Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.82437436017650.0
YGL255W (ZRT1)37636912221e-168
Kwal_23.652238936811421e-156
Scas_693.333473385433e-66
KLLA0D16434g4143675326e-64
CAGL0E01353g4334095337e-64
AGL143C3743445244e-63
CAGL0M04301g3893945063e-60
Sklu_2172.53991613894e-43
Scas_713.51*4291813732e-40
YLR130C (ZRT2)4221673556e-38
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.824
         (369 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.824                                                           684   0.0  
YGL255W (ZRT1) [1745] chr7 (20978..22108) High-affinity zinc tra...   475   e-168
Kwal_23.6522                                                          444   e-156
Scas_693.33                                                           213   3e-66
KLLA0D16434g complement(1384826..1386070) similar to sgd|S000412...   209   6e-64
CAGL0E01353g 127608..128909 similar to tr|Q12436 Saccharomyces c...   209   7e-64
AGL143C [4169] [Homologous to ScYLR130C (ZRT2) - NSH; ScYGL255W ...   206   4e-63
CAGL0M04301g complement(472227..473396) similar to tr|Q12436 Sac...   199   3e-60
Sklu_2172.5 YLR130C, Contig c2172 7809-9008                           154   4e-43
Scas_713.51*                                                          148   2e-40
YLR130C (ZRT2) [3540] chr12 complement(402795..404063) Low-affin...   141   6e-38

>Kwal_14.824
          Length = 374

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/360 (93%), Positives = 337/360 (93%)

Query: 1   MNSSEPWWMQWDPDTVTIGDESVSEAWKTCTIAGVYFGENEYNGSMGARISSIFVIFFVS 60
           MNSSEPWWMQWDPDTVTIGDESVSEAWKTCTIAGVYFGENEYNGSMGARISSIFVIFFVS
Sbjct: 1   MNSSEPWWMQWDPDTVTIGDESVSEAWKTCTIAGVYFGENEYNGSMGARISSIFVIFFVS 60

Query: 61  TLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATAFIHLLDPAYGEIGGDSCVGKTG 120
           TLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATAFIHLLDPAYGEIGGDSCVGKTG
Sbjct: 61  TLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATAFIHLLDPAYGEIGGDSCVGKTG 120

Query: 121 HWADYSWCPAXXXXXXXXXXXXXXASDVYVKRRFGVAHNHGDVIEDAVVKRQGDAHEDLE 180
           HWADYSWCPA              ASDVYVKRRFGVAHNHGDVIEDAVVKRQGDAHEDLE
Sbjct: 121 HWADYSWCPAIVLLTIFIIFLVDLASDVYVKRRFGVAHNHGDVIEDAVVKRQGDAHEDLE 180

Query: 181 SHNNHMHAXXXXXXXXXYDVISDASSEIATESFESQFAAFLILEFGVIFHSVMIGLNLGT 240
           SHNNHMHA         YDVISDASSEIATESFESQFAAFLILEFGVIFHSVMIGLNLGT
Sbjct: 181 SHNNHMHADSDDKSKKSYDVISDASSEIATESFESQFAAFLILEFGVIFHSVMIGLNLGT 240

Query: 241 VGDEFSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLG 300
           VGDEFSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLG
Sbjct: 241 VGDEFSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLG 300

Query: 301 VRTSYNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDFIFDEKRTNDIPRLIFMVGCT 360
           VRTSYNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDFIFDEKRTNDIPRLIFMVGCT
Sbjct: 301 VRTSYNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDFIFDEKRTNDIPRLIFMVGCT 360

>YGL255W (ZRT1) [1745] chr7 (20978..22108) High-affinity zinc
           transport protein, member of ZIP family of metal ion
           transporters [1131 bp, 376 aa]
          Length = 376

 Score =  475 bits (1222), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 227/369 (61%), Positives = 278/369 (75%), Gaps = 1/369 (0%)

Query: 2   NSSEPWWMQWDPDTVTIGDESVSEAWKTCTIAGVYFGENEYNGSMGARISSIFVIFFVST 61
           N + PWW QWDP  VT+ D++  + WKTC + GVYFG NEYNG++GARISS+FVI FVST
Sbjct: 3   NVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGARISSVFVILFVST 62

Query: 62  LFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATAFIHLLDPAYGEIGGDSCVGKTGH 121
            FT+FP+++ +VK +RIP YVYLFA+YFG+GVIVATAFIHL+DPAYG IGG +CVG+TG+
Sbjct: 63  FFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAFIHLMDPAYGAIGGTTCVGQTGN 122

Query: 122 WADYSWCPAXXXXXXXXXXXXXXASDVYVKRRFGVAHNHG-DVIEDAVVKRQGDAHEDLE 180
           W  YSWCPA               S V+V+R++G++H+H  D I+D VV+       + +
Sbjct: 123 WGLYSWCPAIMLTSLTFTFLTDLFSSVWVERKYGLSHDHTHDEIKDTVVRNTAAVSSEND 182

Query: 181 SHNNHMHAXXXXXXXXXYDVISDASSEIATESFESQFAAFLILEFGVIFHSVMIGLNLGT 240
           + N   +          Y   SDA+S    +SF++QF AFLILEFGVIFHSVMIGLNLG+
Sbjct: 183 NENGTANGSHDTKNGVEYYEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGS 242

Query: 241 VGDEFSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLG 300
           VGDEFS LYPVLVFHQSFEGLGIGARLS+I FP+ K WWP+ALC+ YGL TPICVAIGLG
Sbjct: 243 VGDEFSSLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIGLG 302

Query: 301 VRTSYNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDFIFDEKRTNDIPRLIFMVGCT 360
           VRT Y   S+T  ++SGVLDAISAGIL+YTGLVELLARDFIF+ +RT D+  L F V CT
Sbjct: 303 VRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTKDLRELSFNVICT 362

Query: 361 LLGAGLMAL 369
           L GAG+MAL
Sbjct: 363 LFGAGIMAL 371

>Kwal_23.6522
          Length = 389

 Score =  444 bits (1142), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 216/368 (58%), Positives = 266/368 (72%), Gaps = 5/368 (1%)

Query: 2   NSSEPWWMQWDPDTVTIGDESVSEAWKTCTIAGVYFGENEYNGSMGARISSIFVIFFVST 61
            SS  WW QW+P+ VTI DESV  +WK C +  VYFG +EY GS+ ARISSIFV+ FVST
Sbjct: 22  QSSSAWWAQWNPNEVTIWDESVPNSWKKCAMDHVYFGGSEYQGSLPARISSIFVLLFVST 81

Query: 62  LFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATAFIHLLDPAYGEIGGDSCVGKTGH 121
            FTL P+V  ++K +++P+Y YLFARYFGTGVIV+TAFIHL++ +Y  IG +SCVG TGH
Sbjct: 82  SFTLLPIVLNKIKGVKVPRYCYLFARYFGTGVIVSTAFIHLMEHSYMSIGSNSCVGMTGH 141

Query: 122 WADYSWCPAXXXXXXXXXXXXXXASDVYVKRRFGVAHNHGDVIEDAVVKRQGDAHEDLES 181
           WADY+WC                 SDVY++R++G+   HGD IE+A+     D   D+E 
Sbjct: 142 WADYTWCSCIVMVTVFVIFLVDLLSDVYIERKYGLTGGHGDSIEEAITDVHKD-ENDVEC 200

Query: 182 HNNHMHAXXXXXXXXXYDVISDASSEIATESFESQFAAFLILEFGVIFHSVMIGLNLGTV 241
            +  M           +D +  ASS  + +SFESQ  AF +LEFG+IFHSVMIGL LGT 
Sbjct: 201 ASGEM----TKSDDASFDTLFCASSGSSIKSFESQIGAFFVLEFGIIFHSVMIGLELGTT 256

Query: 242 GDEFSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLGV 301
           G EFSVLYPV+VFHQSFEGLG+GARL SI FP+GK WWPYALC  YG+ TPI VAIGLGV
Sbjct: 257 GSEFSVLYPVIVFHQSFEGLGLGARLMSIKFPEGKKWWPYALCGLYGITTPIAVAIGLGV 316

Query: 302 RTSYNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDFIFDEKRTNDIPRLIFMVGCTL 361
           R +YN +SFT++I+SG+LDAISAGILIYTGLVELLA+DFIF+  RT D+ +L  M+  TL
Sbjct: 317 RLTYNAHSFTMSIISGILDAISAGILIYTGLVELLAKDFIFNPNRTKDMTKLSLMIFATL 376

Query: 362 LGAGLMAL 369
            GAGLMA 
Sbjct: 377 SGAGLMAF 384

>Scas_693.33
          Length = 347

 Score =  213 bits (543), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 126/338 (37%), Positives = 187/338 (55%), Gaps = 10/338 (2%)

Query: 39  ENEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATA 98
           +N+YNG    RI S F+I   S L  LFP VA++   IR+P + +  A++FG+GVIVATA
Sbjct: 8   QNDYNGETNIRILSGFMIMISSGLGGLFPFVASKYSFIRLPDWCFFLAKFFGSGVIVATA 67

Query: 99  FIHLLDPAYGEIGGDSCVGKTGHWADYSWCPAXXXXXXXXXXXXXXASDVYVKRRFGVAH 158
           F+HLL PA  E   D C+G  G +ADY W                  S  Y+ + F    
Sbjct: 68  FVHLLQPA-SEALSDPCLG--GTFADYPWAFGICLMSLFFLFFTEIFSHYYISKAFSDEK 124

Query: 159 NHGDVI-EDAVVKRQGDAHEDLESHNNHMHAXXXXXXXXXYDVIS--DASSEIATESFES 215
           +  D I +D+      +A++ +  +++              D I     +++ A E + +
Sbjct: 125 DSSDTISKDSSYDSDLEANQVIPVNDSRPGKQHFSHEEDHQDAIQIGTPANDKAKEQYTN 184

Query: 216 QFAAFLILEFGVIFHSVMIGLNLGTVGDEFSVLYPVLVFHQSFEGLGIGARLSSIAFPKG 275
           Q  A  ILEFG++FHS+ IGL+L   GDEF  L+ VL+FHQ FEGLG+G R++   +P  
Sbjct: 185 QVFAVFILEFGILFHSIFIGLSLAVSGDEFHTLFIVLIFHQMFEGLGLGTRVAETNWPDS 244

Query: 276 --KAWWPYALCITYGLATPICVAIGLGVRTSYNGNSFTVNIVSGVLDAISAGILIYTGLV 333
             K W P+ + + +   TP+ +AIGLGVR S+   S    I +GV D++S+GILIYTGLV
Sbjct: 245 GPKKWTPWLMGLAFTFVTPVAIAIGLGVRHSWVPGSRRALIANGVFDSLSSGILIYTGLV 304

Query: 334 ELLARDFIFDE--KRTNDIPRLIFMVGCTLLGAGLMAL 369
           EL+A +F++    K      ++++       GAG+MAL
Sbjct: 305 ELMAHEFLYSNQFKGPGGFKKMLYAYFFMCCGAGIMAL 342

>KLLA0D16434g complement(1384826..1386070) similar to sgd|S0004122
           Saccharomyces cerevisiae YLR130c ZRT2 low affininty zinc
           transporter, start by similarity
          Length = 414

 Score =  209 bits (532), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 127/367 (34%), Positives = 192/367 (52%), Gaps = 39/367 (10%)

Query: 39  ENEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATA 98
           +N+Y+G    R+ ++F+I     L + FP++++R   IR+P + +  A++FG+GVIVAT 
Sbjct: 46  DNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATG 105

Query: 99  FIHLLDPAYGEIGGDSCVGKTGHWADYSWCPAXXXXXXXXXXXXXXASDVYVKRRFGVAH 158
           FIHLL+PA   +G + C+G  G +ADY W                  +  Y  + +G  +
Sbjct: 106 FIHLLEPAADALG-EECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162

Query: 159 NHGD--------------------------VIEDAVVKRQGDAHEDLESHNNHMHAXXXX 192
           +H                            V E+ V     + +   E    + H     
Sbjct: 163 DHVHSHFPSSKDQKSLEDEDDEDSDKYNQVVDEENVSLTVANNNNGAEITATNPHPSMPG 222

Query: 193 XXXXXYD-------VISDASSEIATESFESQFAAFLILEFGVIFHSVMIGLNLGTVG-DE 244
                +D        I   +   + E +++Q  +  ILEFG+IFHSV IGL L   G DE
Sbjct: 223 SNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDE 282

Query: 245 FSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLGVRTS 304
           F+ L+ VLVFHQ FEG+G+GAR++ +++ K   + P+ L   + L TPI +AIG+GVR S
Sbjct: 283 FNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHS 342

Query: 305 YNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDFIFDE--KRTNDIPRLIFMVGCTLL 362
           Y   S T  I +G  DAISAGILIYTGLVEL+A +F++ +  K  N + ++++       
Sbjct: 343 YAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCW 402

Query: 363 GAGLMAL 369
           GAGLMAL
Sbjct: 403 GAGLMAL 409

>CAGL0E01353g 127608..128909 similar to tr|Q12436 Saccharomyces
           cerevisiae YLR130c ZRT2 or sp|P32804 Saccharomyces
           cerevisiae YGL255w ZRT1, hypothetical start
          Length = 433

 Score =  209 bits (533), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 139/409 (33%), Positives = 196/409 (47%), Gaps = 81/409 (19%)

Query: 39  ENEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATA 98
           +N++NG    RI S+F++   S +   FP++A+R   I +P +V+  A++FG+GVIVATA
Sbjct: 23  DNDFNGHTNLRILSVFMVLISSAIGVYFPLLASRYSFINLPSWVFFIAKFFGSGVIVATA 82

Query: 99  FIHLLDPAYGEIGGDSCVGKTGHWADYSWCPAXXXXXXXXXXXXXXASDVYVKRRFGVAH 158
           FIHLL+PA   + G+ C+G T  +A+Y W                  S  YV +  G  H
Sbjct: 83  FIHLLEPASDSL-GNPCLGGT--FANYPWAFGICLMALFALFLIEIVSHHYVGKTMGGGH 139

Query: 159 NHGDV------------IEDAVVKRQG----------------------------DAHED 178
           NH               +ED +V   G                            D  +D
Sbjct: 140 NHSHNMPTTFGQTHMHGVEDDMVDEDGSSSTHSHSHVAMDDKYGDVVKNNNYNYDDGSDD 199

Query: 179 LES---------------------------HN------NHMHAXXXXXXXXXYDVISDAS 205
           +ES                           HN       HM           +  I+   
Sbjct: 200 IESQKRPAFNVAQQKVRNDSNENDSLVGHVHNTTVDPLEHMPGHNHFSHDEVHQDITQIG 259

Query: 206 SEIATESFE---SQFAAFLILEFGVIFHSVMIGLNLGTVGDEFSVLYPVLVFHQSFEGLG 262
           S+   +  E   +Q  +  ILEFG++FHSV +GL+L   GDEF  L+ V+VFHQ FEG+G
Sbjct: 260 SKANDQQKEQYLNQLTSLFILEFGILFHSVFVGLSLSVSGDEFKTLFVVIVFHQMFEGMG 319

Query: 263 IGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLGVRTSYNGNSFTVNIVSGVLDAI 322
           +GAR++   +P  K W PY L   Y + TPI +AIG+GVR S+   S    IV+GV DAI
Sbjct: 320 LGARITECYWPHSKRWLPYLLGFGYTITTPIAIAIGIGVRHSFVPGSRRSLIVNGVFDAI 379

Query: 323 SAGILIYTGLVELLARDFIFDE--KRTNDIPRLIFMVGCTLLGAGLMAL 369
           SAGIL+Y GLVEL+A +F+F    K  + +  ++       LGAGLMAL
Sbjct: 380 SAGILVYAGLVELMAHEFLFTNQFKGEHGLRNMLAAYFVMALGAGLMAL 428

>AGL143C [4169] [Homologous to ScYLR130C (ZRT2) - NSH; ScYGL255W
           (ZRT1) - NSH] (431959..433083) [1125 bp, 374 aa]
          Length = 374

 Score =  206 bits (524), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 130/344 (37%), Positives = 189/344 (54%), Gaps = 18/344 (5%)

Query: 39  ENEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATA 98
           ENEY+GS G RI S+F+I   S + T FP++ +R   +R+P + + FA+YFG+GVIVAT 
Sbjct: 31  ENEYDGSDGIRILSVFIILLASAIGTFFPMLGSRFSRVRLPTWAFFFAKYFGSGVIVATG 90

Query: 99  FIHLLDPAYGEIGGDSCVGKTGHWADYSWCPAXXXXXXXXXXXXXXASDVYVKRR----- 153
           FIHLL   +  +  + C+G  G  ++Y W  A               S  +V +      
Sbjct: 91  FIHLLLHGHESLS-NPCLG--GVLSEYPWAFAICMMSLFTLFFVEINSHHFVNKAARSTA 147

Query: 154 FGVAHNHGDVIEDAVVKRQGDAHEDLESHNNHMHAXXXXXXXXXYDVISDASSEIA---T 210
             VA +   + ED   +          S  N             +  +  A S  A    
Sbjct: 148 VAVAGDEKSIKEDESTEDTPPKPNTAVSGANSAVVSQHFAHDECHQDLEQAKSLAADPNR 207

Query: 211 ESFESQFAAFLILEFGVIFHSVMIGLNLG-TVGDEFSVLYPVLVFHQSFEGLGIGARLSS 269
           E + +Q  +  ILEFGV+FHSV+IGL+L  T  D F+ L+ VL+FHQ FEG+G+GAR++ 
Sbjct: 208 EQYLNQLISLFILEFGVVFHSVLIGLSLAVTAEDHFTTLFVVLIFHQMFEGMGLGARIAE 267

Query: 270 IAFPKGKAWWPYALCITYGLATPICVAIGLGVRTSYNGNSFTVNIVSGVLDAISAGILIY 329
             +   + W P+ L + Y L+TPI +AIGLGVR S+   S    IV+GV D++SAGI++Y
Sbjct: 268 TEWGVHRKWTPWLLGLGYCLSTPIAIAIGLGVRHSFAPESRPSLIVNGVFDSLSAGIMLY 327

Query: 330 TGLVELLARDFIFDE--KRTNDIPRLI--FMVGCTLLGAGLMAL 369
           TGL+EL+A +F+F    K      +++  F+  C  LGAGLMAL
Sbjct: 328 TGLIELMAHEFLFSNSFKGEGGFNKMMQGFVYMC--LGAGLMAL 369

>CAGL0M04301g complement(472227..473396) similar to tr|Q12436
           Saccharomyces cerevisiae YLR130c ZRT2 or sp|P32804
           Saccharomyces cerevisiae YGL255w ZRT1, hypothetical
           start
          Length = 389

 Score =  199 bits (506), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 126/394 (31%), Positives = 201/394 (51%), Gaps = 56/394 (14%)

Query: 20  DESVSEAWKTCTIAGVYFGENEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIP 79
           +E +  +  TC+       EN+YNG    RI ++F++   S L   FP+++++   IR+P
Sbjct: 3   NELLGRSVDTCST------ENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLP 56

Query: 80  KYVYLFARYFGTGVIVATAFIHLLDPAYGEIGGDSCVGKTGHWADYSWCPAXXXXXXXXX 139
            + +  A++FG+GVI+ATAFIHLL PA  E   D C+G  G + DY W            
Sbjct: 57  NWCFFVAKFFGSGVIIATAFIHLLQPA-AEALTDDCLG--GTFEDYPWAFGICLMSLFML 113

Query: 140 XXXXXASDVYVKRRFGVAH---NHGDVIEDAVVKRQGDAHEDLES-------HNNHMHAX 189
                 +  +V ++F  +H   ++ + + D ++K    + +DL         H + +   
Sbjct: 114 FLAEIVAHHFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDS 173

Query: 190 XXXXXXX--------------XYDVISDASSE-------IATESFESQFAA--------F 220
                                 Y+   +++ E       + T + E +F+A         
Sbjct: 174 KKIETGVSTNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVL 233

Query: 221 LILEFGVIFHSVMIGLNLGTVGDEFSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWP 280
            +LEFG+IFHSV +GL+L   G EF VL+ V+ FHQ FEGLG+G R++   +P  K + P
Sbjct: 234 CVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTP 293

Query: 281 YALCITYGLATPICVAIGLGVRTSYNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDF 340
           + +   + + +PI +AIG+GVR S+   S    I +GV D+IS+GILIYTGL+EL+A +F
Sbjct: 294 WIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEF 353

Query: 341 IFD-----EKRTNDIPRLIFMVGCTLLGAGLMAL 369
           IF      E    ++    F++ C   GA LMAL
Sbjct: 354 IFSNQFKGEHSLRNMLTAYFIMCC---GAALMAL 384

>Sklu_2172.5 YLR130C, Contig c2172 7809-9008
          Length = 399

 Score =  154 bits (389), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 82/161 (50%), Positives = 109/161 (67%), Gaps = 2/161 (1%)

Query: 211 ESFESQFAAFLILEFGVIFHSVMIGLNLGTVGDEFSVLYPVLVFHQSFEGLGIGARLSSI 270
           E + SQ  A  ILEFGV+FHSV +GL+L   GDEF+ L+ VLVFHQ FEGLG+G R++  
Sbjct: 234 EQYLSQVFAVFILEFGVVFHSVFVGLSLAVAGDEFNTLFIVLVFHQMFEGLGLGTRIAET 293

Query: 271 AFPKGKAWWPYALCITYGLATPICVAIGLGVRTSYNGNSFTVNIVSGVLDAISAGILIYT 330
            +P  K + P+ L + Y L+TPI +AIG+GVR S+   S    I +GV D+ISAGILIYT
Sbjct: 294 TWPASKRYTPWLLGLGYTLSTPIAIAIGIGVRHSFAPGSKKALITNGVFDSISAGILIYT 353

Query: 331 GLVELLARDFIFDEKRTND--IPRLIFMVGCTLLGAGLMAL 369
           GLVEL+A +F++ ++   +    R+I       LGAGLMAL
Sbjct: 354 GLVELMAHEFLYSQQFKGEGGCKRMIGAYFIMCLGAGLMAL 394

 Score = 83.6 bits (205), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 60/89 (67%), Gaps = 3/89 (3%)

Query: 39  ENEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATA 98
           +NEY+G    RI ++F+I   S L   FP++++R   IR+P + +  A++FG+GVIVAT 
Sbjct: 16  DNEYDGRDSLRILAVFMILISSGLGAFFPILSSRYSVIRLPAWCFFIAKFFGSGVIVATG 75

Query: 99  FIHLLDPAYGEIGGDSCVGKTGHWADYSW 127
           FIHLL PA   + G++C+G  G +ADY W
Sbjct: 76  FIHLLKPATDNL-GNTCLG--GTFADYPW 101

>Scas_713.51*
          Length = 429

 Score =  148 bits (373), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 115/181 (63%), Gaps = 9/181 (4%)

Query: 198 YDVISDASSEIAT-------ESFESQFAAFLILEFGVIFHSVMIGLNLGTVGDEFSVLYP 250
           +D +   SS+I T       E + +Q  A  ILEFG+IFHSV +GL+L   G+EF  L+ 
Sbjct: 244 HDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHSVFVGLSLSVSGEEFETLFI 303

Query: 251 VLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLGVRTSYNGNSF 310
           VL+FHQ FEGLG+G R++   +PK K + P+ + + + + +PI VAIG+GVR S+   S 
Sbjct: 304 VLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSR 363

Query: 311 TVNIVSGVLDAISAGILIYTGLVELLARDFIFDE--KRTNDIPRLIFMVGCTLLGAGLMA 368
              I +GV D+IS+GILIYTGLVEL+A +F++    K    + +++       +GAGLMA
Sbjct: 364 NALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMA 423

Query: 369 L 369
           L
Sbjct: 424 L 424

 Score = 98.6 bits (244), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 82/158 (51%), Gaps = 12/158 (7%)

Query: 29  TCTIAGVYFGENEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARY 88
           TC ++      N YNG  G RI +IF+I   S L   FP++A+R   I +P++ +  A++
Sbjct: 12  TCEVS------NTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKF 65

Query: 89  FGTGVIVATAFIHLLDPAYGEIGGDSCVGKTGHWADYSWCPAXXXXXXXXXXXXXXASDV 148
           FG+GVIVATAFIHLLDPA  E  G+SC+G  G + +Y W                  +  
Sbjct: 66  FGSGVIVATAFIHLLDPA-AEALGNSCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHY 122

Query: 149 YVKRRFGVAHN---HGDVIEDAVVKRQGDAHEDLESHN 183
           YV + FG   +   H +  ED +   + D   DLE  N
Sbjct: 123 YVAKSFGDHDHDGGHSNHHEDDITSFEADGFTDLERQN 160

>YLR130C (ZRT2) [3540] chr12 complement(402795..404063) Low-affinity
           zinc transport protein, member of the zinc-iron permease
           (ZIP) family of metal ion transporters [1269 bp, 422 aa]
          Length = 422

 Score =  141 bits (355), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 110/167 (65%), Gaps = 6/167 (3%)

Query: 207 EIATESFESQFAAFLILEFGVIFHSVMIGLNLGTVGDEFSVLYPVLVFHQSFEGLGIGAR 266
           E   E + +Q  A  ILEFG+IFHSV +GL+L   G+EF  L+ VL FHQ FEGLG+G R
Sbjct: 253 EEDKEQYLNQILAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTR 312

Query: 267 LSSIAFPKGKAWWPYALCITYGLATPICVAIGLGVRTSYNGNSFTVNIVSGVLDAISAGI 326
           ++   +P+ K + P+ + + + L +PI VA+G+GVR S+   S    I +GV D+IS+GI
Sbjct: 313 VAETNWPESKKYMPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALIANGVFDSISSGI 372

Query: 327 LIYTGLVELLARDFIFDE--KRTNDIPRLI--FMVGCTLLGAGLMAL 369
           LIYTGLVEL+A +F++    K  + + +++  +++ C   GA LMAL
Sbjct: 373 LIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYLIMCC--GAALMAL 417

 Score = 89.4 bits (220), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 69/123 (56%), Gaps = 5/123 (4%)

Query: 40  NEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATAF 99
           N YNG  G RI ++F+I   S L   FP++++R   IR+P + +  A++FG+GVIVATAF
Sbjct: 18  NGYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAF 77

Query: 100 IHLLDPAYGEIGGDSCVGKTGHWADYSWCPAXXXXXXXXXXXXXXASDVYVKRRFGVAHN 159
           +HLL PA  E  GD C+G  G +A+Y W                  +  +V +  G  H+
Sbjct: 78  VHLLQPA-AEALGDECLG--GTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLG--HD 132

Query: 160 HGD 162
           HGD
Sbjct: 133 HGD 135

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.140    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,669,117
Number of extensions: 405762
Number of successful extensions: 1050
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1055
Number of HSP's successfully gapped: 22
Length of query: 369
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 266
Effective length of database: 13,030,455
Effective search space: 3466101030
Effective search space used: 3466101030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 62 (28.5 bits)