Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.83125725413520.0
Kwal_47.168452642496826e-90
YOL154W (ZPS1)2492026208e-81
Sklu_2244.42492225946e-77
Sklu_1789.12682075741e-73
KLLA0D19921g2832025733e-73
KLLA0C00264g2582424896e-61
Scas_633.1617097770.050
Sklu_1943.438840671.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.831
         (254 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.831                                                           525   0.0  
Kwal_47.16845                                                         267   6e-90
YOL154W (ZPS1) [4671] chr15 (34657..35406) Member of the fungal-...   243   8e-81
Sklu_2244.4 YOL154W, Contig c2244 10844-11593                         233   6e-77
Sklu_1789.1 , Contig c1789 637-1443                                   225   1e-73
KLLA0D19921g 1690012..1690863 some similarities with sp|Q12512 S...   225   3e-73
KLLA0C00264g complement(17326..18102) similar to sp|Q12512 Sacch...   192   6e-61
Scas_633.16                                                            34   0.050
Sklu_1943.4 YNL001W, Contig c1943 3802-4968                            30   1.6  

>Kwal_14.831
          Length = 257

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/254 (100%), Positives = 254/254 (100%)

Query: 1   MANFRRNALALLTSFICVGTLIAGLVLAIIAERKAVTMKNTRKTYATVATGEFTESPFPR 60
           MANFRRNALALLTSFICVGTLIAGLVLAIIAERKAVTMKNTRKTYATVATGEFTESPFPR
Sbjct: 1   MANFRRNALALLTSFICVGTLIAGLVLAIIAERKAVTMKNTRKTYATVATGEFTESPFPR 60

Query: 61  LHKSCNASDVDFLTRAFADSLEVTGHARDKLLNESSSNEIYKRWFGDGSVYEVLGVLDGI 120
           LHKSCNASDVDFLTRAFADSLEVTGHARDKLLNESSSNEIYKRWFGDGSVYEVLGVLDGI
Sbjct: 61  LHKSCNASDVDFLTRAFADSLEVTGHARDKLLNESSSNEIYKRWFGDGSVYEVLGVLDGI 120

Query: 121 ANMTKTDILLRCDDVDGRCAANPGYYAGHHRLEHDAETVICDYFYESRAFLKDLCANGTL 180
           ANMTKTDILLRCDDVDGRCAANPGYYAGHHRLEHDAETVICDYFYESRAFLKDLCANGTL
Sbjct: 121 ANMTKTDILLRCDDVDGRCAANPGYYAGHHRLEHDAETVICDYFYESRAFLKDLCANGTL 180

Query: 181 KEFGPAKYAGIDMIHRYFHVSFVSMDEYVGEFTEEIEDMLELAKSNSTFAVRNVDNYLYY 240
           KEFGPAKYAGIDMIHRYFHVSFVSMDEYVGEFTEEIEDMLELAKSNSTFAVRNVDNYLYY
Sbjct: 181 KEFGPAKYAGIDMIHRYFHVSFVSMDEYVGEFTEEIEDMLELAKSNSTFAVRNVDNYLYY 240

Query: 241 LADVYSSDKVKGGC 254
           LADVYSSDKVKGGC
Sbjct: 241 LADVYSSDKVKGGC 254

>Kwal_47.16845
          Length = 264

 Score =  267 bits (682), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 171/249 (68%)

Query: 6   RNALALLTSFICVGTLIAGLVLAIIAERKAVTMKNTRKTYATVATGEFTESPFPRLHKSC 65
           R+ L LLT+F+ V  ++  +   I+A+RK                  ++ +  P ++ +C
Sbjct: 12  RHGLVLLTTFVVVAFVVISMTFGILADRKYNENTGKMPNNPAAPVVSWSRTGLPTIYDTC 71

Query: 66  NASDVDFLTRAFADSLEVTGHARDKLLNESSSNEIYKRWFGDGSVYEVLGVLDGIANMTK 125
           N + ++ L  AF ++L VT  AR +L+     + IYKRWFGDG +Y V+G ++ +A M K
Sbjct: 72  NGTHLEQLNEAFEETLNVTALARSRLMKYGVQDSIYKRWFGDGPLYTVIGTIEAVAQMPK 131

Query: 126 TDILLRCDDVDGRCAANPGYYAGHHRLEHDAETVICDYFYESRAFLKDLCANGTLKEFGP 185
            D + RCDD+DGRCAANP YYAGHHRL    ETVICDYFY ++  L  +C NG++   GP
Sbjct: 132 KDTIFRCDDIDGRCAANPNYYAGHHRLNATQETVICDYFYTAKLPLSKICTNGSITSTGP 191

Query: 186 AKYAGIDMIHRYFHVSFVSMDEYVGEFTEEIEDMLELAKSNSTFAVRNVDNYLYYLADVY 245
           +KY GIDM+HRYFHV  +S+++Y+GE+TEE++++LE+A++NSTFAVRNVD+YLYYLADVY
Sbjct: 192 SKYKGIDMVHRYFHVPTISLNDYIGEYTEELDEILEMAENNSTFAVRNVDSYLYYLADVY 251

Query: 246 SSDKVKGGC 254
           SS  V GGC
Sbjct: 252 SSSVVPGGC 260

>YOL154W (ZPS1) [4671] chr15 (34657..35406) Member of the
           fungal-specific deuterolysin family of zinc
           metalloproteinases [750 bp, 249 aa]
          Length = 249

 Score =  243 bits (620), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 103/202 (50%), Positives = 146/202 (72%)

Query: 53  FTESPFPRLHKSCNASDVDFLTRAFADSLEVTGHARDKLLNESSSNEIYKRWFGDGSVYE 112
           ++ + FP ++++CN ++   L  AF D+ E+T + +D+LLN    +  YKRWFG+GS++ 
Sbjct: 44  WSHATFPTIYQTCNETNARMLNAAFKDTAEITAYGKDRLLNYGVDDVYYKRWFGNGSIFT 103

Query: 113 VLGVLDGIANMTKTDILLRCDDVDGRCAANPGYYAGHHRLEHDAETVICDYFYESRAFLK 172
           V+GV + +   +K  +L+RCDD+DG CAANP YYAGHHR    AETVICDYFY S+  L 
Sbjct: 104 VMGVFEQLMEASKGAMLMRCDDIDGLCAANPNYYAGHHRQSAPAETVICDYFYTSKKPLS 163

Query: 173 DLCANGTLKEFGPAKYAGIDMIHRYFHVSFVSMDEYVGEFTEEIEDMLELAKSNSTFAVR 232
            +C  GT+ + GP  YAGIDM+HRY HV  +SMD YVGE+ E +E++++  ++N+T+AVR
Sbjct: 164 TICFEGTIVDVGPKHYAGIDMLHRYLHVPTMSMDGYVGEYAETLEEVVDYTQNNATYAVR 223

Query: 233 NVDNYLYYLADVYSSDKVKGGC 254
           N DNYLYYLADVYS+  + GGC
Sbjct: 224 NTDNYLYYLADVYSASVIPGGC 245

>Sklu_2244.4 YOL154W, Contig c2244 10844-11593
          Length = 249

 Score =  233 bits (594), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 146/222 (65%), Gaps = 11/222 (4%)

Query: 44  TYATVATGEFTE-----------SPFPRLHKSCNASDVDFLTRAFADSLEVTGHARDKLL 92
           TY T +T E T              FP  H+SCN +++  L  AF DSLEVT +A+ +LL
Sbjct: 24  TYNTSSTVELTSLDSTDVIGWNAPTFPEYHQSCNETNIRMLNAAFKDSLEVTAYAKSRLL 83

Query: 93  NESSSNEIYKRWFGDGSVYEVLGVLDGIANMTKTDILLRCDDVDGRCAANPGYYAGHHRL 152
           N    +  YKRWFG+GS+Y V+GVLD +   +K  I+ RCDD DG+CAANP  +AG++R+
Sbjct: 84  NYGVDDTYYKRWFGNGSIYTVIGVLDHLMESSKEGIVYRCDDADGKCAANPTSWAGYYRV 143

Query: 153 EHDAETVICDYFYESRAFLKDLCANGTLKEFGPAKYAGIDMIHRYFHVSFVSMDEYVGEF 212
            +  +TVIC+ FY  +  L  +C  G + + GP  YAGIDM+HRY H   +S DEY+ E+
Sbjct: 144 SNPMQTVICNRFYSVKKPLSTMCFEGNIVDLGPTHYAGIDMLHRYLHAPIMSSDEYITEY 203

Query: 213 TEEIEDMLELAKSNSTFAVRNVDNYLYYLADVYSSDKVKGGC 254
            EEI ++L+ AK+N T+AVRN DNYLYY+ADVYSS  V GGC
Sbjct: 204 VEEIGELLDYAKNNGTYAVRNTDNYLYYVADVYSSAVVPGGC 245

>Sklu_1789.1 , Contig c1789 637-1443
          Length = 268

 Score =  225 bits (574), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 101/207 (48%), Positives = 144/207 (69%), Gaps = 1/207 (0%)

Query: 48  VATGEFTESPFPRLHKSCNASDVDFLTRAFADSLEVTGHARDKLLNESSSNEIYKRWFGD 107
           V TG +    FP +H SCN ++ + L  AF D+++VT   R++LL     ++ YKRWFG+
Sbjct: 59  VVTG-WLRPTFPEIHDSCNETNNNMLNAAFEDTVQVTDVIRNRLLEYGVEDKFYKRWFGN 117

Query: 108 GSVYEVLGVLDGIANMTKTDILLRCDDVDGRCAANPGYYAGHHRLEHDAETVICDYFYES 167
           GS++ VLGV + +   +K  ++ RCDD DG+CAANP  +AGH+R+ +  +TVIC+ FY  
Sbjct: 118 GSIFTVLGVFNHLVESSKEGMIYRCDDTDGKCAANPTSWAGHYRVSNPMQTVICNRFYTV 177

Query: 168 RAFLKDLCANGTLKEFGPAKYAGIDMIHRYFHVSFVSMDEYVGEFTEEIEDMLELAKSNS 227
           +  L  +C +GT+ E GP  YAGID++HRY     ++ DEY+ E+ EEI+D+L+ AK+N+
Sbjct: 178 KKPLSSMCFDGTVLEVGPTHYAGIDLLHRYLRAPTMNSDEYITEYVEEIDDLLDYAKNNA 237

Query: 228 TFAVRNVDNYLYYLADVYSSDKVKGGC 254
           T+AVRNVDNYLYY ADVYSS  V GGC
Sbjct: 238 TYAVRNVDNYLYYAADVYSSSVVPGGC 264

>KLLA0D19921g 1690012..1690863 some similarities with sp|Q12512
           Saccharomyces cerevisiae YOL154w singleton, hypothetical
           start
          Length = 283

 Score =  225 bits (573), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 136/202 (67%)

Query: 53  FTESPFPRLHKSCNASDVDFLTRAFADSLEVTGHARDKLLNESSSNEIYKRWFGDGSVYE 112
           +T   FP+ H SCN ++   +  A  D+LEV+  ARD+LL   +S+EIYKRWFGD  ++ 
Sbjct: 75  WTNPTFPQYHNSCNITNQRMINGALIDTLEVSSFARDRLLANGTSDEIYKRWFGDAPLFT 134

Query: 113 VLGVLDGIANMTKTDILLRCDDVDGRCAANPGYYAGHHRLEHDAETVICDYFYESRAFLK 172
           V GV++      K D+L RCDD  G CAANP  + G+H L    ET  CD FY  +  L 
Sbjct: 135 VAGVIENTIQGVKDDLLFRCDDPQGGCAANPTSWWGYHVLNTTGETNFCDLFYSGKKPLT 194

Query: 173 DLCANGTLKEFGPAKYAGIDMIHRYFHVSFVSMDEYVGEFTEEIEDMLELAKSNSTFAVR 232
            +C  GT+ E GP  YAGID+ HRYFH+  +S + Y+GE+TEE++D+L LA++N+T+AVR
Sbjct: 195 HICFEGTIVEVGPTLYAGIDLFHRYFHLDQMSSEGYIGEYTEELDDILALAQNNATYAVR 254

Query: 233 NVDNYLYYLADVYSSDKVKGGC 254
           NVDNYLYYLADVY+   + GGC
Sbjct: 255 NVDNYLYYLADVYAEAVIPGGC 276

>KLLA0C00264g complement(17326..18102) similar to sp|Q12512
           Saccharomyces cerevisiae YOL154w singleton, hypothetical
           start
          Length = 258

 Score =  192 bits (489), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 146/242 (60%), Gaps = 10/242 (4%)

Query: 22  IAGLVLAIIAERKAVTMKN----TRKTYATVATGEFTESP-----FPRLHKSCNASDVDF 72
           I G +  I +   A  +KN    +  +   +  GE  ES      FP  H+SCNA++   
Sbjct: 8   IVGCISIISSIAGATPLKNHDFHSNSSLELIEFGESGESGWGSPVFPYFHQSCNATNQRM 67

Query: 73  LTRAFADSLEVTGHARDKLLNESSSNEIYKRWFGDGSVYEVLGVLDGIANMTKTDILLRC 132
           L+    D+LEVT  ARDKLL  + +++ +KRWFG+ SV+ V+G L+ +    K+D+L RC
Sbjct: 68  LSSGLKDTLEVTAVARDKLL-ANGTDKFFKRWFGNSSVFTVIGTLEYVIESGKSDVLYRC 126

Query: 133 DDVDGRCAANPGYYAGHHRLEHDAETVICDYFYESRAFLKDLCANGTLKEFGPAKYAGID 192
           DD  G CA +   + G+H      ET ICD FY+++  L  +C  G + E GP  Y+GID
Sbjct: 127 DDPSGDCAVHSTDWPGYHVTNTTGETNICDLFYQTKKPLSTICFEGDIVELGPKHYSGID 186

Query: 193 MIHRYFHVSFVSMDEYVGEFTEEIEDMLELAKSNSTFAVRNVDNYLYYLADVYSSDKVKG 252
           + HR+ H+  ++ + ++ E+TE + ++L LA++N+TFA RN DNYLYYLADVY++    G
Sbjct: 187 LFHRFLHLDNLNGNGFISEWTETLPEVLYLAENNATFAARNTDNYLYYLADVYAATVNPG 246

Query: 253 GC 254
           GC
Sbjct: 247 GC 248

>Scas_633.16
          Length = 170

 Score = 34.3 bits (77), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 81  LEVTGHARDKLLNESSSNEIYKRWFGDGSVYEVLGVLDGIANMTKT-DI--LLRCDDVDG 137
           L      R+  LN ++S E +K     G+  +++  L  I  +T+T D+  +L  +DV+G
Sbjct: 58  LSPNPPKRNSKLNITASGEAFKE-IKKGAYIDIVVRLGYIKLLTQTFDLCDMLEDEDVEG 116

Query: 138 -RCAANPGYYAGHHRLEHDAETVICDYFYESRAFLKD 173
            RC   PG Y     ++  AE     Y + +RA+  D
Sbjct: 117 LRCPVQPGKYNLAKSVDIPAEVPPGRYIFSARAYTVD 153

>Sklu_1943.4 YNL001W, Contig c1943 3802-4968
          Length = 388

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 5/40 (12%)

Query: 101 YKRWFGDGSVYEV--LGVLDGIANMTKTDILLRCDDVDGR 138
           YK W+G+  + +   LG +D    +  TD LLR DD++ R
Sbjct: 296 YKAWYGEAEITKACELGAID---TLLITDTLLRSDDINIR 332

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,190,180
Number of extensions: 347150
Number of successful extensions: 834
Number of sequences better than 10.0: 14
Number of HSP's gapped: 832
Number of HSP's successfully gapped: 14
Length of query: 254
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 155
Effective length of database: 13,168,927
Effective search space: 2041183685
Effective search space used: 2041183685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)