
Sbjct: 40  FTGEDGKTTTETIYHVETPIVV--STTYSGWTGSETTTVSTELTTLTGEDGKTTTETIYH 97

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 98  VETPIV--ASTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 142

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 56/100 (56%), Gaps = 4/100 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 548 STYSTGVSTFTGEDGKTTTQTIYYVETPTAG--STEVTGWTGTFTSTYSTGVSTFTGEDG 605

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTL 177
             TT+TIYYVETP     ST  T WTG +TSTYST  L L
Sbjct: 606 KTTTQTIYYVETPTAG--STEVTGWTGTFTSTYSTRPLYL 643

>Kwal_37.16352
          Length = 338

 Score = 88.2 bits (217), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 65/103 (63%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG PTT+T+YYVETP
Sbjct: 216 DGKPTTQTVYYVETPTAAT--TVFIPGTGSVTATLSTGTTTFTGSDGKPTTKTVYYVETP 273

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                S  YT WTG +TSTYSTD+ T TG DG  TT+T+Y+VE
Sbjct: 274 SSG--SNVYTPWTGSFTSTYSTDLSTFTGADGKATTKTVYYVE 314

 Score = 76.6 bits (187), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 81/194 (41%), Positives = 98/194 (50%), Gaps = 10/194 (5%)

Query: 1   MVSQLLRLSTMLRPQPSPLR-ALCTPHGLVPRPPPSLLTCLHSLALTVFQLPRPXXXXXX 59
           MV QL R  T  R Q   LR   C+   L     PSL   L S  L V QLPR       
Sbjct: 44  MVRQLPRRCTTSRRQ---LRLPPCSLLELALLLQPSLRAPLLSPDLMVRQLPR--RCTTS 98

Query: 60  XXXXXXXXXXXXXXVLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXX 119
                         V  P  YST+++TFTG+DG PTT+T+YYVETPT AT  TV+     
Sbjct: 99  RLHQVALTCTLHGLVASPPPYSTDLSTFTGADGKPTTKTVYYVETPTAAT--TVFTPGTG 156

Query: 120 XXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTG 179
                         GSDG  TT+T+YYVETP     +T +T  TG  T+T ST   T TG
Sbjct: 157 SVTATLSTGTTTFTGSDGRTTTQTVYYVETP--TAATTVFTPGTGSATATLSTGTTTFTG 214

Query: 180 TDGIQTTETLYFVE 193
           +DG  TT+T+Y+VE
Sbjct: 215 SDGKPTTQTVYYVE 228

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETP  ++ S VY                   G+DG  TT+T+YYVETP
Sbjct: 259 DGKPTTKTVYYVETP--SSGSNVYTPWTGSFTSTYSTDLSTFTGADGKATTKTVYYVETP 316

Query: 151 VVNVVSTTYTSWTGRYTST 169
                +T +T  TG  T+T
Sbjct: 317 --TAATTVFTPGTGSVTAT 333

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/32 (71%), Positives = 29/32 (90%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFAT 109
           STYST+++TFTG+DG  TT+T+YYVETPT AT
Sbjct: 289 STYSTDLSTFTGADGKATTKTVYYVETPTAAT 320

>Kwal_40.16456
          Length = 240

 Score = 85.9 bits (211), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 83  FTGEDGKATTETIYHVETPIVA--STTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 140

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETPV   VST+YT+WTG +TSTYST+ +T  G DG   T+ +Y VE
Sbjct: 141 VETPV--SVSTSYTAWTGSFTSTYSTEFITYPGEDGRTFTDIVYHVE 185

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 62/107 (57%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP   + ST Y                   G DG   T+ +Y+
Sbjct: 126 FTGEDGKTTTETIYHVETP--VSVSTSYTAWTGSFTSTYSTEFITYPGEDGRTFTDIVYH 183

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 184 VETPIV--ASTTYSGWTGSDTTTVSTELTTFTGEDGKTTTETIYHVE 228

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYSTE  T+ G DG   T+ +Y+VETP  A  ST Y                   G DG
Sbjct: 160 STYSTEFITYPGEDGRTFTDIVYHVETPIVA--STTYSGWTGSDTTTVSTELTTFTGEDG 217

Query: 138 VPTTETIYYVETPV 151
             TTETIY+VETP+
Sbjct: 218 KTTTETIYHVETPI 231

>Kwal_55.19514
          Length = 765

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/120 (50%), Positives = 72/120 (60%), Gaps = 4/120 (3%)

Query: 74  VLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXX 133
           V   +TYST  TTFTGSDG  TT+TIYYVETP  A  ST Y                   
Sbjct: 577 VSAATTYSTGATTFTGSDGKTTTQTIYYVETP--AIVSTQYTAGSVSAATTYSTGATTFT 634

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           GSDG  TT+TIYYVETP   +VST YT+ +    +TYST   T TG+DG  TT+T+Y+VE
Sbjct: 635 GSDGKTTTQTIYYVETPA--IVSTQYTAGSVSAATTYSTGATTFTGSDGKTTTQTIYYVE 692

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/120 (51%), Positives = 73/120 (60%), Gaps = 4/120 (3%)

Query: 74  VLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXX 133
           V   +TYST  TTFTGSDG  TT+TIYYVETP  A  ST Y                   
Sbjct: 620 VSAATTYSTGATTFTGSDGKTTTQTIYYVETP--AIVSTQYTAGSVSAATTYSTGATTFT 677

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           GSDG  TT+TIYYVETP +  VST YT+ +   T+TYST   T TG+DG  TT+T+Y+VE
Sbjct: 678 GSDGKTTTQTIYYVETPAI--VSTEYTAGSVTATTTYSTGATTFTGSDGKTTTQTIYYVE 735

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/107 (48%), Positives = 63/107 (58%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTGSDG  T +T+YYVETP  AT  T Y                   GSDG  TT+TIYY
Sbjct: 504 FTGSDGQTTIQTVYYVETPAVAT--TEYTGGSVTATTTYSTGATTFTGSDGKTTTQTIYY 561

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP   +VST YT+ +    +TYST   T TG+DG  TT+T+Y+VE
Sbjct: 562 VETPA--IVSTQYTAGSVSAATTYSTGATTFTGSDGKTTTQTIYYVE 606

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 51/88 (57%), Gaps = 4/88 (4%)

Query: 74  VLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXX 133
           V   +TYST  TTFTGSDG  TT+TIYYVETP  A  ST Y                   
Sbjct: 663 VSAATTYSTGATTFTGSDGKTTTQTIYYVETP--AIVSTEYTAGSVTATTTYSTGATTFT 720

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTS 161
           GSDG  TT+TIYYVETP   +VST YT+
Sbjct: 721 GSDGKTTTQTIYYVETPA--IVSTEYTA 746

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 57/105 (54%), Gaps = 4/105 (3%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G+D V T ET+YYVE P   T  T Y                   GSDG  T +T+YYVE
Sbjct: 463 GTDNVVTIETLYYVELPVGTT--TEYTAGSVTATTTYSTGATTFTGSDGQTTIQTVYYVE 520

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP   V +T YT  +   T+TYST   T TG+DG  TT+T+Y+VE
Sbjct: 521 TPA--VATTEYTGGSVTATTTYSTGATTFTGSDGKTTTQTIYYVE 563

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 135 SDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           S G P T  +YY   PV  + S + T+WTG   +TYST + T TGTD + T ETLY+VE
Sbjct: 422 SAGDPATVIVYY---PVTTLSSISATTWTGSTVNTYSTSIYTTTGTDNVVTIETLYYVE 477

>Kwal_40.16444
          Length = 264

 Score = 84.7 bits (208), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 126 FTGEDGKTTTETIYHVETPIVA--STTYSGWTGSETTTVSTEVTTFTGEDGKTTTETIYH 183

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETPV   VST+YT+WTG YTSTYST+ +T  G DG   T+ +Y VE
Sbjct: 184 VETPVS--VSTSYTAWTGSYTSTYSTEFITYPGEDGSTFTDIVYHVE 228

 Score = 75.5 bits (184), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  AT  T Y                   G DG  TTETIY+
Sbjct: 83  FTGEDGKTTTETIYHVETPIVAT--TTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 140

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST+V T TG DG  TTET+Y VE
Sbjct: 141 VETPIV--ASTTYSGWTGSETTTVSTEVTTFTGEDGKTTTETIYHVE 185

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP   + ST Y                   G DG   T+ +Y+
Sbjct: 169 FTGEDGKTTTETIYHVETP--VSVSTSYTAWTGSYTSTYSTEFITYPGEDGSTFTDIVYH 226

Query: 147 VETPVVNVVSTTYTSWTG 164
           VETP+  V STTY+ WTG
Sbjct: 227 VETPI--VASTTYSGWTG 242

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%)

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   +TTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 55  VETPIV--ATTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 99

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (68%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFAT 109
           STYSTE  T+ G DG   T+ +Y+VETP  A+
Sbjct: 203 STYSTEFITYPGEDGSTFTDIVYHVETPIVAS 234

>KLLA0A11935g 1031062..1034418 some similarities with sp|P32768
           Saccharomyces cerevisiae YAR050w FLO1 cell wall protein
           involved in flocculation, hypothetical start
          Length = 1118

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 72/126 (57%), Gaps = 10/126 (7%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFAT-----QSTVYXXXXXXXXXXXXXXXXXX 132
           +TY+TE  TFTG DG PT ETIYYV+TP   T      +T Y                  
Sbjct: 491 TTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTF 550

Query: 133 XGSDGVPTTETIYYVETPVV-----NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTE 187
            G DG PT ETIYYV+TPV      +  +T YTSW G+ T+TY+T+ +T TG DG  T E
Sbjct: 551 TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE 610

Query: 188 TLYFVE 193
           T+Y+V+
Sbjct: 611 TIYYVK 616

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 72/126 (57%), Gaps = 10/126 (7%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFAT-----QSTVYXXXXXXXXXXXXXXXXXX 132
           +TY+TE  TFTG DG PT ETIYYV+TP   T      +T Y                  
Sbjct: 541 TTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTF 600

Query: 133 XGSDGVPTTETIYYVETPVV-----NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTE 187
            G DG PT ETIYYV+TPV      +  +T YTSW G+ T+TY+T+ +T TG DG  T E
Sbjct: 601 TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE 660

Query: 188 TLYFVE 193
           T+Y+V+
Sbjct: 661 TIYYVK 666

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 72/126 (57%), Gaps = 10/126 (7%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFAT-----QSTVYXXXXXXXXXXXXXXXXXX 132
           +TY+TE  TFTG DG PT ETIYYV+TP   T      +T Y                  
Sbjct: 591 TTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTF 650

Query: 133 XGSDGVPTTETIYYVETPVV-----NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTE 187
            G DG PT ETIYYV+TPV      +  +T YTSW G+ T+TY+T+ +T TG DG  T E
Sbjct: 651 TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE 710

Query: 188 TLYFVE 193
           T+Y+V+
Sbjct: 711 TIYYVK 716

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 72/126 (57%), Gaps = 10/126 (7%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFAT-----QSTVYXXXXXXXXXXXXXXXXXX 132
           +TY+TE  TFTG DG PT ETIYYV+TP   T      +T Y                  
Sbjct: 641 TTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTF 700

Query: 133 XGSDGVPTTETIYYVETPVV-----NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTE 187
            G DG PT ETIYYV+TPV      +  +T YTSW G+ T+TY+T+ +T TG DG  T E
Sbjct: 701 TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE 760

Query: 188 TLYFVE 193
           T+Y+V+
Sbjct: 761 TIYYVK 766

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 72/126 (57%), Gaps = 10/126 (7%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFAT-----QSTVYXXXXXXXXXXXXXXXXXX 132
           +TY+TE  TFTG DG PT ETIYYV+TP   T      +T Y                  
Sbjct: 691 TTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTF 750

Query: 133 XGSDGVPTTETIYYVETPVV-----NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTE 187
            G DG PT ETIYYV+TPV      +  +T YTSW G+ T+TY+T+ +T TG DG  T E
Sbjct: 751 TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE 810

Query: 188 TLYFVE 193
           T+Y+V+
Sbjct: 811 TIYYVK 816

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 72/126 (57%), Gaps = 10/126 (7%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFAT-----QSTVYXXXXXXXXXXXXXXXXXX 132
           +TY+TE  TFTG DG PT ETIYYV+TP   T      +T Y                  
Sbjct: 741 TTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTF 800

Query: 133 XGSDGVPTTETIYYVETPVV-----NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTE 187
            G DG PT ETIYYV+TPV      +  +T YTSW G+ T+TY+T+ +T TG DG  T E
Sbjct: 801 TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE 860

Query: 188 TLYFVE 193
           T+Y+V+
Sbjct: 861 TIYYVK 866

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 71/126 (56%), Gaps = 10/126 (7%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFAT-----QSTVYXXXXXXXXXXXXXXXXXX 132
           +TY+TE  TFTG DG PT ETIYYV+TP   T      +T Y                  
Sbjct: 791 TTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTF 850

Query: 133 XGSDGVPTTETIYYVETPVVNVV-----STTYTSWTGRYTSTYSTDVLTLTGTDGIQTTE 187
            G DG PT ETIYYV+TPV         +T YTSWTG Y++T++T V+T+ G DG  T +
Sbjct: 851 TGEDGKPTIETIYYVKTPVEKTTYGHTSTTAYTSWTGEYSTTFATKVVTIIGGDGKPTVK 910

Query: 188 TLYFVE 193
           T+Y V+
Sbjct: 911 TIYSVQ 916

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 71/125 (56%), Gaps = 9/125 (7%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETP----TFATQSTVYXXXXXXXXXXXXXXXXXXX 133
            TY+TE  T TG DG+PT +TIY V+TP    T  T +T Y                   
Sbjct: 442 KTYATETITVTGEDGIPTIKTIYSVKTPEPETTAHTATTTYIKWGGKITTTYATEKVTFT 501

Query: 134 GSDGVPTTETIYYVETPVV-----NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTET 188
           G DG PT ETIYYV+TPV      +  +T YTSW G+ T+TY+T+ +T TG DG  T ET
Sbjct: 502 GEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIET 561

Query: 189 LYFVE 193
           +Y+V+
Sbjct: 562 IYYVK 566

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 71/116 (61%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
            TY+TE  T TG DG+PT +TIY V+TP   T++T Y                   G DG
Sbjct: 352 KTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTETKTYATETITVTGEDG 411

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +PT +TIY V+TP VN  +TTYT WTG  T TY+T+ +T+TG DGI T +T+Y V+
Sbjct: 412 IPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVK 467

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 62/112 (55%)

Query: 82  TEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTT 141
           T V+ +T   G   TE +  V+TP   T +T Y                   G DG+PT 
Sbjct: 266 TTVSEYTNDSGKTVTENVIVVQTPEVHTATTTYTGWTGTETKTYATETITVTGEDGIPTI 325

Query: 142 ETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +TIY V+TP VN  +TTYT WTG  T TY+T+ +T+TG DGI T +T+Y V+
Sbjct: 326 KTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVK 377

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETP 105
           +T++T+V T  G DG PT +TIY V+TP
Sbjct: 891 TTFATKVVTIIGGDGKPTVKTIYSVQTP 918

>Kwal_40.16440
          Length = 523

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 70/116 (60%), Gaps = 5/116 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+TIYYVETPT    ST                     G DG
Sbjct: 375 STYSTGVSTFTGEDGKTTTQTIYYVETPTAG--STEVTGWTGSYTSTYSTGVTTFTGEDG 432

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+T+YYVETPV    ST+ T WTG YTSTYST V T T  DG+ TT T+Y+VE
Sbjct: 433 KTTTQTVYYVETPVE--ASTSQTQWTGSYTSTYSTAVTTYT-IDGVATTRTIYYVE 485

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 68/116 (58%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYSTE  T+ G DG   T+ +Y+VETP  AT  T Y                   G DG
Sbjct: 289 STYSTEFITYPGEDGSTFTDIVYHVETPIVAT--TTYSGWTGSETTTVSTELTTFTGEDG 346

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TT+TIYYV+TP V   ST  TSWTG YTSTYST V T TG DG  TT+T+Y+VE
Sbjct: 347 KTTTQTIYYVKTPTVG--STELTSWTGSYTSTYSTGVSTFTGEDGKTTTQTIYYVE 400

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  AT  T Y                   G DG  TTETIY+
Sbjct: 212 FTGEDGKTTTETIYHVETPIVAT--TTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 269

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETPV   VST+YT+WTG YTSTYST+ +T  G DG   T+ +Y VE
Sbjct: 270 VETPVS--VSTSYTAWTGSYTSTYSTEFITYPGEDGSTFTDIVYHVE 314

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 61/107 (57%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TT+TIYYV+TPT    ST                     G DG  TT+TIYY
Sbjct: 341 FTGEDGKTTTQTIYYVKTPTVG--STELTSWTGSYTSTYSTGVSTFTGEDGKTTTQTIYY 398

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP     ST  T WTG YTSTYST V T TG DG  TT+T+Y+VE
Sbjct: 399 VETPTAG--STEVTGWTGSYTSTYSTGVTTFTGEDGKTTTQTVYYVE 443

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 61/113 (53%), Positives = 70/113 (61%), Gaps = 4/113 (3%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TTFTG DG  TTETIY+VETP  A  ST Y                   G DG  T
Sbjct: 34  STELTTFTGEDGKTTTETIYHVETPIVA--STTYSGWTGSETTTVSTELTTFTGEDGKAT 91

Query: 141 TETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TETIY+VETP+  V STTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 92  TETIYHVETPI--VASTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 142

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 64/111 (57%), Gaps = 5/111 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST VTTFTG DG  TT+T+YYVETP  A+ S                        DG
Sbjct: 418 STYSTGVTTFTGEDGKTTTQTVYYVETPVEASTSQTQWTGSYTSTYSTAVTTYTI---DG 474

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTET 188
           V TT TIYYVETP V   ST  T WTG +TSTYST + T TG DG  TT+T
Sbjct: 475 VATTRTIYYVETPTVG--STEVTGWTGSFTSTYSTGLSTFTGEDGKTTTQT 523

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 126 FTGEDGKTTTETIYHVETPIVA--STTYSGWTGSETTTVSTELTTLTGEDGKTTTETIYH 183

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 184 VETPIV--ASTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 228

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 65/107 (60%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 83  FTGEDGKATTETIYHVETPIVA--STTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 140

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST++ TLTG DG  TTET+Y VE
Sbjct: 141 VETPIV--ASTTYSGWTGSETTTVSTELTTLTGEDGKTTTETIYHVE 185

>Kwal_47.16796
          Length = 209

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 58/96 (60%), Gaps = 4/96 (4%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 83  FTGEDGKATTETIYHVETPIVA--STTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 140

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDG 182
           VETPV   VST+YT+WTG +TSTYST+ +T  G DG
Sbjct: 141 VETPV--SVSTSYTAWTGSFTSTYSTEFITYPGEDG 174

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 44/60 (73%), Gaps = 2/60 (3%)

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           G DG  TTETIY+VETP+V   STTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 85  GEDGKATTETIYHVETPIV--ASTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 142

>Kwal_47.16813
          Length = 339

 Score = 82.4 bits (202), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 67/111 (60%), Gaps = 4/111 (3%)

Query: 83  EVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTE 142
            VTTFTG DG  TTETIY+VETP  A  ST Y                   G DG  TTE
Sbjct: 123 RVTTFTGEDGKTTTETIYHVETPIVA--STTYSGWTGSETTTVSTELTTFTGEDGKTTTE 180

Query: 143 TIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TIY+VETP+V   +TTY+ WTG  T+T ST+V T TG DG  TTET+Y VE
Sbjct: 181 TIYHVETPIV--ATTTYSGWTGSETTTVSTEVTTFTGEDGKATTETIYHVE 229

 Score = 70.9 bits (172), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 59/101 (58%), Gaps = 4/101 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  AT  T Y                   G DG  TTETIY+
Sbjct: 170 FTGEDGKTTTETIYHVETPIVAT--TTYSGWTGSETTTVSTEVTTFTGEDGKATTETIYH 227

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTE 187
           VETP+  V STTY+ WTG  T+T ST++ T TG DG  TTE
Sbjct: 228 VETPI--VASTTYSGWTGSETTTVSTELTTFTGEDGKTTTE 266

>KLLA0C19162g 1705537..1706838 weakly similar to sp|P32768
           Saccharomyces cerevisiae YAR050w FLO1 cell wall protein
           involved in flocculation, hypothetical start
          Length = 433

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 72/116 (62%), Gaps = 1/116 (0%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T  TE  T TGSDG+PT +TIY VETP   T +T Y                   GS+G
Sbjct: 15  NTIGTETVTETGSDGIPTVKTIYTVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSNG 74

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +PT +T+Y V+TP  + + T+YT WTG YTST+ST+V+T TG+ G+ T +T+Y VE
Sbjct: 75  IPTVKTVYTVKTP-EDDIETSYTGWTGTYTSTHSTEVVTSTGSGGVLTEKTVYHVE 129

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 1/116 (0%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T  TE  T TGS+G+PT +T+Y V+TP    + T Y                   GS G
Sbjct: 60  NTIGTETVTETGSNGIPTVKTVYTVKTPEDDIE-TSYTGWTGTYTSTHSTEVVTSTGSGG 118

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           V T +T+Y+VETP V   S  YT WTG++TST++T+ +T TG+DGI T +T+Y V+
Sbjct: 119 VLTEKTVYHVETPEVRTASIEYTHWTGKFTSTHATETVTETGSDGIPTIKTIYHVQ 174

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 42/73 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           ST+STEV T TGS GV T +T+Y+VETP   T S  Y                   GSDG
Sbjct: 104 STHSTEVVTSTGSGGVLTEKTVYHVETPEVRTASIEYTHWTGKFTSTHATETVTETGSDG 163

Query: 138 VPTTETIYYVETP 150
           +PT +TIY+V+TP
Sbjct: 164 IPTIKTIYHVQTP 176

>AFL092C [3101] [Homologous to ScYHR211W (FLO5) - NSH]
           (269106..271913) [2808 bp, 935 aa]
          Length = 935

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 60/104 (57%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           GSDG+ TTETIY+V TP     +T                     G+DG+ TTETIY+V 
Sbjct: 408 GSDGIATTETIYHVVTPEAQAVTTTTRGWAGNHTTTLSTAVATVTGTDGIATTETIYHVV 467

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
           TP    V+TT   W G +T+T ST V T+TGTDGI TTET+Y V
Sbjct: 468 TPEAQAVTTTTRGWAGNHTTTLSTAVATVTGTDGIATTETIYHV 511

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 38/72 (52%)

Query: 79  TYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGV 138
           T ST V T TG+DG+ TTETIY+V TP     +T                     G+DG+
Sbjct: 443 TLSTAVATVTGTDGIATTETIYHVVTPEAQAVTTTTRGWAGNHTTTLSTAVATVTGTDGI 502

Query: 139 PTTETIYYVETP 150
            TTETIY+V TP
Sbjct: 503 ATTETIYHVVTP 514

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 63/114 (55%)

Query: 79  TYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGV 138
           T ST V T TG+DG  T ET YYV TP     +T                     G DG+
Sbjct: 308 TLSTGVATVTGTDGYGTIETTYYVVTPEAVVSTTTTSGWTGTHTTTLSTGLTTVTGPDGI 367

Query: 139 PTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            TTET YYV TP    V+TT + WTG +T+T ST V T+TG+DGI TTET+Y V
Sbjct: 368 ATTETTYYVVTPEAQAVTTTTSGWTGSFTTTMSTGVTTVTGSDGIATTETIYHV 421

>CAGL0E06600g 658198..661095 some similarities with sp|P38894
           Saccharomyces cerevisiae YHR211w FLO5, hypothetical
           start
          Length = 965

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 65/118 (55%)

Query: 76  RPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGS 135
           + +T  T++ TFTG DG  T ETI+ VETP  +T +T Y                    S
Sbjct: 401 KTTTVETQLNTFTGKDGKETIETIFIVETPVISTATTKYTLGKGSATTTVNTEYTTDIDS 460

Query: 136 DGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           DG  T + IY+VETP V + ST  T+ T  +T+T +T++ +  G DG QT ET+Y VE
Sbjct: 461 DGKETVKAIYFVETPAVYISSTMITNGTNSHTTTINTEIRSFVGVDGKQTIETIYLVE 518

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 60/115 (52%)

Query: 79  TYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGV 138
           T ST+V T TG+DG  T +  YYV+TP     ST +                   G DG 
Sbjct: 359 TASTKVETKTGNDGSVTEQFTYYVKTPATRLASTQFSLGKGSKTTTVETQLNTFTGKDGK 418

Query: 139 PTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            T ETI+ VETPV++  +T YT   G  T+T +T+  T   +DG +T + +YFVE
Sbjct: 419 ETIETIFIVETPVISTATTKYTLGKGSATTTVNTEYTTDIDSDGKETVKAIYFVE 473

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 27/61 (44%)

Query: 90  SDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVET 149
           SDG  T + IY+VETP     ST+                    G DG  T ETIY VET
Sbjct: 460 SDGKETVKAIYFVETPAVYISSTMITNGTNSHTTTINTEIRSFVGVDGKQTIETIYLVET 519

Query: 150 P 150
           P
Sbjct: 520 P 520

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 79  TYSTEVTTFTGSDGVPTTETIYYVETPT 106
           T +TE+ +F G DG  T ETIY VETPT
Sbjct: 494 TINTEIRSFVGVDGKQTIETIYLVETPT 521

>KLLA0C19316g 1722987..1725086 weakly similar to sp|P32768
           Saccharomyces cerevisiae YAR050w FLO1 cell wall protein
           involved in flocculation, start by similarity
          Length = 699

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T  TE  T TGSDG+PT +TI+ VETP   T +T+Y                   GSDG
Sbjct: 303 NTIGTETVTETGSDGIPTVKTIFTVETPEVQTDTTIYTPWTGATTNTIGTETVTETGSDG 362

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +PT +TIY VETP     +T YT WTG  ++T  T+ +T TG+D I T +T++ VE
Sbjct: 363 IPTVKTIYTVETPEGQTATTVYTPWTGTTSNTIGTETVTETGSDDIPTIKTIFTVE 418

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 67/116 (57%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T  TE  T TGSDG+PT +TIY VETP   T +TVY                   GSD 
Sbjct: 348 NTIGTETVTETGSDGIPTVKTIYTVETPEGQTATTVYTPWTGTTSNTIGTETVTETGSDD 407

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +PT +TI+ VETP V   +T Y+ WTG  T T  ++ +T TG++GI T +T++ VE
Sbjct: 408 IPTIKTIFTVETPEVQTATTEYSGWTGSATQTIGSETVTETGSNGIPTVKTIFTVE 463

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 64/108 (59%)

Query: 86  TFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIY 145
           T TGSDG+PT +TIY VETP   T +T Y                   GSDG+PT +TI+
Sbjct: 266 TETGSDGIPTIKTIYTVETPEVQTATTTYTPWTGATSNTIGTETVTETGSDGIPTVKTIF 325

Query: 146 YVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            VETP V   +T YT WTG  T+T  T+ +T TG+DGI T +T+Y VE
Sbjct: 326 TVETPEVQTDTTIYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVE 373

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 68/115 (59%)

Query: 79  TYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGV 138
           T  TE  T TGS+G+PT +TIY VETP   T +T Y                   GSDG+
Sbjct: 214 TIGTETVTETGSNGIPTIKTIYSVETPEVQTATTEYSGWTGTTTNTIGTETVTETGSDGI 273

Query: 139 PTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           PT +TIY VETP V   +TTYT WTG  ++T  T+ +T TG+DGI T +T++ VE
Sbjct: 274 PTIKTIYTVETPEVQTATTTYTPWTGATSNTIGTETVTETGSDGIPTVKTIFTVE 328

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 49/92 (53%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T  TE  T TGSD +PT +TI+ VETP   T +T Y                   GS+G
Sbjct: 393 NTIGTETVTETGSDDIPTIKTIFTVETPEVQTATTEYSGWTGSATQTIGSETVTETGSNG 452

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTST 169
           +PT +TI+ VETP V   +TTY   TG  +ST
Sbjct: 453 IPTVKTIFTVETPDVQTATTTYIEGTGTDSST 484

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 48/89 (53%)

Query: 105 PTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVSTTYTSWTG 164
           P   T +T Y                   GS+G+PT +TIY VETP V   +T Y+ WTG
Sbjct: 195 PEVQTATTTYAGWTGSATQTIGTETVTETGSNGIPTIKTIYSVETPEVQTATTEYSGWTG 254

Query: 165 RYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T+T  T+ +T TG+DGI T +T+Y VE
Sbjct: 255 TTTNTIGTETVTETGSDGIPTIKTIYTVE 283

>Kwal_27.12846
          Length = 641

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 481 FTGEDGKTTTETIYHVETPIVA--STTYSGWTGSETTTVSTEVTTFTGEDGKATTETIYH 538

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 539 VETPIV--ASTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 583

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 524 FTGEDGKATTETIYHVETPIVA--STTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 581

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   +TTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 582 VETPIV--ATTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 626

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TT+TIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 438 FTGEDGKTTTKTIYHVETPIVA--STTYSGWTGSETTTVSTEVTTFTGEDGKTTTETIYH 495

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST+V T TG DG  TTET+Y VE
Sbjct: 496 VETPIV--ASTTYSGWTGSETTTVSTEVTTFTGEDGKATTETIYHVE 540

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  AT  T Y                   G DG  TT+TIY+
Sbjct: 395 FTGEDGKTTTETIYHVETPIVAT--TTYSGWTGSETTTVSTELTTFTGEDGKTTTKTIYH 452

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST+V T TG DG  TTET+Y VE
Sbjct: 453 VETPIV--ASTTYSGWTGSETTTVSTEVTTFTGEDGKTTTETIYHVE 497

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 62/107 (57%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           F G+DG  T ETIYYV TP  A  ST Y                   G DG  TTETIY+
Sbjct: 309 FQGADGASTIETIYYVATP--AVMSTSYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 366

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 367 VETPIV--ASTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 411

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 59/105 (56%), Gaps = 2/105 (1%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G DG+ TT T+YYV TP   T +T                     G+DG  T ETIYYV 
Sbjct: 266 GDDGIGTTSTLYYVHTPLPTTTTTSMAGWTSSGTSTTFTDVTTFQGADGASTIETIYYVA 325

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP   V+ST+Y+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 326 TPA--VMSTSYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 368

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  AT  T Y                   G DG  TTETIY+
Sbjct: 567 FTGEDGKTTTETIYHVETPIVAT--TTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 624

Query: 147 VETPVVNVVSTTY 159
           VETP+  V STTY
Sbjct: 625 VETPI--VASTTY 635

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVY 114
           FTG DG  TTETIY+VETP  A+ + ++
Sbjct: 610 FTGEDGKTTTETIYHVETPIVASTTYIW 637

>Kwal_47.16820
          Length = 303

 Score = 73.2 bits (178), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  AT  T Y                   G DG  TTETIY+
Sbjct: 126 FTGEDGKTTTETIYHVETPIVAT--TTYSGWTGSETTTVSTEVTTFTGEDGKTTTETIYH 183

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 184 VETPIV--ASTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 228

 Score = 73.2 bits (178), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 169 FTGEDGKTTTETIYHVETPIVA--STTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 226

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   +TTY+ WTG  T+T ST+V T TG DG  TTET+Y VE
Sbjct: 227 VETPIV--ATTTYSGWTGSETTTVSTEVTTFTGEDGKATTETIYHVE 271

 Score = 72.8 bits (177), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 68/116 (58%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYSTE  T+ G DG   T+ +Y+VETP  A  ST Y                   G DG
Sbjct: 31  STYSTEFITYPGEDGSTFTDIVYHVETPIVA--STTYSGWTGSDTTTVSTELTTFTGEDG 88

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TTETIY+VETP+V   STTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 89  KTTTETIYHVETPIV--ASTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 142

 Score = 72.8 bits (177), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 83  FTGEDGKTTTETIYHVETPIVA--STTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 140

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   +TTY+ WTG  T+T ST+V T TG DG  TTET+Y VE
Sbjct: 141 VETPIV--ATTTYSGWTGSETTTVSTEVTTFTGEDGKTTTETIYHVE 185

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/92 (48%), Positives = 51/92 (55%), Gaps = 4/92 (4%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  AT  T Y                   G DG  TTETIY+
Sbjct: 212 FTGEDGKTTTETIYHVETPIVAT--TTYSGWTGSETTTVSTEVTTFTGEDGKATTETIYH 269

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLT 178
           VETP+  V STTY+ WTG  T+T S  + T T
Sbjct: 270 VETPI--VASTTYSGWTGSETTTVSVMLTTFT 299

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/39 (58%), Positives = 29/39 (74%)

Query: 155 VSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VST+YT+WTG YTSTYST+ +T  G DG   T+ +Y VE
Sbjct: 18  VSTSYTAWTGSYTSTYSTEFITYPGEDGSTFTDIVYHVE 56

>Kwal_47.16790
          Length = 647

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  AT  T Y                   G DG  TTETIY+
Sbjct: 487 FTGEDGKTTTETIYHVETPIVAT--TTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 544

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST+V T TG DG  TTET+Y VE
Sbjct: 545 VETPIV--ASTTYSGWTGSETTTVSTEVTTFTGEDGKTTTETIYHVE 589

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 68/116 (58%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYSTE+TT T  +G  T  +IYY+ETP   T S  Y                   G DG
Sbjct: 392 STYSTEITTITDENGAETVRSIYYIETPIVETTS--YSGWTGSETTTVSTELTTFTGEDG 449

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             TTETIY+VETP+V   +TTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 450 KTTTETIYHVETPIV--ATTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 503

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 530 FTGEDGKTTTETIYHVETPIVA--STTYSGWTGSETTTVSTEVTTFTGEDGKTTTETIYH 587

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   STTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 588 VETPIV--ASTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 632

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (52%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +TY + V T TGSDG PT  T+Y+V+ P     ST                     G DG
Sbjct: 302 TTYDSTVFTTTGSDGYPTASTVYFVQVPGTERTSTSAAAWTGSQTSTYSTSVTTSTGPDG 361

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T +T YYV TP     S T  +++G+ TSTYST++ T+T  +G +T  ++Y++E
Sbjct: 362 YETIDTFYYVNTPRSFDQSYTTRAYSGKSTSTYSTEITTITDENGAETVRSIYYIE 417

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           FTG DG  TTETIY+VETP  A  ST Y                   G DG  TTETIY+
Sbjct: 573 FTGEDGKTTTETIYHVETPIVA--STTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYH 630

Query: 147 VETPVVNVVSTTYTSW 162
           VETP+V   +  +  W
Sbjct: 631 VETPIVATTTYFWMDW 646

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 56/113 (49%), Gaps = 1/113 (0%)

Query: 82  TEVTTFTGSDGVPTTETIYYVETPTFATQSTVYX-XXXXXXXXXXXXXXXXXXGSDGVPT 140
           T V+T+T S G  TT  +  VE P   T S+                      GSDG PT
Sbjct: 260 TVVSTYTNSAGQATTGNVVVVEAPVTDTASSASTGRHSGTATTTYDSTVFTTTGSDGYPT 319

Query: 141 TETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             T+Y+V+ P     ST+  +WTG  TSTYST V T TG DG +T +T Y+V 
Sbjct: 320 ASTVYFVQVPGTERTSTSAAAWTGSQTSTYSTSVTTSTGPDGYETIDTFYYVN 372

>KLLA0B00308g complement(18349..19698) weakly similar to sp|P32768
           Saccharomyces cerevisiae YAR050w FLO1 cell wall protein
           involved in flocculation, start by similarity
          Length = 449

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 59/104 (56%)

Query: 90  SDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVET 149
           SDG  TT  +  VETP   T +T Y                   GSDG+PT +TIY VET
Sbjct: 179 SDGSSTTAILVVVETPEVQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVET 238

Query: 150 PVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           P     +T YTSWTG YT+T++T+++T TG DGI T + +Y VE
Sbjct: 239 PEGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPTIKAIYSVE 282

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 79  TYSTEVTTFTGSDGVPTTETIYYVETP 105
           T++TE+ T TG DG+PT + IY VETP
Sbjct: 258 TFATEIVTSTGEDGIPTIKAIYSVETP 284

>Kwal_11.640
          Length = 114

 Score = 66.6 bits (161), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 54/95 (56%), Gaps = 4/95 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST V+TFTG DG  TT+T+YYVETPT    ST                     G DG
Sbjct: 17  STYSTGVSTFTGEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDG 74

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYST 172
             TT+T+YYVETP     +T  T WTG YTSTYST
Sbjct: 75  KTTTQTVYYVETPTTG--ATEVTGWTGSYTSTYST 107

 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 2/60 (3%)

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           G DG  TT+T+YYVETP     ST  T WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 28  GEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVE 85

 Score = 45.4 bits (106), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 29/37 (78%)

Query: 157 TTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           T+YT WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 6   TSYTGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVE 42

>KLLA0C19151g 1702106..1703893 weakly similar to sp|P38894
           Saccharomyces cerevisiae YHR211w FLO5 member of the
           FLO1P family of flocculation proteins, start by
           similarity
          Length = 595

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 65/118 (55%), Gaps = 3/118 (2%)

Query: 79  TYSTEVTT---FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGS 135
           TY+T  TT   +T   G   TE +  VETP   T +T Y                   GS
Sbjct: 261 TYTTSYTTVGEYTDDSGSTVTENVIVVETPEVHTATTEYSGWTGKFTSTYATKVITTTGS 320

Query: 136 DGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +G+PT  TIY VETP V   +T ++ WTG+ T+T+ T+V+T TG+DGI T +++Y VE
Sbjct: 321 NGIPTISTIYSVETPEVQTATTEFSGWTGKVTTTHGTEVVTATGSDGIPTIKSIYSVE 378

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 70/116 (60%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STY+T+V T TGS+G+PT  TIY VETP   T +T +                   GSDG
Sbjct: 308 STYATKVITTTGSNGIPTISTIYSVETPEVQTATTEFSGWTGKVTTTHGTEVVTATGSDG 367

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +PT ++IY VETP V   +T Y+ WTG  T+T  T+ +T TG++GI T +T++ VE
Sbjct: 368 IPTIKSIYSVETPEVQTATTEYSGWTGTTTNTIGTETVTETGSNGIPTIKTIFTVE 423

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 52/98 (53%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T  TE  T TGSDG+PT +TI+ VETP   T +T Y                   GSDG
Sbjct: 488 NTIGTETVTETGSDGIPTIKTIFTVETPEVQTATTEYSGWTGTTTNTIGTETVTETGSDG 547

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVL 175
           +PT +TIY VETP     +T YT WTG  T T  T+ +
Sbjct: 548 IPTVKTIYTVETPEGQTATTAYTPWTGSVTQTIGTETV 585

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 68/116 (58%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           +T  TE  T TGSDG+PT +TI+ VETP   T +T Y                   GSDG
Sbjct: 443 NTIGTETVTETGSDGIPTIKTIFTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDG 502

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +PT +TI+ VETP V   +T Y+ WTG  T+T  T+ +T TG+DGI T +T+Y VE
Sbjct: 503 IPTIKTIFTVETPEVQTATTEYSGWTGTTTNTIGTETVTETGSDGIPTVKTIYTVE 558

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 64/106 (60%)

Query: 88  TGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYV 147
           TGS+G+PT +TI+ VETP   T +T Y                   GSDG+PT +TI+ V
Sbjct: 408 TGSNGIPTIKTIFTVETPEVQTATTTYTPWTGATTNTIGTETVTETGSDGIPTIKTIFTV 467

Query: 148 ETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           ETP V   +TTYT WTG  T+T  T+ +T TG+DGI T +T++ VE
Sbjct: 468 ETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTIKTIFTVE 513

>KLLA0E14586g complement(1290917..1294591) some similarities with
           sp|P38894 Saccharomyces cerevisiae YHR211w FLO5 member
           of the FLO1P family of flocculation proteins,
           hypothetical start
          Length = 1224

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (76%)

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           GSDG+PT +TIY VETP V   +T YT WTG YTST++TD+ T+TG+DGI T  T+Y V+
Sbjct: 312 GSDGIPTVKTIYTVETPEVQTATTVYTGWTGEYTSTFATDLTTVTGSDGIPTITTIYSVK 371

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 35/64 (54%)

Query: 86  TFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIY 145
           T TGSDG+PT +TIY VETP   T +TVY                   GSDG+PT  TIY
Sbjct: 309 TETGSDGIPTVKTIYTVETPEVQTATTVYTGWTGEYTSTFATDLTTVTGSDGIPTITTIY 368

Query: 146 YVET 149
            V+T
Sbjct: 369 SVKT 372

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 23/27 (85%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVET 104
           ST++T++TT TGSDG+PT  TIY V+T
Sbjct: 346 STFATDLTTVTGSDGIPTITTIYSVKT 372

>Kwal_29.12877
          Length = 105

 Score = 65.1 bits (157), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 2/58 (3%)

Query: 136 DGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           DGV TT+T+YYVETP     S  YT WTG +TSTYSTD+ T TG DG  TT+T+Y+VE
Sbjct: 20  DGVATTKTVYYVETPSSG--SNVYTPWTGSFTSTYSTDLSTFTGADGKPTTQTVYYVE 75

 Score = 59.3 bits (142), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 50/85 (58%), Gaps = 5/85 (5%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST +   T  DGV TT+T+YYVETP  ++ S VY                   G+DG
Sbjct: 8   STYSTAIDVVT-IDGVATTKTVYYVETP--SSGSNVYTPWTGSFTSTYSTDLSTFTGADG 64

Query: 138 VPTTETIYYVETPVVNVVSTTYTSW 162
            PTT+T+YYVETP   +VST YT+W
Sbjct: 65  KPTTQTVYYVETPA--IVSTQYTAW 87

>Kwal_18.2697
          Length = 605

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 60/100 (60%), Gaps = 5/100 (5%)

Query: 94  PTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVN 153
           PTT+T+YYVETP  ++ S VY                     DGV TT+T+YYVETP   
Sbjct: 452 PTTQTVYYVETP--SSGSNVYTPWTGSFTSTYSTAIDVVT-IDGVATTKTVYYVETPSSG 508

Query: 154 VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             S  YT WTG +TSTYSTD+ T TG DG  TT+T+Y+VE
Sbjct: 509 --SNVYTPWTGSFTSTYSTDLSTFTGADGKPTTKTVYYVE 546

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 49/73 (67%), Gaps = 2/73 (2%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST+++TFTG+DG PTT+T+YYVETPT AT  TV+                   GSDG
Sbjct: 521 STYSTDLSTFTGADGKPTTKTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDG 578

Query: 138 VPTTETIYYVETP 150
            PTT+T+YYVETP
Sbjct: 579 KPTTQTVYYVETP 591

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 66/146 (45%), Gaps = 48/146 (32%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG PTT+T+YYVETP
Sbjct: 363 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVETP 420

Query: 151 VVNVV-----------------------------------------STTYTSWTGRYTST 169
                                                         S  YT WTG +TST
Sbjct: 421 TAATTVFTPGTGSVTATLSMGTTTFTGTDGKPTTQTVYYVETPSSGSNVYTPWTGSFTST 480

Query: 170 YST--DVLTLTGTDGIQTTETLYFVE 193
           YST  DV+T+   DG+ TT+T+Y+VE
Sbjct: 481 YSTAIDVVTI---DGVATTKTVYYVE 503

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 68/116 (58%), Gaps = 5/116 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST +   T  DGV TT+T+YYVETP  ++ S VY                   G+DG
Sbjct: 479 STYSTAIDVVT-IDGVATTKTVYYVETP--SSGSNVYTPWTGSFTSTYSTDLSTFTGADG 535

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            PTT+T+YYVETP     +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 536 KPTTKTVYYVETP--TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 589

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 19  DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 76

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 77  --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 117

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 105 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 162

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 163 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 203

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 191 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 248

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 249 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 289

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 277 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 334

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 335 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 375

>Kwal_29.12875
          Length = 605

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 60/100 (60%), Gaps = 5/100 (5%)

Query: 94  PTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVN 153
           PTT+T+YYVETP  ++ S VY                     DGV TT+T+YYVETP   
Sbjct: 452 PTTQTVYYVETP--SSGSNVYTPWTGSFTSTYSTAIDVVT-IDGVATTKTVYYVETPSSG 508

Query: 154 VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             S  YT WTG +TSTYSTD+ T TG DG  TT+T+Y+VE
Sbjct: 509 --SNVYTPWTGSFTSTYSTDLSTFTGADGKPTTKTVYYVE 546

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 49/73 (67%), Gaps = 2/73 (2%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST+++TFTG+DG PTT+T+YYVETPT AT  TV+                   GSDG
Sbjct: 521 STYSTDLSTFTGADGKPTTKTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDG 578

Query: 138 VPTTETIYYVETP 150
            PTT+T+YYVETP
Sbjct: 579 KPTTQTVYYVETP 591

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 66/146 (45%), Gaps = 48/146 (32%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG PTT+T+YYVETP
Sbjct: 363 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVETP 420

Query: 151 VVNVV-----------------------------------------STTYTSWTGRYTST 169
                                                         S  YT WTG +TST
Sbjct: 421 TAATTVFTPGTGSVTATLSMGTTTFTGTDGKPTTQTVYYVETPSSGSNVYTPWTGSFTST 480

Query: 170 YST--DVLTLTGTDGIQTTETLYFVE 193
           YST  DV+T+   DG+ TT+T+Y+VE
Sbjct: 481 YSTAIDVVTI---DGVATTKTVYYVE 503

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 68/116 (58%), Gaps = 5/116 (4%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST +   T  DGV TT+T+YYVETP  ++ S VY                   G+DG
Sbjct: 479 STYSTAIDVVT-IDGVATTKTVYYVETP--SSGSNVYTPWTGSFTSTYSTDLSTFTGADG 535

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            PTT+T+YYVETP     +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 536 KPTTKTVYYVETP--TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 589

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 19  DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 76

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 77  --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 117

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 105 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 162

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 163 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 203

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 191 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 248

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 249 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 289

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 277 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 334

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 335 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 375

>Kwal_54.19493
          Length = 134

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 2/58 (3%)

Query: 136 DGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           DGV TT+T+YY+ETP     S  YT WTG +TSTYSTD+ T TG DG  TT+T+Y+VE
Sbjct: 43  DGVATTKTVYYIETPSSG--SNVYTPWTGSFTSTYSTDLSTFTGADGKPTTKTVYYVE 98

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 58/115 (50%), Gaps = 17/115 (14%)

Query: 1   MVSQLLRLSTMLRPQPSPLRALCTPHGLVPRPP----PSLLTCLHSLA--LTVFQLPRPX 54
           MV+Q  RL TMLR     +R   TPHGL   P     P +   +  +A   TV+ +  P 
Sbjct: 1   MVNQPPRLCTMLRLHQ--VRLTSTPHGLAASPQLTPLPLMFVTIDGVATTKTVYYIETPS 58

Query: 55  XXXXXXXXXXXXXXXXXXXVLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFAT 109
                                  STYST+++TFTG+DG PTT+T+YYVETPT AT
Sbjct: 59  SGSNVYTPWTGSFT---------STYSTDLSTFTGADGKPTTKTVYYVETPTAAT 104

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           F   DGV TT+T+YY+ETP  ++ S VY                   G+DG PTT+T+YY
Sbjct: 39  FVTIDGVATTKTVYYIETP--SSGSNVYTPWTGSFTSTYSTDLSTFTGADGKPTTKTVYY 96

Query: 147 VETPVVNVVSTTYTSW 162
           VETP     +T Y  W
Sbjct: 97  VETPT--AATTEYDRW 110

>Kwal_45.16518
          Length = 134

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 2/58 (3%)

Query: 136 DGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           DGV TT+T+YY+ETP     S  YT WTG +TSTYSTD+ T TG DG  TT+T+Y+VE
Sbjct: 43  DGVATTKTVYYIETPSSG--SNVYTPWTGSFTSTYSTDLSTFTGADGKPTTKTVYYVE 98

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 58/115 (50%), Gaps = 17/115 (14%)

Query: 1   MVSQLLRLSTMLRPQPSPLRALCTPHGLVPRPP----PSLLTCLHSLA--LTVFQLPRPX 54
           MV+Q  RL TMLR     +R   TPHGL   P     P +   +  +A   TV+ +  P 
Sbjct: 1   MVNQPPRLCTMLRLHQ--VRLTSTPHGLAASPQLTPLPLMFVTIDGVATTKTVYYIETPS 58

Query: 55  XXXXXXXXXXXXXXXXXXXVLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFAT 109
                                  STYST+++TFTG+DG PTT+T+YYVETPT AT
Sbjct: 59  SGSNVYTPWTGSFT---------STYSTDLSTFTGADGKPTTKTVYYVETPTAAT 104

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           F   DGV TT+T+YY+ETP  ++ S VY                   G+DG PTT+T+YY
Sbjct: 39  FVTIDGVATTKTVYYIETP--SSGSNVYTPWTGSFTSTYSTDLSTFTGADGKPTTKTVYY 96

Query: 147 VETPVVNVVSTTYTSW 162
           VETP     +T Y  W
Sbjct: 97  VETPT--AATTEYDRW 110

>Kwal_10.632
          Length = 134

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 2/58 (3%)

Query: 136 DGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           DGV TT+T+YY+ETP     S  YT WTG +TSTYSTD+ T TG DG  TT+T+Y+VE
Sbjct: 43  DGVATTKTVYYIETPSSG--SNVYTPWTGSFTSTYSTDLSTFTGADGKPTTKTVYYVE 98

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 58/115 (50%), Gaps = 17/115 (14%)

Query: 1   MVSQLLRLSTMLRPQPSPLRALCTPHGLVPRPP----PSLLTCLHSLA--LTVFQLPRPX 54
           MV+Q  RL TMLR     +R   TPHGL   P     P +   +  +A   TV+ +  P 
Sbjct: 1   MVNQPPRLCTMLRLHQ--VRLTSTPHGLAASPQLTPLPLMFVTIDGVATTKTVYYIETPS 58

Query: 55  XXXXXXXXXXXXXXXXXXXVLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFAT 109
                                  STYST+++TFTG+DG PTT+T+YYVETPT AT
Sbjct: 59  SGSNVYTPWTGSFT---------STYSTDLSTFTGADGKPTTKTVYYVETPTAAT 104

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
           F   DGV TT+T+YY+ETP  ++ S VY                   G+DG PTT+T+YY
Sbjct: 39  FVTIDGVATTKTVYYIETP--SSGSNVYTPWTGSFTSTYSTDLSTFTGADGKPTTKTVYY 96

Query: 147 VETPVVNVVSTTYTSW 162
           VETP     +T Y  W
Sbjct: 97  VETPT--AATTEYDRW 110

>Kwal_44.16501
          Length = 130

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 50/94 (53%), Gaps = 4/94 (4%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G DG  TT+T+YYVETPT    ST                     G DG  TT+T+YYVE
Sbjct: 21  GEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVE 78

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDG 182
           TP     ST  T WTG +TSTYST V T TG DG
Sbjct: 79  TPTAG--STEITGWTGTFTSTYSTGVSTFTGEDG 110

 Score = 63.2 bits (152), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 2/60 (3%)

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           G DG  TT+T+YYVETP     ST  T WTG +TSTYST V T TG DG  TT+T+Y+VE
Sbjct: 21  GEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTGEDGKTTTQTVYYVE 78

>Kwal_55.19506
          Length = 533

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 66/105 (62%), Gaps = 9/105 (8%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   G+DG PTT+T+YYVETP
Sbjct: 406 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSMGTTTFTGTDGKPTTQTVYYVETP 463

Query: 151 VVNVVSTTYTSWTGRYTSTYST--DVLTLTGTDGIQTTETLYFVE 193
                S  YT WTG +TSTYST  DV+T+   DG+ TT+T+Y+VE
Sbjct: 464 SSG--SNVYTPWTGSFTSTYSTAIDVVTI---DGVATTKTVYYVE 503

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 19  DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 76

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 77  --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 117

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 105 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 162

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 163 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 203

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 191 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 248

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 249 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 289

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 277 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 334

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 335 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 375

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 94  PTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVN 153
           PTT+T+YYVETP  ++ S VY                     DGV TT+T+YYVETP   
Sbjct: 452 PTTQTVYYVETP--SSGSNVYTPWTGSFTSTYSTAIDVVT-IDGVATTKTVYYVETPSSG 508

Query: 154 VVSTTYTSWTGRYTST 169
             S  YT WTG +TST
Sbjct: 509 --SNVYTPWTGSFTST 522

>Kwal_11.643
          Length = 280

 Score = 67.8 bits (164), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/58 (63%), Positives = 42/58 (72%), Gaps = 2/58 (3%)

Query: 136 DGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           DGVPTT TIYYVETP     ST  T WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 130 DGVPTTRTIYYVETPTAG--STEVTGWTGSFTSTYSTGLSTFTGEDGKTTTQTIYYVE 185

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (72%), Gaps = 2/55 (3%)

Query: 139 PTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           P  +TIYYVETP     ST+YT WTG +TSTYST + T TG DG  TT+T+Y+VE
Sbjct: 4   PPLKTIYYVETPTAG--STSYTGWTGTFTSTYSTGLSTFTGEDGKTTTQTIYYVE 56

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/131 (39%), Positives = 67/131 (51%), Gaps = 34/131 (25%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTF-ATQSTVYXXXXXXXXXXXXXXXXXXXGSD 136
           STYST ++TFTG DG  TT+TIYYVETPT  +T+ T +                   G+ 
Sbjct: 31  STYSTGLSTFTGEDGKTTTQTIYYVETPTVGSTEVTGW------------------TGTH 72

Query: 137 GVPTTETIYY-----VETPVVNVV---------STTYTSWTGRYTSTYSTDVLTLTGTDG 182
               T  +Y      +  P + +          ST+ T WTG YTSTYST V T T  DG
Sbjct: 73  HKHPTPPVYLPLPAKMARPRLKLSTTSRHQLKPSTSQTHWTGSYTSTYSTAVTTYT-IDG 131

Query: 183 IQTTETLYFVE 193
           + TT T+Y+VE
Sbjct: 132 VPTTRTIYYVE 142

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           STYST VTT+T  DGVPTT TIYYVETPT    ST                     G DG
Sbjct: 118 STYSTAVTTYT-IDGVPTTRTIYYVETPTAG--STEVTGWTGSFTSTYSTGLSTFTGEDG 174

Query: 138 VPTTETIYYVETPVVN 153
             TT+TIYYVETP   
Sbjct: 175 KTTTQTIYYVETPTAG 190

>Kwal_27.9651
          Length = 438

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 56/97 (57%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G DG  T ET+YYVETP    +ST Y                   G DG+ TTET+Y+VE
Sbjct: 311 GEDGYQTVETLYYVETPEKKIESTTYTPWTGTFTTTYSTGVSTFTGEDGIATTETVYFVE 370

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQT 185
           TP V   STTYT WTG +T+T+ST V T TG DGI T
Sbjct: 371 TPEVKKESTTYTPWTGTFTTTFSTGVSTFTGEDGIAT 407

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/60 (66%), Positives = 45/60 (75%)

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           G DG  T ET+YYVETP   + STTYT WTG +T+TYST V T TG DGI TTET+YFVE
Sbjct: 311 GEDGYQTVETLYYVETPEKKIESTTYTPWTGTFTTTYSTGVSTFTGEDGIATTETVYFVE 370

>Kwal_28.12868
          Length = 429

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 56/97 (57%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
           G DG  T ET+YYVETP    +ST Y                   G DG+ TTET+Y+VE
Sbjct: 311 GEDGYQTVETLYYVETPEKKIESTTYTPWTGTFTTTYSTGVSTFTGEDGIATTETVYFVE 370

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQT 185
           TP V   STTYT WTG +T+T+ST V T TG DGI T
Sbjct: 371 TPEVKKESTTYTPWTGTFTTTFSTGVSTFTGEDGIAT 407

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/60 (66%), Positives = 45/60 (75%)

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           G DG  T ET+YYVETP   + STTYT WTG +T+TYST V T TG DGI TTET+YFVE
Sbjct: 311 GEDGYQTVETLYYVETPEKKIESTTYTPWTGTFTTTYSTGVSTFTGEDGIATTETVYFVE 370

>Sklu_2424.5 , Contig c2424 17833-20731
          Length = 967

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           ST+ST  +  TG+DG  TTE IYYVETP  A  +T                     G+DG
Sbjct: 782 STFSTGTSVVTGTDGSETTEVIYYVETPENAVTTT--TAWTGTFTSTFSTGTSVVTGTDG 839

Query: 138 VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            PTTE +YYVETP  N V+TT T+WTG + ST+ST    +TGTDG  TTE +Y+VE
Sbjct: 840 KPTTEVVYYVETPE-NAVTTT-TAWTGTFISTFSTGTSVVTGTDGKPTTEVIYYVE 893

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 64/106 (60%), Gaps = 4/106 (3%)

Query: 88  TGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYV 147
           TG+DG PTTE +YYVETP  A  +T                     G+DG PTTE IYYV
Sbjct: 835 TGTDGKPTTEVVYYVETPENAVTTT--TAWTGTFISTFSTGTSVVTGTDGKPTTEVIYYV 892

Query: 148 ETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           ETP  N V+TT T+WTG + ST+ST    +TGTDG  TTE +Y+VE
Sbjct: 893 ETPE-NAVTTT-TAWTGTFISTFSTGTSVVTGTDGKPTTEVIYYVE 936

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 59/106 (55%), Gaps = 4/106 (3%)

Query: 88  TGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYV 147
           TG+DG PTTE IYYVETP  A  +T                     G+DG PTTE +YYV
Sbjct: 405 TGTDGKPTTEVIYYVETPENAVTTT--TAWTGTFTSTFSTGTSVVTGTDGKPTTEVVYYV 462

Query: 148 ETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           ETP   V +TT  + T   T +  T V  +TGTDG +TTE +Y+VE
Sbjct: 463 ETPENAVTTTTAWTGTFTSTFSTGTSV--VTGTDGSETTEVIYYVE 506

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 58/106 (54%), Gaps = 4/106 (3%)

Query: 88  TGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYV 147
           TG+DG PTTE +YYVETP  A  +T                     G+DG  TTE IYYV
Sbjct: 577 TGTDGKPTTEVVYYVETPENAVTTT--TAWTGTFISTFSTGTSVVTGTDGSETTEVIYYV 634

Query: 148 ETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           ETP   V +TT  + T   T +  T V  +TGTDG +TTE +Y+VE
Sbjct: 635 ETPENAVTTTTAWTGTFTSTFSTGTSV--VTGTDGSETTEVIYYVE 678

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 58/106 (54%), Gaps = 4/106 (3%)

Query: 88  TGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYV 147
           TG+DG  TTE IYYVETP  A  +T                     G+DG PTTE +YYV
Sbjct: 663 TGTDGSETTEVIYYVETPENAVTTT--TAWTGTFTSTFSTGTSVVTGTDGKPTTEVVYYV 720

Query: 148 ETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           ETP   V +TT  + T   T +  T V  +TGTDG +TTE +Y+VE
Sbjct: 721 ETPENAVTTTTAWTGTFTSTFSTGTSV--VTGTDGSETTEVIYYVE 764

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 56/106 (52%), Gaps = 4/106 (3%)

Query: 88  TGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYV 147
           TG+DG  TTE IYYVETP F T +                      G+DG  TTE IYYV
Sbjct: 491 TGTDGSETTEVIYYVETPEFFTVAA--TAWTGTFTSTFSTGTSVVTGTDGSETTEVIYYV 548

Query: 148 ETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           ETP   V +TT  + T   T +  T V  +TGTDG  TTE +Y+VE
Sbjct: 549 ETPENAVTTTTAWTGTFTSTFSTGTSV--VTGTDGKPTTEVVYYVE 592

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           ST+ST  +  TG+DG PTTE IYYVETP  A  +T                     G+DG
Sbjct: 868 STFSTGTSVVTGTDGKPTTEVIYYVETPENAVTTT--TAWTGTFISTFSTGTSVVTGTDG 925

Query: 138 VPTTETIYYVETP 150
            PTTE IYYVETP
Sbjct: 926 KPTTEVIYYVETP 938

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 57/106 (53%), Gaps = 4/106 (3%)

Query: 88  TGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYV 147
           TG+DG  TTE IYYVETP  A  +T                     G+DG PTTE +YYV
Sbjct: 319 TGTDGSETTEVIYYVETPENAVTTT--TAWTGTFTSTFSTGTSVVTGTDGKPTTEVVYYV 376

Query: 148 ETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           ETP   V +TT  + T   T +  T V  +TGTDG  TTE +Y+VE
Sbjct: 377 ETPENAVTTTTAWTGTFTSTFSTGTSV--VTGTDGKPTTEVIYYVE 420

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 56/106 (52%), Gaps = 4/106 (3%)

Query: 88  TGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYV 147
           TG+DG  TTE IYYVETP  A  +T                     G+DG  TTE IYYV
Sbjct: 749 TGTDGSETTEVIYYVETPENAVTTT--TAWTGTFISTFSTGTSVVTGTDGSETTEVIYYV 806

Query: 148 ETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           ETP   V +TT  + T   T +  T V  +TGTDG  TTE +Y+VE
Sbjct: 807 ETPENAVTTTTAWTGTFTSTFSTGTSV--VTGTDGKPTTEVVYYVE 850

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 51/105 (48%), Gaps = 4/105 (3%)

Query: 89  GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
            S+G  TT+    +ETP  A  +T                     G+DG  TTE IYYVE
Sbjct: 277 NSEGSLTTDQFVVIETPENAVTTT--TAWTGTFTSTFSTGTSVVTGTDGSETTEVIYYVE 334

Query: 149 TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           TP   V +TT  + T   T +  T V  +TGTDG  TTE +Y+VE
Sbjct: 335 TPENAVTTTTAWTGTFTSTFSTGTSV--VTGTDGKPTTEVVYYVE 377

>Kwal_40.16449
          Length = 202

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 63/150 (42%), Gaps = 45/150 (30%)

Query: 87  FTGSDGVPTTETIYYVETPTFATQ------------------------------------ 110
           FTG DG  TTETIY+VETP    +                                    
Sbjct: 40  FTGEDGKTTTETIYHVETPVSGNRQATPPGLVLLQARTRPSSSPIPVRMAGHLQISFTMW 99

Query: 111 -------STVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVSTTYTSWT 163
                  ST Y                   G DG  TTETIY+VETP+V   STTY+ WT
Sbjct: 100 RSLQLMASTTYSGWTGSDTTTVSTELTTFTGEDGKATTETIYHVETPIV--ASTTYSGWT 157

Query: 164 GRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           G  T+T ST++ T TG DG  TTET+Y V 
Sbjct: 158 GSETTTVSTELTTFTGEDGKTTTETIYHVR 187

>Kwal_47.16805
          Length = 128

 Score = 58.2 bits (139), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 43/89 (48%), Gaps = 2/89 (2%)

Query: 74  VLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXX 133
            LR   Y   +TTFTG DG  TTETIY+VETP  A  ST Y                   
Sbjct: 27  ALRRLLYPLSLTTFTGEDGKTTTETIYHVETPIVA--STTYSGWTGSETTTVSTEVTTFT 84

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSW 162
           G DG  TTETIY+VETPV    S     W
Sbjct: 85  GEDGKTTTETIYHVETPVSVSTSIHRLDW 113

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 2/60 (3%)

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           G DG  TTETIY+VETP+V   STTY+ WTG  T+T ST+V T TG DG  TTET+Y VE
Sbjct: 42  GEDGKTTTETIYHVETPIV--ASTTYSGWTGSETTTVSTEVTTFTGEDGKTTTETIYHVE 99

>Kwal_22.2754
          Length = 411

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 41/52 (78%), Gaps = 2/52 (3%)

Query: 142 ETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +T+YYVETP++   S+ +T WTG++TSTYST     TG+DGI +T+T+Y++E
Sbjct: 7   KTVYYVETPIL--ASSVFTRWTGKFTSTYSTSYAAFTGSDGIVSTQTVYYIE 56

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFA 108
           STYST    FTGSDG+ +T+T+YY+ETP  A
Sbjct: 31  STYSTSYAAFTGSDGIVSTQTVYYIETPVSA 61

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 97  ETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPV 151
           +T+YYVETP  A  S+V+                   GSDG+ +T+T+YY+ETPV
Sbjct: 7   KTVYYVETPILA--SSVFTRWTGKFTSTYSTSYAAFTGSDGIVSTQTVYYIETPV 59

>KLLA0D00275g complement(24448..25623) no similarity, hypothetical
           start
          Length = 391

 Score = 60.8 bits (146), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 62/132 (46%), Gaps = 21/132 (15%)

Query: 83  EVTTFTGSDGVPTTETIYYVETPTFATQS-----------TVYXXXXXXXXXXXXXXXXX 131
           +V T TG DG+ T +TIY V+TP                 T Y                 
Sbjct: 160 DVLTETGDDGIATVKTIYKVQTPDGTDDDGGAETTTTTESTEYTRWTGTYTTTYSTDIST 219

Query: 132 XXGSDGVPTTETIYYVETP----------VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTD 181
             G DG+ T +TIY V+TP           V   +T YT WTG YT+TYSTDVLT TG D
Sbjct: 220 ETGDDGIATVKTIYLVQTPDGSDDDDDETTVTTETTQYTGWTGAYTTTYSTDVLTETGED 279

Query: 182 GIQTTETLYFVE 193
           G  T +T+Y V+
Sbjct: 280 GYPTIKTIYLVQ 291

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (78%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETP 105
           +TYST+V T TG DG PT +TIY V+TP
Sbjct: 266 TTYSTDVLTETGEDGYPTIKTIYLVQTP 293

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 10/79 (12%)

Query: 83  EVTTFTGSDGVPTTETIYYVETPTFATQSTV----------YXXXXXXXXXXXXXXXXXX 132
           +++T TG DG+ T +TIY V+TP  +               Y                  
Sbjct: 216 DISTETGDDGIATVKTIYLVQTPDGSDDDDDETTVTTETTQYTGWTGAYTTTYSTDVLTE 275

Query: 133 XGSDGVPTTETIYYVETPV 151
            G DG PT +TIY V+TP+
Sbjct: 276 TGEDGYPTIKTIYLVQTPL 294

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 66/137 (48%), Gaps = 23/137 (16%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTF-----ATQSTVYXXXXXXXXXXXXXXXXXX 132
           +TYSTEV T  G+  +PT  TIYYV+ P F      T+ T+                   
Sbjct: 46  TTYSTEVVTDDGT--IPTVMTIYYVQIPYFDDDDYVTEETIVTTEYTAWTGTYTTTYSTE 103

Query: 133 X---GSDGVPTTETIYYVETP-------------VVNVVSTTYTSWTGRYTSTYSTDVLT 176
                   +PT +TIY V+TP                  +T YT WTG YT+TYSTDVLT
Sbjct: 104 VLTLSGSPIPTVKTIYKVQTPDTSDDGGDDGTETTTTTETTEYTVWTGTYTTTYSTDVLT 163

Query: 177 LTGTDGIQTTETLYFVE 193
            TG DGI T +T+Y V+
Sbjct: 164 ETGDDGIATVKTIYKVQ 180

>Kwal_44.16506
          Length = 484

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 41/52 (78%), Gaps = 2/52 (3%)

Query: 142 ETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           +T+YYVETP++   S+ +T WTG++TSTYST     TG+DGI +T+T+Y++E
Sbjct: 7   KTVYYVETPIL--ASSVFTRWTGKFTSTYSTSYAAFTGSDGIVSTQTVYYIE 56

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFA 108
           STYST    FTGSDG+ +T+T+YY+ETP  A
Sbjct: 31  STYSTSYAAFTGSDGIVSTQTVYYIETPVSA 61

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 97  ETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPV 151
           +T+YYVETP  A  S+V+                   GSDG+ +T+T+YY+ETPV
Sbjct: 7   KTVYYVETPILA--SSVFTRWTGKFTSTYSTSYAAFTGSDGIVSTQTVYYIETPV 59

>Kwal_44.16504
          Length = 129

 Score = 54.7 bits (130), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/82 (48%), Positives = 46/82 (56%), Gaps = 4/82 (4%)

Query: 97  ETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVS 156
            T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP     S
Sbjct: 50  RTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTKTVYYVETPSSG--S 105

Query: 157 TTYTSWTGRYTSTYSTDVLTLT 178
             YT WTG +TSTYSTD+ T T
Sbjct: 106 NVYTPWTGSFTSTYSTDLSTFT 127

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 2/52 (3%)

Query: 142 ETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            T+YYVETP     +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 50  RTVYYVETP--TAATTVFTPGTGSVTATLSTGTTTFTGSDGKTTTKTVYYVE 99

>AFL095W [3100] [Homologous to ScYHR211W (FLO5) - NSH]
            complement(260875..268482) [7608 bp, 2535 aa]
          Length = 2535

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 49/95 (51%)

Query: 89   GSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVE 148
            G DG+PT E+ YYV TP  +  +T                     G+DG+ TTET YYV 
Sbjct: 1540 GPDGIPTVESTYYVVTPEASAVTTDVHGWTGSYTTTLSTGFTTFTGTDGIATTETSYYVV 1599

Query: 149  TPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGI 183
            TP       T + WTG Y +T ST V T+TGTDGI
Sbjct: 1600 TPEARAARRTTSGWTGTYMTTLSTGVATVTGTDGI 1634

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 40/59 (67%)

Query: 134  GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            G DG+PT E+ YYV TP  + V+T    WTG YT+T ST   T TGTDGI TTET Y+V
Sbjct: 1540 GPDGIPTVESTYYVVTPEASAVTTDVHGWTGSYTTTLSTGFTTFTGTDGIATTETSYYV 1598

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 62/106 (58%)

Query: 87   FTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYY 146
             TG +G+PT ++ YYV TP  +  +T                     G+DG+ TTET YY
Sbjct: 1268 VTGYNGIPTIKSTYYVVTPEASVVTTTASGWRRTYTTTRSTGITTVTGTDGIATTETTYY 1327

Query: 147  VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            V TP  + V+TT + WTG Y +T STDV T+TGT+GI TTET+Y V
Sbjct: 1328 VVTPEAHAVTTTTSGWTGTYKTTLSTDVTTVTGTNGIATTETIYHV 1373

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 57/100 (57%)

Query: 93  VPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVV 152
           + TTETIY+V TP     +TV                    G+DG+ TTET YYV TP  
Sbjct: 554 IATTETIYHVVTPEGVLTATVTSGWTGSITTTLSTGVTTVTGTDGIATTETTYYVVTPEA 613

Query: 153 NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            +V+TT + W G YT+T+ST V T+TG DGI T ET Y+V
Sbjct: 614 ELVTTTTSGWAGTYTTTFSTGVTTVTGPDGIPTLETTYYV 653

 Score = 36.6 bits (83), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 57/100 (57%)

Query: 93   VPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVV 152
            + TTETIY+V TP     +TV                    G+DG+ TTET YYV TP  
Sbjct: 914  IATTETIYHVVTPEGLLTATVTSGWTGSITTTLSTGVTTVTGTDGIATTETTYYVVTPEA 973

Query: 153  NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
             +V+TT + W G YT+T+ST V T+TG DGI T ET Y+V
Sbjct: 974  ELVTTTTSGWAGTYTTTFSTGVTTVTGPDGIPTLETTYYV 1013

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 32/46 (69%)

Query: 138  VPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGI 183
            + TTETIY+V TP   + +T  + WTG YT T ST V T+TGTDGI
Sbjct: 1184 IATTETIYHVVTPEGLLTATVTSGWTGYYTRTLSTGVTTVTGTDGI 1229

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 45/104 (43%), Gaps = 45/104 (43%)

Query: 134  GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGI---------- 183
            G++G+ TTETIY+V TP  + ++ T + W G YT+T STDV T+TGTDGI          
Sbjct: 1360 GTNGIATTETIYHVVTPEAHAITETTSGWMGTYTTTLSTDVTTITGTDGIATTETTYYVV 1419

Query: 184  -----------------------------------QTTETLYFV 192
                                                TTET+Y V
Sbjct: 1420 TPEAHAITTTTSGWTGTYMTTLSTDVTTVTGTDGIATTETIYHV 1463

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 41/57 (71%)

Query: 136 DGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
           DG+ TTET YYV TP    ++TT + WTG YT+T ST V T+TGTDGI TTET Y V
Sbjct: 777 DGIATTETTYYVVTPEAEAITTTMSGWTGSYTTTMSTGVTTVTGTDGIVTTETTYHV 833

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 57/100 (57%)

Query: 93   VPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVV 152
            + TTETIY+V TP     +TV                    G+DG+ TTET YYV TP  
Sbjct: 1454 IATTETIYHVVTPEGVLTATVTSGWTGSITTTLSTGVTTVTGTDGIATTETTYYVVTPEA 1513

Query: 153  NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
             +V+TT + W G YT+TYST V T+TG DGI T E+ Y+V
Sbjct: 1514 ELVTTTTSGWAGTYTTTYSTGVTTVTGPDGIPTVESTYYV 1553

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 57/100 (57%)

Query: 93   VPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVV 152
            + TTETIY+V TP     +TV                    G+DG+ TTET YYV TP  
Sbjct: 1184 IATTETIYHVVTPEGLLTATVTSGWTGYYTRTLSTGVTTVTGTDGIATTETTYYVVTPEA 1243

Query: 153  NVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            N V+TT + W G YT+TYST + T+TG +GI T ++ Y+V
Sbjct: 1244 NYVTTTTSGWAGTYTTTYSTGITTVTGYNGIPTIKSTYYV 1283

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETP 105
           +T ST V T TG+DG  T ETIY+V TP
Sbjct: 314 TTLSTGVATVTGTDGYGTIETIYHVVTP 341

>YHR211W (FLO5) [2496] chr8 (525390..528617) Flocculin, member of
           the Flo1p family of flocculation proteins [3228 bp, 1075
           aa]
          Length = 1075

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 61/113 (53%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STEVTT TG++G PT ET+  + TPT     T                     G++G PT
Sbjct: 426 STEVTTITGTNGQPTDETVIVIRTPTSEGLITTTTEPWTGTFTSTSTEMTTVTGTNGQPT 485

Query: 141 TETIYYVETPVVN-VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ET+  + TP    ++STT   WTG +TST ST+V T+TGT+G  T ET+  +
Sbjct: 486 DETVIVIRTPTSEGLISTTTEPWTGTFTST-STEVTTITGTNGQPTDETVIVI 537

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 60/113 (53%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STEVTT TG++G PT ET+  + TPT     T                     G++G PT
Sbjct: 516 STEVTTITGTNGQPTDETVIVIRTPTSEGLITTTTEPWTGTFTSTSTEMTTVTGTNGQPT 575

Query: 141 TETIYYVETPVVN-VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ET+  + TP    +++ T   WTG +TST ST+V T+TGT+G  T ET+  +
Sbjct: 576 DETVIVIRTPTSEGLITRTTEPWTGTFTST-STEVTTITGTNGQPTDETVIVI 627

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 61/113 (53%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G PT ET+  + TPT     T                     G++G PT
Sbjct: 336 STEMTTVTGTNGQPTDETVIVIRTPTSEGLITTTTEPWTGTFTSTSTEMTTVTGTNGQPT 395

Query: 141 TETIYYVETPVVN-VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ET+  + TP    +++TT   WTG +TST ST+V T+TGT+G  T ET+  +
Sbjct: 396 DETVIVIRTPTSEGLITTTTEPWTGTFTST-STEVTTITGTNGQPTDETVIVI 447

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 61/113 (53%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G PT ET+  + TPT     T                     G++G PT
Sbjct: 381 STEMTTVTGTNGQPTDETVIVIRTPTSEGLITTTTEPWTGTFTSTSTEVTTITGTNGQPT 440

Query: 141 TETIYYVETPVVN-VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ET+  + TP    +++TT   WTG +TST ST++ T+TGT+G  T ET+  +
Sbjct: 441 DETVIVIRTPTSEGLITTTTEPWTGTFTST-STEMTTVTGTNGQPTDETVIVI 492

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 61/113 (53%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G PT ET+  + TPT     +                     G++G PT
Sbjct: 471 STEMTTVTGTNGQPTDETVIVIRTPTSEGLISTTTEPWTGTFTSTSTEVTTITGTNGQPT 530

Query: 141 TETIYYVETPVVN-VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ET+  + TP    +++TT   WTG +TST ST++ T+TGT+G  T ET+  +
Sbjct: 531 DETVIVIRTPTSEGLITTTTEPWTGTFTST-STEMTTVTGTNGQPTDETVIVI 582

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G PT ET+  + TPT     T                     G++G PT
Sbjct: 561 STEMTTVTGTNGQPTDETVIVIRTPTSEGLITRTTEPWTGTFTSTSTEVTTITGTNGQPT 620

Query: 141 TETIYYVETP 150
            ET+  + TP
Sbjct: 621 DETVIVIRTP 630

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 21/28 (75%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFA 108
           STEVTT TG++G PT ET+  + TPT A
Sbjct: 606 STEVTTITGTNGQPTDETVIVIRTPTTA 633

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 61/113 (53%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT T ++G  T ET+  + TPT A+  T                     G++G PT
Sbjct: 291 STEMTTITDTNGQLTDETVIVIRTPTTASTITTTTEPWTGTFTSTSTEMTTVTGTNGQPT 350

Query: 141 TETIYYVETPVVN-VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ET+  + TP    +++TT   WTG +TST ST++ T+TGT+G  T ET+  +
Sbjct: 351 DETVIVIRTPTSEGLITTTTEPWTGTFTST-STEMTTVTGTNGQPTDETVIVI 402

>YAR050W (FLO1) [84] chr1 (203396..208009) Flocculin, cell wall
           protein involved in flocculation, member of the Flo1p
           family of flocculation proteins [4614 bp, 1537 aa]
          Length = 1537

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G PT ET+  + TPT     +                     G++GVPT
Sbjct: 876 STEMTTITGTNGQPTDETVIVIRTPTSEGLISTTTEPWTGTFTSTSTEMTHVTGTNGVPT 935

Query: 141 TETIYYVETPVVN-VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ET+  + TP    ++STT   WTG +TST ST+V T+TGT+G  T ET+  +
Sbjct: 936 DETVIVIRTPTSEGLISTTTEPWTGTFTST-STEVTTITGTNGQPTDETVIVI 987

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G PT ET+  + TPT     T                     G++GVPT
Sbjct: 786 STEMTTVTGTNGQPTDETVIVIRTPTSEGLVTTTTEPWTGTFTSTSTEMTTITGTNGVPT 845

Query: 141 TETIYYVETPVVN-VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ET+  + TP    ++STT   WTG +TST ST++ T+TGT+G  T ET+  +
Sbjct: 846 DETVIVIRTPTSEGLISTTTEPWTGTFTST-STEMTTITGTNGQPTDETVIVI 897

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 63/113 (55%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++GVPT ET+  + TPT     +                     G++G PT
Sbjct: 741 STEMTTVTGTNGVPTDETVIVIRTPTSEGLISTTTEPWTGTFTSTSTEMTTVTGTNGQPT 800

Query: 141 TETIYYVETPVVN-VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ET+  + TP    +V+TT   WTG +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 801 DETVIVIRTPTSEGLVTTTTEPWTGTFTST-STEMTTITGTNGVPTDETVIVI 852

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 63/114 (55%), Gaps = 2/114 (1%)

Query: 81   STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
            STEVTT TG++G PT ET+  + TPT     +                     G++G PT
Sbjct: 966  STEVTTITGTNGQPTDETVIVIRTPTSEGLISTTTEPWTGTFTSTSTEMTTVTGTNGQPT 1025

Query: 141  TETIYYVETPVVN-VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
             ET+  + TP    +V+TT   WTG +TST ST++ T+TGT+G+ T ET+  V+
Sbjct: 1026 DETVIVIRTPTSEGLVTTTTEPWTGTFTST-STEMSTVTGTNGLPTDETVIVVK 1078

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G+PT ETI  + TPT AT +                      G++G+PT
Sbjct: 516 STEITTVTGTNGLPTDETIIVIRTPTTATTAMTTPQPWNDTFTSTSTEMTTVTGTNGLPT 575

Query: 141 TETIYYVETPVVNVVSTTYTS-WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ETI  + TP     + T T  W   +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 576 DETIIVIRTPTTATTAITTTEPWNSTFTST-STEMTTVTGTNGLPTDETIIVI 627

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G+PT ETI  + TPT AT +                      G++G+PT
Sbjct: 426 STELTTVTGTNGLPTDETIIVIRTPTTATTAMTTTQPWNDTFTSTSTELTTVTGTNGLPT 485

Query: 141 TETIYYVETPVVNVVSTTYTS-WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ETI  + TP     + T T  W   +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 486 DETIIVIRTPTTATTAMTTTQPWNDTFTST-STEITTVTGTNGLPTDETIIVI 537

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G+PT ETI  + TPT AT +                      G++G+PT
Sbjct: 561 STEMTTVTGTNGLPTDETIIVIRTPTTATTAITTTEPWNSTFTSTSTEMTTVTGTNGLPT 620

Query: 141 TETIYYVETPVVNVVSTTYTS-WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ETI  + TP     + T T  W   +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 621 DETIIVIRTPTTATTAITTTQPWNDTFTST-STEMTTVTGTNGLPTDETIIVI 672

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 60/113 (53%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++GVPT ET+  + TPT A+                        G++GV T
Sbjct: 291 STEMTTVTGTNGVPTDETVIVIRTPTTASTIITTTEPWNSTFTSTSTELTTVTGTNGVRT 350

Query: 141 TETIYYVETPVVNVVSTTYTS-WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ETI  + TP     + T T  W   +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 351 DETIIVIRTPTTATTAITTTEPWNSTFTST-STELTTVTGTNGLPTDETIIVI 402

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 61/113 (53%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++GV T ETI  + TPT AT +                      G++G+PT
Sbjct: 336 STELTTVTGTNGVRTDETIIVIRTPTTATTAITTTEPWNSTFTSTSTELTTVTGTNGLPT 395

Query: 141 TETIYYVETPVVNVVSTTYTS-WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ETI  + TP     + T T  W   +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 396 DETIIVIRTPTTATTAMTTTQPWNDTFTST-STELTTVTGTNGLPTDETIIVI 447

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 35/70 (50%)

Query: 81   STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
            STE+TT TG++G PT ET+  + TPT     T                     G++G+PT
Sbjct: 1011 STEMTTVTGTNGQPTDETVIVIRTPTSEGLVTTTTEPWTGTFTSTSTEMSTVTGTNGLPT 1070

Query: 141  TETIYYVETP 150
             ET+  V+TP
Sbjct: 1071 DETVIVVKTP 1080

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 23/28 (82%)

Query: 81   STEVTTFTGSDGVPTTETIYYVETPTFA 108
            STE++T TG++G+PT ET+  V+TPT A
Sbjct: 1056 STEMSTVTGTNGLPTDETVIVVKTPTTA 1083

>KLLA0E25113g 2227131..2228147 no similarity, hypothetical start
          Length = 338

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 39/73 (53%), Gaps = 13/73 (17%)

Query: 134 GSDGVPTTETIYYVETPVVNVVSTT-------------YTSWTGRYTSTYSTDVLTLTGT 180
           G DG+ T +TIY V+TP                     YT WTG Y +TYSTDVLT TG 
Sbjct: 166 GDDGIATVKTIYKVQTPDGTDDDGGADDETTATTETTQYTGWTGAYATTYSTDVLTETGE 225

Query: 181 DGIQTTETLYFVE 193
           DG  T +T+Y V+
Sbjct: 226 DGYPTIKTIYLVQ 238

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (78%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETP 105
           +TYST+V T TG DG PT +TIY V+TP
Sbjct: 213 TTYSTDVLTETGEDGYPTIKTIYLVQTP 240

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 65/137 (47%), Gaps = 23/137 (16%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXG--- 134
           +TYSTEV T  G+  +PT  TIYYV+ P F     V                        
Sbjct: 46  TTYSTEVVTDDGT--IPTVMTIYYVQIPYFDDDDYVTEETIVTTEYTVWTGTYTTTYSTE 103

Query: 135 ----SDG-VPTTETIYYVETP-------------VVNVVSTTYTSWTGRYTSTYSTDVLT 176
               S G +PT +TIY V+TP                  +T YT WTG YT+TYSTDVL+
Sbjct: 104 VLTLSGGPIPTVKTIYKVQTPDTSDDGGDDGTETTTTTETTEYTVWTGTYTTTYSTDVLS 163

Query: 177 LTGTDGIQTTETLYFVE 193
            TG DGI T +T+Y V+
Sbjct: 164 ETGDDGIATVKTIYKVQ 180

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 32/82 (39%), Gaps = 13/82 (15%)

Query: 83  EVTTFTGSDGVPTTETIYYVETPTFATQSTV-------------YXXXXXXXXXXXXXXX 129
           +V + TG DG+ T +TIY V+TP                     Y               
Sbjct: 160 DVLSETGDDGIATVKTIYKVQTPDGTDDDGGADDETTATTETTQYTGWTGAYATTYSTDV 219

Query: 130 XXXXGSDGVPTTETIYYVETPV 151
               G DG PT +TIY V+TP+
Sbjct: 220 LTETGEDGYPTIKTIYLVQTPL 241

>Kwal_56.22277
          Length = 417

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 19  DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 76

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 77  --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 117

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 105 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 162

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 163 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 203

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 191 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 248

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 249 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 289

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 4/103 (3%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG PTT+T+YYVETPT AT  TV+                   GSDG  TT+T+YYVETP
Sbjct: 277 DGKPTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKTTTQTVYYVETP 334

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
                +T +T  TG  T+T ST   T TG+DG  TT+T+Y+VE
Sbjct: 335 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVE 375

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 55/97 (56%), Gaps = 4/97 (4%)

Query: 91  DGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETP 150
           DG  TT+T+YYVETPT AT  TV+                   GSDG PTT+T+YYVETP
Sbjct: 320 DGKTTTQTVYYVETPTAAT--TVFTPGTGSVTATLSTGTTTFTGSDGKPTTQTVYYVETP 377

Query: 151 VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTE 187
                +T +T  TG  T+T ST   T TG+DG  TT+
Sbjct: 378 --TAATTVFTPGTGSVTATLSTGTTTFTGSDGKPTTQ 412

>Kwal_55.19510
          Length = 274

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 35/47 (74%), Gaps = 2/47 (4%)

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            ETP++   S+ +T WTG++TSTYST     TG+DGI +T+T+Y++E
Sbjct: 12  CETPIL--ASSVFTRWTGKFTSTYSTSYAAFTGSDGIVSTQTVYYIE 56

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFA 108
           STYST    FTGSDG+ +T+T+YY+ETP  A
Sbjct: 31  STYSTSYAAFTGSDGIVSTQTVYYIETPVSA 61

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 17/18 (94%)

Query: 134 GSDGVPTTETIYYVETPV 151
           GSDG+ +T+T+YY+ETPV
Sbjct: 42  GSDGIVSTQTVYYIETPV 59

>Kwal_38.16383
          Length = 110

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/46 (60%), Positives = 31/46 (67%), Gaps = 2/46 (4%)

Query: 134 GSDGVPTTETIYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTG 179
           G DG  TT+T+YYVETP     ST  T WTG +TSTYST V T TG
Sbjct: 21  GEDGKTTTQTVYYVETPTAG--STEITGWTGTFTSTYSTGVSTFTG 64

>Kwal_29.12878
          Length = 271

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 31/40 (77%)

Query: 154 VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           + S+ +T WTG++TSTYST     TG+DGI +T+T+Y++E
Sbjct: 17  LASSVFTRWTGKFTSTYSTSYAAFTGSDGIVSTQTVYYIE 56

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%)

Query: 78  STYSTEVTTFTGSDGVPTTETIYYVETPTFA 108
           STYST    FTGSDG+ +T+T+YY+ETP  A
Sbjct: 31  STYSTSYAAFTGSDGIVSTQTVYYIETPVSA 61

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 17/18 (94%)

Query: 134 GSDGVPTTETIYYVETPV 151
           GSDG+ +T+T+YY+ETPV
Sbjct: 42  GSDGIVSTQTVYYIETPV 59

>Kwal_47.16802
          Length = 159

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 102 VETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPTTETIYYVETPVVNVVSTTYTS 161
           VETP  AT  T Y                   G DG  TTETIY+VETP+  V +TTY+ 
Sbjct: 57  VETPIVAT--TTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVETPI--VATTTYSG 112

Query: 162 WTGRYTSTYSTD 173
           WTG  T+T ST+
Sbjct: 113 WTGSETTTVSTE 124

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%)

Query: 147 VETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
           VETP+V   +TTY+ WTG  T+T ST++ T TG DG  TTET+Y VE
Sbjct: 57  VETPIV--ATTTYSGWTGSETTTVSTELTTFTGEDGKTTTETIYHVE 101

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 18/23 (78%)

Query: 87  FTGSDGVPTTETIYYVETPTFAT 109
           FTG DG  TTETIY+VETP  AT
Sbjct: 85  FTGEDGKTTTETIYHVETPIVAT 107

>YAL063C (FLO9) [7] chr1 complement(24001..27969) Member of the
           Flo1p family of flocculation proteins, which includes
           Flo1p, Flo5p, and Flo10p [3969 bp, 1322 aa]
          Length = 1322

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 63/114 (55%), Gaps = 2/114 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++GVPT ET+  + TPT     +                     G++G PT
Sbjct: 741 STEMTTVTGTNGVPTDETVIVIRTPTSEGLISTTTEPWTGTFTSTSTEMTTVTGTNGQPT 800

Query: 141 TETIYYVETPVVN-VVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
            ET+  + TP    +V+TT   WTG +TST ST++ T+TGT+G  T ET+  V+
Sbjct: 801 DETVIVIRTPTSEGLVTTTTEPWTGTFTST-STEMTTITGTNGQPTDETVIIVK 853

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G+PT ETI  + TPT AT +                      G++G+PT
Sbjct: 516 STEITTVTGTNGLPTDETIIVIRTPTTATTAMTTTQPWNDTFTSTSTEMTTVTGTNGLPT 575

Query: 141 TETIYYVETPVVNVVSTTYTS-WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ETI  + TP     + T T  W   +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 576 DETIIVIRTPTTATTAITTTEPWNSTFTST-STEMTTVTGTNGLPTDETIIVI 627

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G+PT ETI  + TPT AT +                      G++G+PT
Sbjct: 606 STEMTTVTGTNGLPTDETIIVIRTPTTATTAITTTQPWNDTFTSTSTEMTTVTGTNGLPT 665

Query: 141 TETIYYVETPVVNVVSTTYTS-WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ETI  + TP     + T T  W   +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 666 DETIIVIRTPTTATTAMTTTQPWNDTFTST-STEITTVTGTNGLPTDETIIVI 717

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G+PT ETI  + TPT AT +                      G++G+PT
Sbjct: 426 STELTTVTGTNGLPTDETIIVIRTPTTATTAMTTTQPWNDTFTSTSTELTTVTGTNGLPT 485

Query: 141 TETIYYVETPVVNVVSTTYTS-WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ETI  + TP     + T T  W   +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 486 DETIIVIRTPTTATTAMTTTQPWNDTFTST-STEITTVTGTNGLPTDETIIVI 537

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G+PT ETI  + TPT AT +                      G++G+PT
Sbjct: 651 STEMTTVTGTNGLPTDETIIVIRTPTTATTAMTTTQPWNDTFTSTSTEITTVTGTNGLPT 710

Query: 141 TETIYYVETPVVNVVSTTYTS-WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ETI  + TP     + T T  W   +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 711 DETIIVIRTPTTATTAMTTTQPWNDTFTST-STEMTTVTGTNGVPTDETVIVI 762

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 60/113 (53%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++GVPT ET+  + TPT A+                        G++GV T
Sbjct: 291 STEMTTVTGTNGVPTDETVIVIRTPTTASTIITTTEPWNSTFTSTSTELTTVTGTNGVRT 350

Query: 141 TETIYYVETPVVNVVSTTYTS-WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ETI  + TP     + T T  W   +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 351 DETIIVIRTPTTATTAITTTEPWNSTFTST-STELTTVTGTNGLPTDETIIVI 402

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 61/113 (53%), Gaps = 2/113 (1%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++GV T ETI  + TPT AT +                      G++G+PT
Sbjct: 336 STELTTVTGTNGVRTDETIIVIRTPTTATTAITTTEPWNSTFTSTSTELTTVTGTNGLPT 395

Query: 141 TETIYYVETPVVNVVSTTYTS-WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
            ETI  + TP     + T T  W   +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 396 DETIIVIRTPTTATTAMTTTQPWNDTFTST-STELTTVTGTNGLPTDETIIVI 447

 Score = 36.6 bits (83), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 34/70 (48%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDGVPT 140
           STE+TT TG++G PT ET+  + TPT     T                     G++G PT
Sbjct: 786 STEMTTVTGTNGQPTDETVIVIRTPTSEGLVTTTTEPWTGTFTSTSTEMTTITGTNGQPT 845

Query: 141 TETIYYVETP 150
            ET+  V+TP
Sbjct: 846 DETVIIVKTP 855

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 22/28 (78%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFA 108
           STE+TT TG++G PT ET+  V+TPT A
Sbjct: 831 STEMTTITGTNGQPTDETVIIVKTPTTA 858

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 24/31 (77%), Gaps = 1/31 (3%)

Query: 162 WTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
           WTG +TST ST++ T+TGT+G+ T ET+  +
Sbjct: 283 WTGTFTST-STEMTTVTGTNGVPTDETVIVI 312

>Scas_694.1*
          Length = 1109

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 32/49 (65%)

Query: 144 IYYVETPVVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFV 192
           +YY+ T + +VVS   + W+G  + TYST     TGTDGI+T E +Y+V
Sbjct: 1   MYYISTVMPSVVSNVVSEWSGTGSQTYSTVNSIFTGTDGIETVERIYYV 49

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 79  TYSTEVTTFTGSDGVPTTETIYYVETP 105
           TYST  + FTG+DG+ T E IYYV  P
Sbjct: 26  TYSTVNSIFTGTDGIETVERIYYVYVP 52

>CAGL0I00220g complement(12309..14903) some similarities with
           sp|P32768 Saccharomyces cerevisiae YAR050w FLO1,
           hypothetical start
          Length = 864

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 56/120 (46%), Gaps = 24/120 (20%)

Query: 79  TYSTE-VTTFTGSDGVPTTETIYYVETPTFATQSTVYXXXXXXXXXXXXXXXXXXXGSDG 137
           TYSTE +T    S  +P T TI++++ P  ++ +++Y                    SDG
Sbjct: 282 TYSTEYITESIESPNIPVTSTIFHIQVPCPSSSTSIYC-------------------SDG 322

Query: 138 V--PTTETIYYVETP--VVNVVSTTYTSWTGRYTSTYSTDVLTLTGTDGIQTTETLYFVE 193
              P   +    E+   +V   STTYT      T+T ST V  +TG+D   T ET++ VE
Sbjct: 323 FYDPIANSCVKTESSEIIVATASTTYTPGPVTDTTTISTYVTHITGSDNRDTPETVFVVE 382

>Kwal_54.19484
          Length = 327

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (93%)

Query: 561 VSTYEGSANRLGFGLL 576
           VSTYEG+A+R+GF LL
Sbjct: 304 VSTYEGAASRIGFSLL 319

>Kwal_60.24937
          Length = 279

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (93%)

Query: 561 VSTYEGSANRLGFGLL 576
           VSTYEG+A+R+GF LL
Sbjct: 256 VSTYEGAASRIGFSLL 271

>YHR213W (YHR213W) [2497] chr8 (539149..539745) Protein containing a
           flocculin repeat, which are serine- and threonine-rich,
           has strong similarity to a region of flocculin (S.
           cerevisiae Flo5p), which is involved in flocculation
           [597 bp, 198 aa]
          Length = 198

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%)

Query: 81  STEVTTFTGSDGVPTTETIYYVETPTFAT 109
           STE+TT TG++G PT ET+   + PT AT
Sbjct: 152 STEMTTVTGTNGQPTDETVIVAKAPTTAT 180

>CAGL0I10362g 1011132..1014743 some similarities with sp|P32768
           Saccharomyces cerevisiae YAR050w FLO1, hypothetical
           start
          Length = 1217

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 21/34 (61%)

Query: 74  VLRPSTYSTEVTTFTGSDGVPTTETIYYVETPTF 107
           VL P+T  T  +T  G DG+PTT TIY V  PT 
Sbjct: 255 VLNPTTTGTSYSTALGIDGLPTTYTIYQVVVPTI 288

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,528,439
Number of extensions: 176470
Number of successful extensions: 1952
Number of sequences better than 10.0: 88
Number of HSP's gapped: 994
Number of HSP's successfully gapped: 523
Length of query: 576
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 469
Effective length of database: 12,891,983
Effective search space: 6046340027
Effective search space used: 6046340027
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)