Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.81956856029240.0
Kwal_47.17233948331078e-05
Scas_699.7935421042e-04
Scas_720.58890531042e-04
Sklu_2023.3658581042e-04
YPL248C (GAL4)881421042e-04
Kwal_23.4370692531015e-04
KLLA0A09119g1082531015e-04
YHR178W (STB5)743451006e-04
CAGL0D03850g834341006e-04
YHR056C (RSC30)88333997e-04
KLLA0C17050g95533997e-04
YJL206C758101997e-04
YDR303C (RSC3)88533998e-04
AER291C66354980.001
KLLA0D12672g86542980.001
Scas_688.1776933980.001
AFL160C64844970.001
Scas_638.14104346960.002
KLLA0C19228g59143950.002
CAGL0I02552g100543950.002
Kwal_55.2067425234920.003
CAGL0K11902g83162940.003
KLLA0D10153g65544930.003
Scas_663.1294443940.003
CAGL0L04400g98732940.003
Sklu_2434.1098343930.004
CAGL0H01507g794139930.004
Scas_680.2573847930.004
Scas_588.1183533920.005
Scas_721.9486943920.005
ADR403C97030920.005
Scas_590.2117265920.005
Scas_637.799860920.006
AAL057C80933920.006
Kwal_34.1575162836910.006
Kwal_26.709583830910.007
KLLA0A03443g97543910.007
YLR278C134143910.008
Sklu_2191.271834900.008
YBR150C (TBS1)109451900.008
CAGL0J07150g102243900.009
YOR363C (PIP2)99643890.011
CAGL0F07865g84445890.011
KLLA0F04609g91640890.011
Sklu_1622.277858890.012
Kwal_23.290588141890.012
YPR196W47047880.013
Scas_702.7111361890.013
CAGL0G09757g142343890.013
Sklu_1373.260834880.013
Sklu_1973.177733880.013
Scas_556.6102230880.014
CAGL0C01199g92267880.015
Scas_679.2677546880.015
Scas_526.3110943880.015
AGR280C110643880.016
Scas_518.591951870.019
Kwal_23.312278838870.020
YDR034C (LYS14)79072870.020
YKL222C70548870.021
Sklu_2321.390641860.024
KLLA0F22880g116439860.025
YOR162C (YRR1)810154860.026
CAGL0D02904g88729860.029
Kwal_56.2456675563850.033
KLLA0F00572g59745840.037
YLR228C (ECM22)81440850.038
CAGL0A00451g110751850.038
Kwal_26.680594453840.041
KLLA0F10835g75631840.042
KLLA0C10923g77542840.045
KLLA0C16489g72868840.048
YLR014C (PPR1)90432840.049
ACR028C60131830.049
ACL058W81755840.049
KLLA0F09559g65834830.050
YDR213W (UPC2)91331830.054
KLLA0E19701g68144830.054
KLLA0F20680g78734830.058
CAGL0M12298g99435830.064
KLLA0C04620g126945830.067
KLLA0A10329g63956820.069
YOR172W (YRM1)78636820.074
AGL233C87232820.077
KLLA0D15356g62476820.077
KLLA0C03201g65047820.083
KLLA0D00484g100431820.085
KLLA0A06039g65742810.090
KLLA0A04169g77538810.096
YGL013C (PDR1)106841810.096
KLLA0D09977g63425810.100
KLLA0A03421g88043810.10
Kwal_56.2305877552810.11
AGL099C74734810.11
CAGL0B03421g135534810.11
YLR256W (HAP1)150234810.11
YML099C (ARG81)88032810.11
Sklu_2064.292230810.12
CAGL0F07909g104967800.12
Scas_573.4147825800.13
AFR117C115234800.13
YIL130W96443800.14
Scas_550.5*83237800.14
Kwal_47.1808974532800.14
AGL091W86649800.15
KLLA0A09251g68832800.15
AGL361C69655790.15
KLLA0F18084g86056790.16
Kwal_23.642573535790.17
Kwal_23.317861143790.17
KLLA0D05038g67363790.18
Scas_674.12*90930790.18
Kwal_55.2072282730790.19
Sklu_2397.884832790.19
CAGL0I07755g105357790.20
ABL099W80047780.20
KLLA0F02299g87268780.21
Kwal_23.475481237780.21
KLLA0F22990g125325780.22
Kwal_27.968884132780.22
YBR297W (MAL33)46841770.24
YLR266C (PDR8)70136770.26
AFR096W85245770.27
CAGL0M03025g125445780.28
YJL089W (SIP4)82958770.28
YFL052W46566770.29
KLLA0D01452g144545770.30
KLLA0C14212g104042770.30
Sklu_2301.151744770.31
ADR405C80762770.31
YAL051W (OAF1)106230770.31
Sklu_1993.282340770.32
Sklu_2411.1168731760.35
Scas_626.683932770.35
Sklu_2376.692253760.36
Kwal_47.1750692431760.37
ABL121C128545760.38
CAGL0F02519g83244760.46
Scas_521.289029760.46
Kwal_27.10232120945760.47
CAGL0K05841g137225760.47
YGR288W (MAL13)47341750.48
Kwal_14.2619116733750.49
AGR061C61231750.50
Scas_657.385634750.57
Scas_696.44116471750.60
KLLA0F04213g76831740.60
Scas_659.1075737740.62
Sklu_2082.18233670.67
YOL089C (HAL9)103050740.67
CAGL0F05357g60134740.68
YBL005W (PDR3)97631740.80
Kwal_26.673267635730.84
Kwal_8.58063849730.88
YMR280C (CAT8)143329730.90
CAGL0A01914g3743154730.91
Scas_662.890638730.91
CAGL0L04576g86547730.92
YBR240C (THI2)45044720.93
Kwal_47.1756562866730.98
Sklu_2296.691956731.00
ACL096W83555731.0
Kwal_26.744871429721.3
Sklu_2335.694041721.3
CAGL0M05907g89134721.4
AAL175W88332711.5
YDL170W (UGA3)52831711.5
Scas_669.863728711.5
Scas_709.5175949711.5
Kwal_56.2467064347711.5
KLLA0D10197g85632711.6
Kwal_56.2335819638691.7
Kwal_23.351457947701.7
Scas_540.3101955711.8
YKL015W (PUT3)97957701.9
Kwal_26.810997051701.9
Scas_661.2374147701.9
CAGL0F07755g61127702.1
AFR171W61231702.1
Scas_702.7d97862702.2
Scas_596.470127702.2
Sklu_2384.683157702.2
AER370W80149702.3
YLL054C76930692.4
YMR168C (CEP3)60830692.5
Scas_711.3193229692.7
Scas_542.890238692.9
Kwal_14.91582254693.0
AER183C87952683.3
YPL078C (ATP4)244103673.4
Sklu_2210.2395224673.5
Kwal_26.701465430674.0
KLLA0F02750g114847674.3
KLLA0D16753g322109664.6
CAGL0H06875g70229674.6
Sklu_2268.287525674.7
KLLA0F14322g71745674.8
KLLA0E18194g86540674.8
KLLA0E02618g110955674.9
YMR019W (STB4)94939674.9
Sklu_2297.545491665.2
KLLA0F10373g34838665.2
Kwal_56.2260586557675.4
AFL200W59630665.5
Kwal_14.163144343665.8
KLLA0A01804g94542665.9
YCR106W (RDS1)83247666.3
KLLA0F19602g60339666.3
Scas_630.1470132666.4
Kwal_26.666457939666.6
CAGL0G08844g84741667.0
ADR199C94437667.1
KLLA0E14036g67832657.2
YDR207C (UME6)83639657.2
CAGL0F09229g83533657.5
YBL066C (SEF1)105754657.9
KLLA0D12650g65144657.9
CAGL0E05434g81630658.0
Kwal_23.401662844658.6
CAGL0L01903g128733658.7
YLR451W (LEU3)88641659.2
KLLA0E02222g48045649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.819
         (560 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.819                                                          1130   0.0  
Kwal_47.17233                                                          46   8e-05
Scas_699.7                                                             45   2e-04
Scas_720.58                                                            45   2e-04
Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement         45   2e-04
YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcripti...    45   2e-04
Kwal_23.4370                                                           44   5e-04
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    44   5e-04
YHR178W (STB5) [2464] chr8 (459297..461528) Probable transcripti...    43   6e-04
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    43   6e-04
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    43   7e-04
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    43   7e-04
YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein ...    43   7e-04
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    43   8e-04
AER291C [2793] [Homologous to ScYHR178W (STB5) - SH] (1172383..1...    42   0.001
KLLA0D12672g complement(1076011..1078608) gi|125903|sp|P08657|LA...    42   0.001
Scas_688.17                                                            42   0.001
AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH] (130842..13...    42   0.001
Scas_638.14                                                            42   0.002
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    41   0.002
CAGL0I02552g 227257..230274 weakly similar to sp|P38699 Saccharo...    41   0.002
Kwal_55.20674                                                          40   0.003
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    41   0.003
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    40   0.003
Scas_663.12                                                            41   0.003
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    41   0.003
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         40   0.004
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    40   0.004
Scas_680.25                                                            40   0.004
Scas_588.11                                                            40   0.005
Scas_721.94                                                            40   0.005
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    40   0.005
Scas_590.2                                                             40   0.005
Scas_637.7                                                             40   0.006
AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C (R...    40   0.006
Kwal_34.15751                                                          40   0.006
Kwal_26.7095                                                           40   0.007
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    40   0.007
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    40   0.008
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         39   0.008
YBR150C (TBS1) [335] chr2 complement(541165..544449) Protein wit...    39   0.008
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    39   0.009
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    39   0.011
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    39   0.011
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    39   0.011
Sklu_1622.2 YDR034C, Contig c1622 1522-3858                            39   0.012
Kwal_23.2905                                                           39   0.012
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    39   0.013
Scas_702.7                                                             39   0.013
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    39   0.013
Sklu_1373.2 YDR207C, Contig c1373 1069-2895                            39   0.013
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          39   0.013
Scas_556.6                                                             39   0.014
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    39   0.015
Scas_679.26                                                            39   0.015
Scas_526.3                                                             39   0.015
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    39   0.016
Scas_518.5                                                             38   0.019
Kwal_23.3122                                                           38   0.020
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    38   0.020
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    38   0.021
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           38   0.024
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    38   0.025
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    38   0.026
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    38   0.029
Kwal_56.24566                                                          37   0.033
KLLA0F00572g complement(42710..44503) some similarities with ca|...    37   0.037
YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol r...    37   0.038
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    37   0.038
Kwal_26.6805                                                           37   0.041
KLLA0F10835g 997512..999782 no similarity, hypothetical start          37   0.042
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    37   0.045
KLLA0C16489g 1444456..1446642 some similarities with ca|CA2184|I...    37   0.048
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    37   0.049
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    37   0.049
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    37   0.049
KLLA0F09559g complement(876719..878695) some similarities with s...    37   0.050
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    37   0.054
KLLA0E19701g complement(1739869..1741914) some similarities with...    37   0.054
KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001 Saccha...    37   0.058
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    37   0.064
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    37   0.067
KLLA0A10329g 903873..905792 some similarities with ca|CA6113|IPF...    36   0.069
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    36   0.074
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    36   0.077
KLLA0D15356g 1301848..1303722 no similarity, hypothetical start        36   0.077
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    36   0.083
KLLA0D00484g 44879..47893 no similarity, hypothetical start            36   0.085
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    36   0.090
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    36   0.096
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    36   0.096
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    36   0.100
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    36   0.10 
Kwal_56.23058                                                          36   0.11 
AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH] (516587..51...    36   0.11 
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    36   0.11 
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    36   0.11 
YML099C (ARG81) [3872] chr13 complement(74398..77040) Component ...    36   0.11 
Sklu_2064.2 , Contig c2064 873-3641                                    36   0.12 
CAGL0F07909g 776659..779808 some similarities with tr|Q12180 Sac...    35   0.12 
Scas_573.4                                                             35   0.13 
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    35   0.13 
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    35   0.14 
Scas_550.5*                                                            35   0.14 
Kwal_47.18089                                                          35   0.14 
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    35   0.15 
KLLA0A09251g 808253..810319 some similarities with sp|P38699 Sac...    35   0.15 
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    35   0.15 
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    35   0.16 
Kwal_23.6425                                                           35   0.17 
Kwal_23.3178                                                           35   0.17 
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    35   0.18 
Scas_674.12*                                                           35   0.18 
Kwal_55.20722                                                          35   0.19 
Sklu_2397.8 YML099C, Contig c2397 9784-12330                           35   0.19 
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    35   0.20 
ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH] complement(...    35   0.20 
KLLA0F02299g 205549..208167 no similarity, hypothetical start          35   0.21 
Kwal_23.4754                                                           35   0.21 
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    35   0.22 
Kwal_27.9688                                                           35   0.22 
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    34   0.24 
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    34   0.26 
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    34   0.27 
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    35   0.28 
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    34   0.28 
YFL052W (YFL052W) [1632] chr6 (28232..29629) Protein with strong...    34   0.29 
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    34   0.30 
KLLA0C14212g complement(1229219..1232341) some similarities with...    34   0.30 
Sklu_2301.1 , Contig c2301 1246-2795 reverse complement                34   0.31 
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    34   0.31 
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    34   0.31 
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         34   0.32 
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      34   0.35 
Scas_626.6                                                             34   0.35 
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              34   0.36 
Kwal_47.17506                                                          34   0.37 
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    34   0.38 
CAGL0F02519g 245120..247618 weakly similar to sp|P39529 Saccharo...    34   0.46 
Scas_521.2                                                             34   0.46 
Kwal_27.10232                                                          34   0.47 
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    34   0.47 
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    33   0.48 
Kwal_14.2619                                                           33   0.49 
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    33   0.50 
Scas_657.3                                                             33   0.57 
Scas_696.44                                                            33   0.60 
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    33   0.60 
Scas_659.10                                                            33   0.62 
Sklu_2082.1 YER184C, Contig c2082 2025-2273                            30   0.67 
YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein i...    33   0.67 
CAGL0F05357g 541830..543635 some similarities with sp|P39001 Sac...    33   0.68 
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    33   0.80 
Kwal_26.6732                                                           33   0.84 
Kwal_8.580                                                             33   0.88 
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    33   0.90 
CAGL0A01914g 190454..201685 highly similar to sp|P38811 Saccharo...    33   0.91 
Scas_662.8                                                             33   0.91 
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    33   0.92 
YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger...    32   0.93 
Kwal_47.17565                                                          33   0.98 
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       33   1.00 
ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH] complement(1...    33   1.0  
Kwal_26.7448                                                           32   1.3  
Sklu_2335.6 YBL005W, Contig c2335 10191-13013                          32   1.3  
CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces c...    32   1.4  
AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH] complement(...    32   1.5  
YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional activ...    32   1.5  
Scas_669.8                                                             32   1.5  
Scas_709.51                                                            32   1.5  
Kwal_56.24670                                                          32   1.5  
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...    32   1.6  
Kwal_56.23358                                                          31   1.7  
Kwal_23.3514                                                           32   1.7  
Scas_540.3                                                             32   1.8  
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    32   1.9  
Kwal_26.8109                                                           32   1.9  
Scas_661.23                                                            32   1.9  
CAGL0F07755g complement(755947..757782) similar to sp|P40969 Sac...    32   2.1  
AFR171W [3363] [Homologous to NOHBY] complement(752592..754430) ...    32   2.1  
Scas_702.7d                                                            32   2.2  
Scas_596.4                                                             32   2.2  
Sklu_2384.6 YKL015W, Contig c2384 10929-13424                          32   2.2  
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    32   2.3  
YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein ...    31   2.4  
YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component...    31   2.5  
Scas_711.31                                                            31   2.7  
Scas_542.8                                                             31   2.9  
Kwal_14.915                                                            31   3.0  
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    31   3.3  
YPL078C (ATP4) [5365] chr16 complement(408005..408739) Subunit b...    30   3.4  
Sklu_2210.2 , Contig c2210 3292-4479                                   30   3.5  
Kwal_26.7014                                                           30   4.0  
KLLA0F02750g complement(250368..253814) some similarities with s...    30   4.3  
KLLA0D16753g 1418383..1419351 similar to sgd|S0004127 Saccharomy...    30   4.6  
CAGL0H06875g complement(682518..684626) some similarities with s...    30   4.6  
Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement         30   4.7  
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    30   4.8  
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    30   4.8  
KLLA0E02618g 244696..248025 no similarity, hypothetical start          30   4.9  
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    30   4.9  
Sklu_2297.5 YLR098C, Contig c2297 8133-9497                            30   5.2  
KLLA0F10373g 957948..958994 some similarities with sp|P38141 Sac...    30   5.2  
Kwal_56.22605                                                          30   5.4  
AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH] complement(...    30   5.5  
Kwal_14.1631                                                           30   5.8  
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    30   5.9  
YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similari...    30   6.3  
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    30   6.3  
Scas_630.14                                                            30   6.4  
Kwal_26.6664                                                           30   6.6  
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    30   7.0  
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    30   7.1  
KLLA0E14036g complement(1239566..1241602) some similarities with...    30   7.2  
YDR207C (UME6) [1046] chr4 complement(865005..867515) Global tra...    30   7.2  
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    30   7.5  
YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with...    30   7.9  
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    30   7.9  
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    30   8.0  
Kwal_23.4016                                                           30   8.6  
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    30   8.7  
YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription fac...    30   9.2  
KLLA0E02222g complement(208267..209709) weakly similar to ca|CA1...    29   9.9  

>Kwal_14.819
          Length = 568

 Score = 1130 bits (2924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/560 (97%), Positives = 548/560 (97%)

Query: 1   MSSLITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKR 60
           MSSLITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKR
Sbjct: 1   MSSLITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKR 60

Query: 61  KNDNTRFYGLSSVNRVLFEVGMPFCNVDYELENKLAPSHMKKLTSSLVYQKYIEDPQDAL 120
           KNDNTRFYGLSSVNRVLFEVGMPFCNVDYELENKLAPSHMKKLTSSLVYQKYIEDPQDAL
Sbjct: 61  KNDNTRFYGLSSVNRVLFEVGMPFCNVDYELENKLAPSHMKKLTSSLVYQKYIEDPQDAL 120

Query: 121 AAIKRIQSSVGCSLFEEIVDLGALEHTLSSGREVDYQGLILTYAVIIVSERFVTPAPDVA 180
           AAIKRIQSSVGCSLFEEIVDLGALEHTLSSGREVDYQGLILTYAVIIVSERFVTPAPDVA
Sbjct: 121 AAIKRIQSSVGCSLFEEIVDLGALEHTLSSGREVDYQGLILTYAVIIVSERFVTPAPDVA 180

Query: 181 DLIDELTFAIEECPDCLEKVSALILLADYYHYNFKIETAWKRTFLATSIAYALGLHLESS 240
           DLIDELTFAIEECPDCLEKVSALILLADYYHYNFKIETAWKRTFLATSIAYALGLHLESS
Sbjct: 181 DLIDELTFAIEECPDCLEKVSALILLADYYHYNFKIETAWKRTFLATSIAYALGLHLESS 240

Query: 241 KVWPMLVLHDALLCSIVGRPSSIKAVDSQRTSNACHDWGEIAVLLRDSNEILLAACDWTI 300
           KVWPMLVLHDALLCSIVGRPSSIKAVDSQRTSNACHDWGEIAVLLRDSNEILLAACDWTI
Sbjct: 241 KVWPMLVLHDALLCSIVGRPSSIKAVDSQRTSNACHDWGEIAVLLRDSNEILLAACDWTI 300

Query: 301 EKVISLDFRFNDLIERVKNDMNKSSMVENPNKTLLGYLKLGILTASRVKLIFSVYTKNEV 360
           EKVISLDFRFNDLIERVKNDMNKSSMVENPNKTLLGYLKLGILTASRVKLIFSVYTKNEV
Sbjct: 301 EKVISLDFRFNDLIERVKNDMNKSSMVENPNKTLLGYLKLGILTASRVKLIFSVYTKNEV 360

Query: 361 SATKKETLKSLLDQNCCDLTQCLRGVFKVLTSSGMADQNNPFFLRSQCFLAYCSIFQGLL 420
           SATKKETLKSLLDQNCCDLTQCLRGVFKVLTSSGMADQNNPFFLRSQCFLAYCSIFQGLL
Sbjct: 361 SATKKETLKSLLDQNCCDLTQCLRGVFKVLTSSGMADQNNPFFLRSQCFLAYCSIFQGLL 420

Query: 421 LQLHFCSTQEFDSKKEAPPLYFPLPRDTNHEEACLPSLRTIEFLLADYDTLSKSVHFCHY 480
           LQLHFCSTQEFDSKKEAPPLYFPLPRDTNHEEACLPSLRTIEFLLADYDTLSKSVHFCHY
Sbjct: 421 LQLHFCSTQEFDSKKEAPPLYFPLPRDTNHEEACLPSLRTIEFLLADYDTLSKSVHFCHY 480

Query: 481 MLDVFNSFRVXXXXXXXXXXXXQEHQHGCTLEDFTADSNSHASDFSDASKDVTANVSSLP 540
           MLDVFNSFRV            QEHQHGCTLEDFTADSNSHASDFSDASKDVTANVSSLP
Sbjct: 481 MLDVFNSFRVLLNRKNHKLHNLQEHQHGCTLEDFTADSNSHASDFSDASKDVTANVSSLP 540

Query: 541 YVTDDIADWITACFAEEVPN 560
           YVTDDIADWITACFAEEVPN
Sbjct: 541 YVTDDIADWITACFAEEVPN 560

>Kwal_47.17233
          Length = 948

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          I+SC  C  RK++C+R+ P C  C K+N EC Y
Sbjct: 32 ILSCVPCHKRKIKCTRETPSCSKCLKKNWECSY 64

>Scas_699.7
          Length = 935

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY-PQTQRKTSTK 55
          +C  CR +K++CS++ PKC  C K N EC Y P+T+R   T+
Sbjct: 12 ACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTR 53

>Scas_720.58
          Length = 890

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 3/53 (5%)

Query: 8  SQGLSII--SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY-PQTQRKTSTKLN 57
          S+ L II  +C  CR +K++CS++ PKC  C K   +C Y P+ +R   T+++
Sbjct: 10 SKALDIIEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTRVH 62

>Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement
          Length = 658

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 3/58 (5%)

Query: 2  SSLITD--SQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP-QTQRKTSTKL 56
          +S+ TD  SQ     SC +CR  K +CS+++P C++C++   EC YP +  R+T  +L
Sbjct: 8  TSITTDRESQQNEPYSCSRCRRLKKKCSKELPACRNCSRAGEECTYPGRAARRTKKQL 65

>YPL248C (GAL4) [5202] chr16 complement(79711..82356)
          Transcription factor involved in expression of
          galactose-induced genes, phosphorylation correlates
          with activity [2646 bp, 881 aa]
          Length = 881

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY-PQTQRKTSTK 55
          +C  CR +K++CS++ PKC  C K N EC Y P+T+R   T+
Sbjct: 10 ACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTR 51

>Kwal_23.4370
          Length = 692

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 13  IISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP-QTQRKTSTKLNKKRKNDN 64
           + SC +CR  K RCS++ P C SC K    C YP +  R+T  +L + R+ ++
Sbjct: 70  LYSCSRCRKLKKRCSKESPVCVSCAKAGESCTYPGRAPRRTRKELERVRRENS 122

>KLLA0A09119g complement(797533..800781) weakly similar to sp|P12383
           Saccharomyces cerevisiae YGL013c PDR1 transcription
           factor, start by similarity
          Length = 1082

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTRF 67
           +C  CR +K++CS  +P CKSC    CEC Y       +    K  K+D++ F
Sbjct: 54  ACDSCRKKKIKCSGTLP-CKSCETYGCECVYSHAPYGVAKGKKKTAKSDSSAF 105

>YHR178W (STB5) [2464] chr8 (459297..461528) Probable
          transcriptional activator of multidrug resistance genes
          such as PDR5 and SNQ2 [2232 bp, 743 aa]
          Length = 743

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP-QTQRKTSTKL 56
          + SC +CR  K +C +QIP C +C K    C YP +  R+T  +L
Sbjct: 19 LYSCARCRKLKKKCGKQIPTCANCDKNGAHCSYPGRAPRRTKKEL 63

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
          Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRN-CECFYPQ 47
          +C+QCR RK+ C R  P C +C K+   +CFYP+
Sbjct: 15 ACQQCRRRKIGCDRGKPICGNCLKQGKTDCFYPK 48

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component
          of the abundant RSC chromatin remodeling complex [2652
          bp, 883 aa]
          Length = 883

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRN-CECFYP 46
          +C QCR RK+ C R  P C +C K N  +CFYP
Sbjct: 14 ACTQCRKRKIGCDRAKPICGNCVKYNKPDCFYP 46

>KLLA0C17050g 1490472..1493339 some similarities with
          ca|CA3454|IPF10533.exon1 Candida albicans unknown
          function, exon 1, hypothetical start
          Length = 955

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          I+SC  C  RK++C R  P C+SC K   EC Y
Sbjct: 43 ILSCVACHKRKIKCDRAKPVCESCGKNGWECLY 75

>YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein
           with weak similarity to Put3p and other transcription
           factors, has a Zn[2]-Cys[6] fungal-type binuclear
           cluster domain in the N-terminal region [2277 bp, 758
           aa]
          Length = 758

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 54/101 (53%), Gaps = 6/101 (5%)

Query: 8   SQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTRF 67
           ++G +  +C  CR RKVRCS  IP C+ C   + EC Y +  R +S   +++  +D++ +
Sbjct: 39  TKGRAHRACIACRKRKVRCSGNIP-CRLCQTNSYECKYDRPPRNSSV-FDREVSDDSSLY 96

Query: 68  YGLSSVNRVLFEVGMPFCNVDYE--LENKLAPSHMKKLTSS 106
              +S  R   +   P  ++DY+  +E    P  ++++ +S
Sbjct: 97  AQRASHERE--DSKGPISSIDYKKVVETIFPPETLRQILAS 135

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
          of the abundant RSC chromatin remodeling complex [2658
          bp, 885 aa]
          Length = 885

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRN-CECFYP 46
          +C QCR RK+ C R  P C +C K N  +CFYP
Sbjct: 13 ACVQCRKRKIGCDRVKPICGNCMKHNKMDCFYP 45

>AER291C [2793] [Homologous to ScYHR178W (STB5) - SH]
          (1172383..1174374) [1992 bp, 663 aa]
          Length = 663

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 6  TDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP-QTQRKTSTKLNK 58
          +  Q     SC +CR  K +CS+++P+C SC   + EC YP +  R+T  +L +
Sbjct: 13 SGQQRYETYSCSRCRRLKKKCSKELPRCFSCEAASKECVYPGRAPRRTKKQLEE 66

>KLLA0D12672g complement(1076011..1078608)
           gi|125903|sp|P08657|LAC9_KLULA Kluyveromyces lactis
           Lactose regulatory protein LAC9, start by similarity
          Length = 865

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY-PQTQRKTSTK 55
           +C  CR +K +CS+ +P C +C K N +C Y PQ  R   T+
Sbjct: 94  ACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTR 135

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 22/84 (26%)

Query: 202 ALILLADYYHYNFKIETAWKRTFLATSIAYALGLHLESSKVWPMLVLHDALLCSIV---- 257
           ALILL  Y     K  TAW    L + +A +LGLH +     P   +HD  L  ++    
Sbjct: 472 ALILLTHYVQKMHKPNTAWSLIGLCSHMATSLGLHRDL----PNSTIHDQQLRRVLWWTI 527

Query: 258 -----------GRPS---SIKAVD 267
                      GRPS   +++A+D
Sbjct: 528 YCTGCDLSLETGRPSLLPNLQAID 551

>Scas_688.17
          Length = 769

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTK-RNCECFYP 46
          +C QCR RK+ C R  PKC +C K +  +C YP
Sbjct: 16 ACIQCRKRKIGCDRGHPKCGNCIKLKRAQCIYP 48

>AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH]
          (130842..132788) [1947 bp, 648 aa]
          Length = 648

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY-PQTQRKTSTK 55
          I +C  CR RK++CS+  PKC  C + N  C Y P+ +R   T+
Sbjct: 6  IQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTR 49

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 202 ALILLADYYHYNFKIETAWKRTFLATSIAYALGLH 236
           AL+L+A Y +      TAW    LA+ +A +LGLH
Sbjct: 258 ALLLMAHYNYMTHHRNTAWMLLGLASQLATSLGLH 292

>Scas_638.14
          Length = 1043

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKR 60
          +C  CR RK++C+ + P C +C    C C Y   +RKTS + N  +
Sbjct: 47 ACDNCRKRKIKCTGKQP-CATCEAYQCPCIYSTQKRKTSKRNNTAK 91

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKL 56
          ++C +C+ RK +C  Q P C+ CTK N +C Y   +RK   K+
Sbjct: 1  MACLECKKRKQKCDGQKP-CRRCTKLNVKCIYGTDRRKDKRKI 42

>CAGL0I02552g 227257..230274 weakly similar to sp|P38699
          Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
          protein, hypothetical start
          Length = 1005

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP-QTQRKTSTKL 56
          SC +CR  K +C RQ+P+C +C K    C YP +  R+T  +L
Sbjct: 31 SCARCRKLKKKCPRQLPECSNCLKAREPCNYPGRAPRRTKKEL 73

>Kwal_55.20674
          Length = 252

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 23/34 (67%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          ++ +C+ CR RK +CSR+ P+C+ C + +  C Y
Sbjct: 17 AMFTCKSCRQRKRKCSREKPQCQRCARLSIPCVY 50

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 9/62 (14%)

Query: 3   SLITDSQGLSII------SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY---PQTQRKTS 53
           S I D++G ++        C +C+ R+++C    PKC  CT+ N +C Y   P+ +++ +
Sbjct: 185 STIKDAEGNTVKRKYSRNGCAECKRRRMKCDESKPKCWQCTRLNRDCVYILNPKNKKRKT 244

Query: 54  TK 55
           +K
Sbjct: 245 SK 246

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP---QTQRKTSTK 55
          SC  C+ RK +C R+ P C +C K+  EC Y    Q+Q    TK
Sbjct: 11 SCLMCQRRKKKCDRKAPSCSACLKKGYECIYNVNLQSQLVDGTK 54

>Scas_663.12
          Length = 944

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNK 58
          C+ CR  KV+C ++ P C  C+K + EC Y  T++      NK
Sbjct: 40 CQGCRRSKVKCDQEKPVCSRCSKHDLECVYDVTKQHAPRNPNK 82

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCE-CFY 45
          SC  CR RK++C +Q P+C SC +RN   C Y
Sbjct: 36 SCAFCRKRKLKCDKQKPRCSSCARRNLPVCVY 67

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 3/43 (6%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFY---PQTQRKTSTK 55
          C+ CR  K +C R+ P C  C K   EC Y    QTQ +  +K
Sbjct: 28 CKACRKSKTKCDREKPSCTRCIKNGIECVYDIEQQTQPRNPSK 70

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
           Saccharomyces cerevisiae YDR303c RSC3, start by
           similarity
          Length = 794

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 63/139 (45%), Gaps = 9/139 (6%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRN-CECFYPQT--QRKTSTKLNKKRKNDNTRFYGLS 71
           +C QCR RKV C R  P C +C +    +CFYP    Q   +   +   +N + R   +S
Sbjct: 13  ACAQCRRRKVGCDRVRPVCGNCARAGKGDCFYPDVPGQYIQNNGGSPLPQNGSGRPEEIS 72

Query: 72  SVNRVL-FEVGMPFCNVDYELENKLAPSHMKKLTSSLVYQKYIEDPQDALAAIKRIQSSV 130
           +V+++  +   +   N+D   E   AP      TS+  + K +       + +  +Q   
Sbjct: 73  TVDQIREYNTRLQLSNMDGN-ELPQAPKQYIPRTSTFPHNKEVPSGSSMRSNVNWVQ--- 128

Query: 131 GCSLF-EEIVDLGALEHTL 148
           G ++F +E V+ G  E  L
Sbjct: 129 GPAIFVDEGVNYGQDEAVL 147

>Scas_680.25
          Length = 738

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY-PQTQRKTSTKLNKKR 60
          SC +CR  K +C RQ P C +C K +  C Y  +  R+T  +L + R
Sbjct: 15 SCSRCRRLKKKCPRQTPSCANCEKAHATCIYVGRAPRRTKRELEEAR 61

>Scas_588.11
          Length = 835

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRN-CECFYP 46
          +C QCR RK+ C R  P C +C K N  +CF+P
Sbjct: 13 ACVQCRKRKIGCDRVKPICGNCRKTNKGDCFFP 45

>Scas_721.94
          Length = 869

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 3/43 (6%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQ---RKTST 54
           C  C+ R+V+C    P C+ C   N  C YP  Q   RK ST
Sbjct: 54 GCTHCKRRRVKCDELKPACRRCLNWNVPCVYPVVQPKKRKVST 96

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          C+ CR  K +C R+ P+C  C K N +C Y
Sbjct: 32 CQACRKSKTKCDREKPRCSRCAKNNVKCVY 61

>Scas_590.2
          Length = 1172

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 1  MSSLITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKR 60
          + +L+ D +G S  +C  CR RK +C  Q+P C +C K   +C  P       ++ N+K 
Sbjct: 27 IDTLLRDKKGRST-ACLLCRRRKQKCDHQLPSCTACLKAAVKCVQP-------SRYNEKH 78

Query: 61 KNDNT 65
          ++D+ 
Sbjct: 79 ESDDN 83

>Scas_637.7
          Length = 998

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 6/60 (10%)

Query: 15  SCRQCRDRKVRCSRQIP---KCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTRFYGLS 71
           +C  CR RK++C +  P   KC +C K N  C +   +R     LN +R +D+T    LS
Sbjct: 105 ACDHCRKRKIKCDKVDPSTGKCSNCLKYNANCTF---KRGRDNVLNNRRTSDDTTSSALS 161

>AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C
          (RSC30) - SH] (246899..249328) [2430 bp, 809 aa]
          Length = 809

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRN-CECFYP 46
          +C QCR RK+ C R  P C +C +    +CFYP
Sbjct: 15 ACVQCRKRKIGCDRAKPLCGNCVRNGKSDCFYP 47

>Kwal_34.15751
          Length = 628

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRK 51
          C  CR RK++C++Q P C  C K + +C Y   +R+
Sbjct: 15 CDACRIRKLKCNKQKPSCSRCVKHDLQCVYTPYRRE 50

>Kwal_26.7095
          Length = 838

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          CR C+ RK++C +  P C  C+K   EC Y
Sbjct: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY 59

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 975

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 9  QGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRK 51
          Q +S + C+ CR  K +C R+ P+C  C K + +C Y   Q+K
Sbjct: 29 QRISFV-CQACRKNKTKCDREKPRCGRCVKYHLKCVYDVEQQK 70

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 4  LITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP 46
          L+ D +G S  SC  CR RK RC  ++P C +C K   +C  P
Sbjct: 30 LLQDKKGRSR-SCLLCRRRKQRCDHKLPSCTACLKAGIKCVQP 71

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSCTKRNC-ECFY 45
          I SC  CR RK++C  + PKC +C  RN  EC Y
Sbjct: 16 IKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVY 49

>YBR150C (TBS1) [335] chr2 complement(541165..544449) Protein with
           similarity to transcription factors, contains an
           N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
           domain [3285 bp, 1094 aa]
          Length = 1094

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 15  SCRQCRDRKVRCSRQIP---KCKSCTKRNCEC---FYPQTQRKTSTKLNKK 59
           +C  CR RK+RC+   P   KC++C K N +C   F+ + +R+    LN K
Sbjct: 106 ACDYCRKRKIRCTEIEPISGKCRNCIKYNKDCTFHFHEELKRRREEALNNK 156

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 20/43 (46%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNK 58
          C+ CR  K +C ++ P C  C K    C Y  T +K     NK
Sbjct: 23 CQGCRKAKTKCDKEKPACSRCLKHGIRCVYDLTSQKAPKNPNK 65

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNK 58
          C+ CR  K +C ++ P+C  CTK+N  C Y   ++      NK
Sbjct: 25 CQACRKAKTKCDQEKPRCGRCTKQNLFCIYDVARQAAPRNPNK 67

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, start by
          similarity
          Length = 844

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 3/45 (6%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQ---RKTSTKL 56
           C  C+ R+V+C    P C  C K   EC Y   Q   R+T T++
Sbjct: 53 GCDHCKRRRVKCDEGKPMCDKCVKMKLECVYTPVQPPKRRTRTRV 97

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTST 54
          +C +CR +KV+C  + P C  CT  N EC Y Q  R+T T
Sbjct: 13 ACDECRKKKVKCDGKQP-CIHCTVYNYECTYNQPTRRTVT 51

>Sklu_1622.2 YDR034C, Contig c1622 1522-3858
          Length = 778

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 6/58 (10%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTRFYGLSS 72
            C +C+ R+++C    P C  CT+ N EC Y    +      NKKRK    R  G S+
Sbjct: 163 GCTECKKRRMKCDEGKPSCWQCTRLNRECVYILNPK------NKKRKPRVGRNAGNST 214

>Kwal_23.2905
          Length = 881

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRN--CECFYPQTQR 50
          SI +C++CR RKV+C ++ P C  C   N  C    P T R
Sbjct: 45 SIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGR 85

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 11 LSII--SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTK 55
          +SI+  SC  CR R+V+C R  P C  C +RN  C Y Q  RK   K
Sbjct: 1  MSIVRQSCDCCRVRRVKCDRNRP-CDRCRQRNLRCTYLQPLRKRGPK 46

>Scas_702.7
          Length = 1113

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY---------PQTQRKTSTKLNKKRKNDNT 65
          +C  CR RK++C+   P C +C    CEC +         P T   T+ K+ K ++  +T
Sbjct: 36 ACANCRRRKIKCTGTYP-CSNCAAYQCECIFDDLKEDSSNPSTVGGTTQKVTKTKRKSHT 94

Query: 66 R 66
          +
Sbjct: 95 K 95

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 4  LITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP 46
          L+ D +G S  SC  CR RK RC  ++P C +C K   +C  P
Sbjct: 30 LLKDKKGRSR-SCLLCRRRKQRCDHKLPSCTACLKAAVKCVQP 71

>Sklu_1373.2 YDR207C, Contig c1373 1069-2895
          Length = 608

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 12  SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
           S   C  CR RK +C+ + P C +CT+ N ECFY
Sbjct: 537 SRTGCWICRLRKKKCTEEKPHCNNCTRLNLECFY 570

>Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement
          Length = 777

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRN-CECFYP 46
          +C QCR RK+ C R  P C +C +    +CFYP
Sbjct: 15 ACVQCRKRKIGCDRAKPICGNCLRNGKNDCFYP 47

>Scas_556.6
          Length = 1022

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          C++CR  K +C ++ P C  C K+N  C Y
Sbjct: 46 CQECRKAKTKCDKEKPACTRCVKQNLACVY 75

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
           Saccharomyces cerevisiae YDR213w UPC2, hypothetical
           start
          Length = 922

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 12/67 (17%)

Query: 12  SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP-----QTQRKTSTKLNK-------K 59
           S   C  C+ R+V+C    P CK C+  N  C Y      +  +KT+++  K       +
Sbjct: 44  SKTGCDNCKRRRVKCDEGKPGCKKCSNLNLVCVYSTVVDNKVAKKTTSRKGKSPGANSLE 103

Query: 60  RKNDNTR 66
             +DNTR
Sbjct: 104 NSDDNTR 110

>Scas_679.26
          Length = 775

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 4/46 (8%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY----PQTQRKTSTKL 56
            C  C+ R+V+C    P C+ C   N EC Y    P+  + +ST +
Sbjct: 57  GCDNCKRRRVKCDELKPTCQKCINMNLECVYSMPKPRKAKGSSTSV 102

>Scas_526.3
          Length = 1109

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 4  LITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP 46
          L+ D +G S  SC  CR RK RC  ++P C +C K   +C  P
Sbjct: 30 LLQDKKGRSR-SCLLCRRRKQRCDHKMPSCTACLKAAVKCVQP 71

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 4  LITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP 46
          L+ D +G S  SC  C+ RK RC  +IP C +C K    C  P
Sbjct: 30 LLKDKKGRSR-SCLLCQRRKQRCDHKIPSCTACLKAGVRCIQP 71

>Scas_518.5
          Length = 919

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 7   DSQGLSIISCRQCRDRKVRCS---RQIPKCKSCTKRNCEC---FYPQTQRK 51
           +S+   + +C  CR RKV+C     Q  KC +CTK + EC   F+ Q +RK
Sbjct: 110 ESKKRVLKACDYCRKRKVKCGDIIAQTGKCANCTKNDVECTFKFHLQLERK 160

>Kwal_23.3122
          Length = 788

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY-PQTQRK 51
           C  C+ R+V+C    P C+ C     EC Y P T RK
Sbjct: 49 GCDNCKRRRVKCDEDKPSCQKCLNMKLECVYTPVTSRK 86

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 12/72 (16%)

Query: 1   MSSLITDSQGLSII------SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTST 54
           ++S +TD +G ++        C +C+ R+++C    P C  C + N +C Y    +    
Sbjct: 138 VTSTVTDKKGNTVKRKYSRNGCSECKRRRMKCDETKPTCWQCARLNRQCVYVLNPK---- 193

Query: 55  KLNKKRKNDNTR 66
             NKKR+  N +
Sbjct: 194 --NKKRRTSNAQ 203

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRN-CECFYPQTQRKTSTKLNKKRK 61
          SC  CR RK++C R  P C SC+ RN  +C Y +       +L KK +
Sbjct: 23 SCHFCRVRKLKCDRVRPFCGSCSSRNRKQCEYKENTSAMEDQLRKKYR 70

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRN--CECFYPQTQR 50
          SI +C++CR +KV+C ++ P C  C   N  C    P T R
Sbjct: 39 SIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGR 79

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKR--NCECFYPQTQRK 51
          SC  CR RKVRC R  P C  C K   N EC Y   +R+
Sbjct: 8  SCLVCRRRKVRCDRAKPVCLVCVKHGSNMECNYEVQKRE 46

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
           Transcription factor involved in drug-induced
           transcriptional regulation, including activation of
           multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 61/154 (39%), Gaps = 32/154 (20%)

Query: 13  IISCRQCRDRKVRCSRQIPKCKSCTKRN-CECFYPQTQRKTSTKLNKKRKNDNTRFYGLS 71
           I SC  CR RK+RC +Q P C +C  RN   C Y +       + NK  +   T  YG  
Sbjct: 51  IKSCGFCRRRKLRCDQQKPMCSTCISRNLTTCQYAE-------EFNKNIEKKAT--YG-- 99

Query: 72  SVNRVLFEVGMPFCNVDY-----ELENKLAPSHMKKLTSSLVYQKYIEDPQDALA-AIKR 125
                      P+ N D      ELENK+     +K T+S     Y       L  ++ R
Sbjct: 100 -----------PYPNADLLKKVEELENKIRILEAEKNTNSSASSMYTSPNFPPLGTSVGR 148

Query: 126 IQSSVGCSLFEEIVDLGALEHTLS---SGREVDY 156
             +     L + +++  A  + L    SGR   Y
Sbjct: 149 GSTETSSPLPDGVINPYADRYYLQSKHSGRSTLY 182

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          +C+ CR +KV+C +  P CK C + N  C
Sbjct: 24 ACKLCRRKKVKCDQGYPSCKGCLRNNVPC 52

>Kwal_56.24566
          Length = 755

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 4  LITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKND 63
          ++   +  S   C  CR R+ +C    PKC +C+K   +C +P   RK   +L K+ +  
Sbjct: 20 MLRPKRNRSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKCIWP---RKGQGRLTKEMREK 76

Query: 64 NTR 66
            R
Sbjct: 77 MKR 79

>KLLA0F00572g complement(42710..44503) some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 597

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 21/45 (46%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKK 59
           C  CR RK +C    P C +C +   EC +P +      K+ KK
Sbjct: 10 GCLICRRRKKKCDEVKPTCTACKRNFLECIWPNSSNTKDGKVGKK 54

>YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol
          regulatory element binding protein involved in the
          regulation of sterol biosynthetic gene expression and
          may be involved in regulating sterol uptake [2445 bp,
          814 aa]
          Length = 814

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 19/40 (47%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRK 51
          S   C  C+ R+V+C    P CK CT    +C Y   Q +
Sbjct: 40 SKTGCDNCKRRRVKCDEGKPFCKKCTNMKLDCVYSPIQPR 79

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
          cerevisiae YGL013c PDR1 transcription factor,
          hypothetical start
          Length = 1107

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNT 65
          +C  CR RK++C+   P C SCT   CEC Y   +   + K N   K+  T
Sbjct: 30 ACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAKSTKNLKSNDAGKSKPT 79

>Kwal_26.6805
          Length = 944

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 7/53 (13%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFY-------PQTQRKTSTKLNKKRK 61
          C+ CR  K +C R  P C  C K    C Y       P+T  K +T    KR+
Sbjct: 29 CQSCRKGKTKCDRAKPSCSRCLKHGIRCVYDVDRQTPPKTPNKDATIARLKRE 81

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
           C QC+   ++C    PKC  C KRN  C Y
Sbjct: 23 GCLQCKRSHLKCDEGQPKCGKCVKRNISCTY 53

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 775

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY--PQTQRK 51
          S+ +C++CR RK++C  + P C  C +    C    P T+R+
Sbjct: 16 SVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRRE 57

>KLLA0C16489g 1444456..1446642 some similarities with
           ca|CA2184|IPF6874.3 Candida albicans unknown function,
           3-prime end, hypothetical start
          Length = 728

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTRFYGLSSVN 74
            C  CR ++++C  Q P C  C +    C +P+      TK  ++   DN   Y   +  
Sbjct: 42  GCFTCRLKRMKCDEQHPICGRCKRNLLTCIWPKEGNGKLTKKMRQAMKDNVDPYAEMNPK 101

Query: 75  RV--LFEV 80
           +V  LFE+
Sbjct: 102 KVQLLFEI 109

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
          Transcription factor regulating pyrimidine pathway,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          S  +C++CR +K++C ++ P CK C K    C
Sbjct: 30 SRTACKRCRLKKIKCDQEFPSCKRCAKLEVPC 61

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 36.6 bits (83), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 15/31 (48%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
           C QC+    +C    P C  C KRN EC Y
Sbjct: 20 GCLQCKKSHTKCDETKPACLKCVKRNVECTY 50

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
          [2454 bp, 817 aa]
          Length = 817

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 24/55 (43%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTRF 67
          +++C  C  RKV+C+R  P C  C K    C Y    R +    NK  +    R 
Sbjct: 35 VLNCMPCHKRKVKCNRARPVCDHCEKNRYACAYFVNDRVSRGGQNKVPRESKLRL 89

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 13  IISCRQCRDRKVRCSRQIPKCKSCTKRN-CECFY 45
           I SC  CR RK++C R+ P C  C  R   EC Y
Sbjct: 87  IKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVY 120

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
          element binding protein involved in the regulation of
          sterol biosynthetic gene expression and the uptake and
          intracellular esterification of sterols [2742 bp, 913
          aa]
          Length = 913

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
           C  C+ R+V+C    P C+ CT    EC Y
Sbjct: 50 GCDNCKRRRVKCDEGKPACRKCTNMKLECQY 80

>KLLA0E19701g complement(1739869..1741914) some similarities with
          sp|P26370 Saccharomyces cerevisiae YDL170w UGA3
          transcriptional activator for GABA catabolic genes
          singleton, hypothetical start
          Length = 681

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (47%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNK 58
           C  C+ RK RCS   P CK C + + +C +P    K   +  K
Sbjct: 19 GCLTCKVRKKRCSEDRPICKDCARLSLDCVFPDNLTKDQIRAYK 62

>KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001
           Saccharomyces cerevisiae YDR207c UME6 negative
           transcriptional regulator singleton, hypothetical start
          Length = 787

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 12  SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
           S   C  CR RK +C+ + P+C++C + + ECFY
Sbjct: 715 SRTGCWICRLRKKKCTEEKPQCQNCVRLHLECFY 748

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 36.6 bits (83), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQR 50
          C+ CR  K RC ++ P C  C K   EC Y   ++
Sbjct: 27 CQACRRSKTRCDKEKPICTRCKKLKLECVYDMAKQ 61

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 2  SSLITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP 46
          + L+ D +G S  +C  C+ RK +C  +IP C +C K   +C  P
Sbjct: 28 NQLLKDKKGRSR-ACLLCQRRKQKCDHKIPSCTACLKAGVKCIQP 71

>KLLA0A10329g 903873..905792 some similarities with
          ca|CA6113|IPF100.3 Candida albicans zinc finger
          protein, 3-prime end (by homology), hypothetical start
          Length = 639

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 25/56 (44%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTRF 67
          S + C++C+  K +C    P C  C KR  +C Y +T +         R +   +F
Sbjct: 13 SYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRTLKWGGRPFKDNRVSKKMKF 68

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSC-TKRNCECFYPQ 47
          I SC  CR RK+RC +Q P C +C T+    C Y +
Sbjct: 28 IKSCAFCRKRKLRCDQQKPMCSTCKTRGRSGCLYTE 63

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNC-ECFY 45
          SC  CR R+V+C++  PKC +C  +   EC Y
Sbjct: 18 SCVFCRKRRVKCNKARPKCSTCIGKGLPECVY 49

>KLLA0D15356g 1301848..1303722 no similarity, hypothetical start
          Length = 624

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 7/76 (9%)

Query: 8   SQGLSIISCRQCRDRKVRCSRQIPK--CKSCTKRNCECFYPQTQRKTSTKLNKKRK---- 61
           + G +  SCR C   K +C+R+  +  C+ C  R  EC + Q +  +   + +       
Sbjct: 32  ASGRTPTSCRSCAKSKKKCTRESDRGPCQLCENRGIECSFMQGEPDSLPTMMEHEWLAVF 91

Query: 62  -NDNTRFYGLSSVNRV 76
            N++  FY L+++NR 
Sbjct: 92  LNEDAPFYNLNTLNRT 107

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 36.2 bits (82), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRK 61
          +C  C++RKVRC  Q P C SC     +C Y    +     L KKRK
Sbjct: 35 ACSSCKERKVRCDGQSP-CASCINARVKCEYVMNMK----PLKKKRK 76

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
            C QC+    +C  + PKC  C KR+ +C Y
Sbjct: 70  GCLQCKKAHTKCDERKPKCSRCEKRSIDCTY 100

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 35.8 bits (81), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTK 55
          + C  CR RK +C R  P C +C K    C Y +   + ++K
Sbjct: 19 LVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSEDTDENASK 60

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
          Saccharomyces cerevisiae YLR228c ECM22, start by
          similarity
          Length = 775

 Score = 35.8 bits (81), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKT 52
           C  C+ R+V+C    P C +C K + +C Y   Q ++
Sbjct: 56 GCDHCKRRRVKCDETRPHCLNCKKMSLDCVYTPVQPRS 93

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
          transcription factor, in conjunction with Pdr3p
          regulates the expression of a network of genes involved
          in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 35.8 bits (81), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTK 55
          +C  CR RK++C+ + P C SC   +CEC +   Q     K
Sbjct: 45 ACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTRQGGARIK 84

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 35.8 bits (81), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRN 40
          C  C+ RKV+C R +P C++C +RN
Sbjct: 15 CTFCQARKVKCDRSLPACQNCIERN 39

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 20/43 (46%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNK 58
          C+ CR  K +C R+ P C  C + N  C Y    +    K NK
Sbjct: 21 CQLCRKSKTKCDRKKPSCARCQRLNKPCIYDLEYQPLPRKPNK 63

>Kwal_56.23058
          Length = 775

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTR 66
            C +C+ R+++C    P C  C + N EC Y     +T  +  + +  DN++
Sbjct: 148 GCTECKRRRMKCDEGKPTCWQCARLNRECVY---VIRTKNRKRRPKSTDNSK 196

>AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH]
           (516587..518830) [2244 bp, 747 aa]
          Length = 747

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 12  SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
           S   C  CR RK +CS + P+C +C + N EC Y
Sbjct: 676 SRTGCWICRLRKKKCSEERPQCSNCLRLNLECVY 709

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTKRNCE--CFY 45
          +SC  CR RKV+C +  P C  CTK      C Y
Sbjct: 21 LSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHY 54

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
          with heme-dependent DNA-binding activity, responsible
          for heme-dependent activation of many genes [4509 bp,
          1502 aa]
          Length = 1502

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTKRNCE--CFY 45
          +SC  CR RKV+C +  P C+ CTK      C Y
Sbjct: 62 LSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHY 95

>YML099C (ARG81) [3872] chr13 complement(74398..77040) Component
          of the ARGR regulatory complex, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2643 bp, 880 aa]
          Length = 880

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          +   C  CR RKV+C  + P C+ C K N  C
Sbjct: 17 TFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          C +CR RK++C +Q P C  C ++   C Y
Sbjct: 25 CLECRRRKIKCDKQRPCCIQCAEQGLTCVY 54

>CAGL0F07909g 776659..779808 some similarities with tr|Q12180
          Saccharomyces cerevisiae YOL089c HAL9 or sp|P38114
          Saccharomyces cerevisiae YBR150c TBS1, hypothetical
          start
          Length = 1049

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 12/67 (17%)

Query: 12 SIISCRQCRDRKVRCSRQIP---KCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTRFY 68
          S  +C  CR RK+RC    P   KC +C K   EC +     K   +L  K+K    R Y
Sbjct: 37 STKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVECTF-----KFHEELQTKKK----RMY 87

Query: 69 GLSSVNR 75
           L ++ +
Sbjct: 88 ELKAIEK 94

>Scas_573.4
          Length = 1478

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTK 38
          +SC  CR RKV+C +  P C+ CTK
Sbjct: 41 LSCTICRKRKVKCDKIRPHCQQCTK 65

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTKRNCE--CFY 45
          +SC  CR RKV+C +  P C  CTK      C Y
Sbjct: 17 LSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHY 50

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region, putative transcription
          factor [2895 bp, 964 aa]
          Length = 964

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLN 57
          +C +CR +KV+C  Q P C  CT  + EC Y +  ++T    N
Sbjct: 20 ACDECRKKKVKCDGQQP-CIHCTVYSYECTYKKPTKRTQNSGN 61

>Scas_550.5*
          Length = 832

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKT 52
          C  CR +K+RC+R+ P C  C +    C Y +    T
Sbjct: 15 CAACRTQKLRCNRERPSCSRCQRIGRTCVYEKHSEDT 51

>Kwal_47.18089
          Length = 745

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNC-ECFY 45
          SC  CR RK++C  + P C SC  R   EC Y
Sbjct: 28 SCTFCRHRKLKCDHKRPMCGSCAARKLPECIY 59

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 6/49 (12%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKND 63
            C  C+ R+V+C    P C+ C K    C Y      T  K  KK+  D
Sbjct: 88  GCDNCKRRRVKCDEGKPGCQKCLKMRLSCVY------TPAKPRKKKDRD 130

>KLLA0A09251g 808253..810319 some similarities with sp|P38699
          Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
          protein, hypothetical start
          Length = 688

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP 46
          SC +CR  K +CS+ +  C +C K N  C YP
Sbjct: 21 SCSRCRRLKKKCSKDLSTCTNCAKANEPCDYP 52

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
           aa]
          Length = 696

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 8/55 (14%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP--------QTQRKTSTKLNKKRK 61
            C QC+   ++C +  P C +C K+N  C Y          ++RK   +L K +K
Sbjct: 60  GCSQCKKSHIKCDKVQPLCTTCAKKNILCTYELSFVFEDGSSKRKILKRLPKTKK 114

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 3/56 (5%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY---PQTQRKTSTKLNKKRKNDNTR 66
           SC+ CR  + +C R  P C  C K   +C Y   P+ + K S  +     ++  R
Sbjct: 3  FSCQNCRKTRRKCDRGKPTCARCIKYKIDCVYELPPKHKIKQSVDIGNDMISETQR 58

>Kwal_23.6425
          Length = 735

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRN-CECFY 45
          SI  C  CR RK++C +  P C +C  R   EC Y
Sbjct: 32 SIKQCLFCRKRKLKCDKNRPVCGTCASRGLTECVY 66

>Kwal_23.3178
          Length = 611

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 7   DSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQ 49
           +S   S   C  CR RK +C+ + P C +C + N +CFY  T+
Sbjct: 536 NSGSRSRTGCWICRLRKKKCTEEKPSCHNCLRLNLQCFYDHTK 578

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
          Saccharomyces cerevisiae YDR034c LYS14 transcriptional
          activator of lysine pathway genes singleton, start by
          similarity
          Length = 673

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 15/63 (23%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY------------PQTQR---KTSTKLNKK 59
           C +C+ +KV+C    P C  CT  + EC Y            P   R   K ++  +KK
Sbjct: 27 GCLECKRKKVKCDETKPMCWQCTHLSLECVYKTKEFQFVVSGGPNKSRVNSKVTSVSDKK 86

Query: 60 RKN 62
          RKN
Sbjct: 87 RKN 89

>Scas_674.12*
          Length = 909

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 16/30 (53%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          C  CR +KV+C +  P C  C K N  C Y
Sbjct: 15 CLVCRSKKVKCDKARPSCGRCRKTNKLCVY 44

>Kwal_55.20722
          Length = 827

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          C +CR+RK++C +  PKC  C +    C Y
Sbjct: 15 CLECRNRKLKCDKARPKCTRCKQNLLTCSY 44

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          +   C  CR RKV+C    P CK C +   EC
Sbjct: 16 TFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 10/57 (17%)

Query: 15  SCRQCRDRKVRCSRQIP---KCKSCTKRNCECFY----PQTQRKTS---TKLNKKRK 61
           +C  CR RK +C    P   KC +C+K   +C +     + +RK+S   TK+NK  K
Sbjct: 177 ACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDCIFITEPTKKKRKSSSEGTKVNKSPK 233

>ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH]
           complement(212832..215234) [2403 bp, 800 aa]
          Length = 800

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRK 61
            C +C+ R+++C    P C  C++ N EC Y    R       KK++
Sbjct: 196 GCTECKRRRMKCDEGKPICWQCSRLNRECKYILNARNKKRAAAKKQQ 242

>KLLA0F02299g 205549..208167 no similarity, hypothetical start
          Length = 872

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 13 IISCRQCRDRKVRCSRQ-IPKCKSCTKRNC--ECFYPQTQRKTS-TKLNKKRKN---DNT 65
          +++C +CR +K+RC     P C  C  + C  EC       KT+ +K+NK++ N    N 
Sbjct: 4  VLACSRCRQQKIRCIHDGKPPCTYCLHKGCGDECVLTYPPLKTNKSKVNKRKANKPLGNN 63

Query: 66 RFYGLSSV 73
          R   +S V
Sbjct: 64 RNGDMSGV 71

>Kwal_23.4754
          Length = 812

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRK 51
          +C +CR +KV+C  Q P C  CT  + EC Y Q  ++
Sbjct: 14 ACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSKR 49

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTK 38
          +SC  CR RKV+C +  P+C+ C K
Sbjct: 23 LSCTICRKRKVKCDKGRPQCQQCVK 47

>Kwal_27.9688
          Length = 841

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          +   C  CR RKV+C    P C+ C K   EC
Sbjct: 19 TFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTK 55
          +C  CR R+V+C  + P C  C + N +C Y Q  +K  +K
Sbjct: 7  ACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKRGSK 46

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSCTKRNC-ECFYPQ 47
          I SC  CR RK++CS+  P C+ C  R   +C Y +
Sbjct: 28 IKSCAFCRKRKLKCSQARPMCQQCVIRKLPQCVYTE 63

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 7/45 (15%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKK 59
          +C +CR +K++C    P C SC K   +C       KTS KL ++
Sbjct: 28 ACDRCRLKKIKCDGLRPSCTSCKKIGYQC-------KTSDKLTRR 65

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
          Saccharomyces cerevisiae YMR280c CAT8 transcription
          factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 7/45 (15%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKK 59
          +C +CR +K +C  +IP+C  C     EC       K S +LN+K
Sbjct: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFEC-------KISDRLNRK 96

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
          activator of gluconeogenic genes through CSRE elements,
          activated by Snf1p kinase, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 2  SSLITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKK 59
          S+ ITD       +C +CR +K++C    P C +C K +  C       KTS KL+++
Sbjct: 32 SNAITDFSVRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPC-------KTSDKLSRR 82

>YFL052W (YFL052W) [1632] chr6 (28232..29629) Protein with strong
          similarity to the MAL regulatory proteins Mal63p,
          Mal33p, and Mal23p, contains an N-terminal Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [1398 bp, 465 aa]
          Length = 465

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKR---KNDNTRFYGLS 71
          +C  C  R+V+C R+ P CK C + N +C Y +  +K   K  K R   K D+ + +  S
Sbjct: 7  ACDCCCIRRVKCDRKKP-CKCCLQHNLQCTYLRPLKKRGPKPVKVRNLKKVDDVQVFSKS 65

Query: 72 SVNRVL 77
          S   ++
Sbjct: 66 SSGGIM 71

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 7/45 (15%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKK 59
           +C +CR +K+RC  + P+C  C     EC       K S KL+++
Sbjct: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFEC-------KISDKLSRR 219

>KLLA0C14212g complement(1229219..1232341) some similarities with
           sp|P25611 Saccharomyces cerevisiae YCR106w, hypothetical
           start
          Length = 1040

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 16  CRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLN 57
           C  CR RK RC R  P C  C   + EC Y  ++     K++
Sbjct: 75  CYACRRRKTRCDRGNP-CSKCVALSTECVYSISEMNNGNKVS 115

>Sklu_2301.1 , Contig c2301 1246-2795 reverse complement
          Length = 517

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 2/44 (4%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY--PQTQRKTS 53
          SI++C +CR +K +C +  P C  C      C    P T R  S
Sbjct: 36 SIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVS 79

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 8/62 (12%)

Query: 1  MSSLITDSQG----LSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY---PQTQRKTS 53
          +S  +T ++G    LS + C+ CR  K +C +  P C  C K    C Y    QT+ K+ 
Sbjct: 21 VSGKVTKTKGRRNKLSFV-CQSCRRSKTKCDKVKPSCTRCVKNGSVCVYDVETQTKPKSR 79

Query: 54 TK 55
          +K
Sbjct: 80 SK 81

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
          required for induction of SPS19 and POX1 on
          oleate-containing medium, plays a role in peroxisome
          proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          C+ C   K +C R+ P+C  C K   +C Y
Sbjct: 66 CQACWKSKTKCDREKPECGRCVKHGLKCVY 95

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTST 54
          +C +CR +KV+C  Q P C  CT  + EC Y Q  ++  +
Sbjct: 14 ACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKRGGS 52

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          +C  C+ RK++C    P C SCTK + +C Y
Sbjct: 27 ACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56

>Scas_626.6
          Length = 839

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          +   C  CR RKV+C  + P C  C K   EC
Sbjct: 17 TFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 28/53 (52%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDN 64
          + + C  C+ RK++C R+ P C +C+  N   +    Q   + + N + K++N
Sbjct: 24 TTVVCTNCKKRKIKCDRKRPACSNCSVANVAEYCQYVQPNWALENNDEPKSNN 76

>Kwal_47.17506
          Length = 924

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          +C  CR RK++C+   P C +C    CEC Y
Sbjct: 18 ACNNCRRRKIKCTGAQP-CLNCQTYRCECTY 47

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 7/45 (15%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKK 59
           +C +CR +K RC  + P+C  C     EC       K S KL+++
Sbjct: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC-------KISDKLSRR 114

>CAGL0F02519g 245120..247618 weakly similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, hypothetical start
          Length = 832

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 2  SSLITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          + L+  +Q LS  +C  C+ RK +C    P C+SC K N +C Y
Sbjct: 23 NQLVARTQRLSR-ACDLCKKRKTKCQGGNP-CQSCRKANIQCIY 64

>Scas_521.2
          Length = 890

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 17/29 (58%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          +C++CR +K++C ++ P C  C      C
Sbjct: 40 ACKRCRSKKIKCDQKFPSCDRCAHLKVPC 68

>Kwal_27.10232
          Length = 1209

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 7/45 (15%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKK 59
           +C +CR +K RC  + P+C  C     EC       K S KL+++
Sbjct: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC-------KVSDKLSRR 110

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor,
          hypothetical start
          Length = 1372

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTK 38
          +SC  CR RKV+C +  P C  C K
Sbjct: 69 LSCTICRRRKVKCDKSRPNCTQCVK 93

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTK 55
          +C  CR R+V+C  + P C SC + + +C Y Q  RK   K
Sbjct: 12 ACDCCRIRRVKCDGKRP-CSSCLQNSLDCTYLQPSRKRGPK 51

>Kwal_14.2619
          Length = 1167

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRN--CECFY 45
          SC  CR RKV+C R  P C +C K     EC Y
Sbjct: 11 SCLTCRRRKVKCDRSKPVCLACIKYKSISECSY 43

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
          (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTKRNCECF 44
          ++C+ CR R+ +C  Q+P C +C K   EC 
Sbjct: 12 LACQTCRKRRRKCDLQVP-CVNCQKFGVECL 41

>Scas_657.3
          Length = 856

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSCTKRN-CECFY 45
          I SC  CR RK++C ++ P C +C  R    C Y
Sbjct: 42 ITSCAFCRQRKLKCDQKRPICSTCIGRKLTTCVY 75

>Scas_696.44
          Length = 1164

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 33/71 (46%), Gaps = 9/71 (12%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCEC---------FYPQTQRKTSTKLNKKRKNDNT 65
           +C +CR +K RC  + P+C  C     EC          +P+   +T  +  ++ +N+N 
Sbjct: 80  ACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGYTETLEEKVRELENENR 139

Query: 66  RFYGLSSVNRV 76
           R   +   N++
Sbjct: 140 RLLAICQFNKL 150

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 17/31 (54%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
            C +C+ R+++C    P C  C + N +C Y
Sbjct: 154 GCLECKKRRMKCDEGKPTCWQCARLNRKCVY 184

>Scas_659.10
          Length = 757

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSC-TKRNCECFYPQT 48
          I SC  CR RK++C +  P C  C  +++  C Y +T
Sbjct: 18 IKSCAFCRGRKLKCDKNKPICNQCLMRKHPTCIYTET 54

>Sklu_2082.1 YER184C, Contig c2082 2025-2273
          Length = 82

 Score = 30.4 bits (67), Expect = 0.67,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQ 47
          +C +CR RK++C+     C SC     +C Y Q
Sbjct: 15 ACNECRKRKIKCTGTF-SCSSCVIYGSKCGYDQ 46

>YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein
           involved in salt tolerance, has similarity to
           transcription factors, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3093 bp, 1030 aa]
          Length = 1030

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 15  SCRQCRDRKVRC---SRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRK 61
           +C  CR RK+RC    +Q  KC +C K    C    T +     L KKRK
Sbjct: 135 ACDHCRKRKIRCDEVDQQTKKCSNCIKFQLPC----TFKHRDEILKKKRK 180

>CAGL0F05357g 541830..543635 some similarities with sp|P39001
           Saccharomyces cerevisiae YDR207c UME6, hypothetical
           start
          Length = 601

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 12  SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
           S   C  CR RK +CS + P C +C + N +C+Y
Sbjct: 526 SRTGCWICRLRKKKCSEEKPACFNCQRLNLDCYY 559

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
          transcription factor, in conjunction with Pdr1p
          regulates the expression of a network of genes involved
          in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          +C  CR RK++C+ + P C +C   +C C +
Sbjct: 14 ACVNCRKRKIKCTGKYP-CTNCISYDCTCVF 43

>Kwal_26.6732
          Length = 676

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 17/35 (48%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYP 46
          S+  C  CR R+ +C  + P C  C     +C +P
Sbjct: 8  SVTGCLTCRKRRKKCDERKPVCTGCESNFLQCTWP 42

>Kwal_8.580
          Length = 638

 Score = 32.7 bits (73), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSC-TKRNCECFYPQTQRKTSTKLNKKRKN 62
          +C  CR RK +CS  +P C++C T    +C Y    ++  T  + K ++
Sbjct: 16 ACDNCRLRKAKCSGDLPVCRNCSTAGTIKCTYSLADKRRKTNKDSKARS 64

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
          Transcription factor required for derepression of
          gluconeogenic enzymes, contains an N-terminal
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
          bp, 1433 aa]
          Length = 1433

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          +C +CR +K RC  + P+C  C     EC
Sbjct: 69 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 97

>CAGL0A01914g 190454..201685 highly similar to sp|P38811
           Saccharomyces cerevisiae YHR099w TRA1, start by
           similarity
          Length = 3743

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 65/154 (42%), Gaps = 11/154 (7%)

Query: 56  LNKKRKNDNTRFYGLSSVNRVLFEVGMPFCNVDYELENKLAPSHMKKLT-SSLVYQKYIE 114
           L +K K      +  S++   LF++     N+   +   +   H+  L   SL Y K  E
Sbjct: 747 LKRKLKTLGNTDFNTSNILIRLFKLSFMSVNLFPNINEIVLLPHLNGLILDSLEYSKTAE 806

Query: 115 DPQDALAAIKRIQSSVGCSLFEEI---------VDLGALEHTLSSGREVDYQGLILTYAV 165
           +P      I+ +  S+G   FE +         V L +L   + S R + ++  +     
Sbjct: 807 EPLVYFYLIRTLFRSIGGGRFENLYRSIKPILQVLLQSLNEKIVSAR-LPHERELYVELC 865

Query: 166 IIVSERFVTPAPDVADLIDELTFAIEECPDCLEK 199
           I V  R    AP +  L++ L +A++E PD + +
Sbjct: 866 ITVPVRLSVLAPYLPYLMEPLVYALQEYPDLVSQ 899

>Scas_662.8
          Length = 906

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKT 52
          +C +CR +KV+C  Q P C  CT  + EC Y    +++
Sbjct: 36 ACDECRKKKVKCDGQQP-CIHCTVYSYECTYNHPSKRS 72

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSCTKRN-CECFYPQTQRKTSTKLNK 58
          I +C  CR RK++C    P C +C  R    C Y  T      KL +
Sbjct: 37 IRTCAFCRRRKLKCDNARPMCSTCVSRKFSTCIYEDTVDTRKVKLEE 83

>YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger
          regulatory protein for thiamine pyrophosphokinase
          (THI80) expression [1353 bp, 450 aa]
          Length = 450

 Score = 32.3 bits (72), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 20/44 (45%)

Query: 2  SSLITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          SS +  ++G +   C  CR +K RC    P C  C K    C Y
Sbjct: 16 SSKVPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSY 59

>Kwal_47.17565
          Length = 628

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 13/66 (19%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCT------------KRNCECFYPQTQRKTSTKLNKK 59
          SI +C+ C + K++C++Q P C +CT            KR+ E   P    K +TK  +K
Sbjct: 9  SIKTCKYCYEHKLKCNKQSP-CDNCTRLGITSHCVYGFKRSGESSVPTNVGKRTTKPEQK 67

Query: 60 RKNDNT 65
           K   T
Sbjct: 68 TKTLTT 73

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 32.7 bits (73), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 7/56 (12%)

Query: 4  LITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKK 59
          L+   Q  S  +C +CR +K++C    P C SC K    C       +TS KL ++
Sbjct: 17 LLLSRQERSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHC-------QTSDKLTRR 65

>ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH]
           complement(169508..172015) [2508 bp, 835 aa]
          Length = 835

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 14  ISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRK--TSTKLNKKRKNDNTR 66
           ++C +CR R VRC    P C  C   N  C Y +  +K   S K  ++ + D  R
Sbjct: 59  LACLRCRRRHVRCPGGTP-CAKCAVANIACEYLEPSKKLIVSMKYLQRLQEDLAR 112

>Kwal_26.7448
          Length = 714

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 19/29 (65%)

Query: 12  SIISCRQCRDRKVRCSRQIPKCKSCTKRN 40
           S + C +C+ R+++C   +P+C +C  R+
Sbjct: 91  SRLGCDECKRRRIKCDETLPECNNCKNRH 119

>Sklu_2335.6 YBL005W, Contig c2335 10191-13013
          Length = 940

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 5  ITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          +T S      +C  CR RK++C+ + P C +C    C C Y
Sbjct: 17 VTKSSSKVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEY 56

>CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces
          cerevisiae YKR064w, hypothetical start
          Length = 891

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 5  ITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTK 38
          +T S+   ++ C  CR RK +C RQ+P C  C +
Sbjct: 7  VTKSRRRPMLVCVNCRKRKSKCDRQLP-CSKCIQ 39

>AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH]
          complement(32874..35525) [2652 bp, 883 aa]
          Length = 883

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          +   C  CR RKV+C    P C+ C K   +C
Sbjct: 40 TFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71

>YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional
          activator for 4-aminobutyric acid (GABA) catabolic
          genes, including UGA4, UGA1, and UGS2, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [1587
          bp, 528 aa]
          Length = 528

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
           C  C+ RK RCS   P C+ C + +  C Y
Sbjct: 16 GCITCKIRKKRCSEDKPVCRDCRRLSFPCIY 46

>Scas_669.8
          Length = 637

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCE 42
          +C  C+ RKV+C + IP C SC ++  E
Sbjct: 15 ACNVCKKRKVKCDKLIP-CTSCIQKGLE 41

>Scas_709.51
          Length = 759

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 6/49 (12%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKND 63
          +C  C+ RKV+C    P C +C K+  +C Y       S+   KK  ND
Sbjct: 33 ACNICKRRKVKCDGNKP-CLNCIKKEIDCEY-----NNSSNTTKKEPND 75

>Kwal_56.24670
          Length = 643

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRK 61
           C  C+ RK RCS   P C  C +    C Y   ++ T  + N+ R+
Sbjct: 26 GCIPCKIRKKRCSEHKPTCTDCERLGFTCVY-LPEKSTREEANQYRE 71

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
          Saccharomyces cerevisiae YML099c ARG81 transcription
          factor involved in arginine metabolism singleton, start
          by similarity
          Length = 856

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          +   C  CR RKV+C  + P C+ C K    C
Sbjct: 10 TFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41

>Kwal_56.23358
          Length = 196

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 517 DSNSHASDFSDASKDVTANVSSLPYVTDDIADWITACF 554
           D+NS   DF  AS+DV+ N+  +  +T D+     A F
Sbjct: 11  DANSKLLDFPGASEDVSMNIGQINKLTQDLVSETNANF 48

>Kwal_23.3514
          Length = 579

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKN 62
          C  C  RKV+C R IP C +C KR  +     ++R   TKL++  ++
Sbjct: 12 CVVCTKRKVKCDRNIP-CSNCVKRGQQELCIASER---TKLDRSSRS 54

>Scas_540.3
          Length = 1019

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 9/55 (16%)

Query: 16  CRQCRDRKVRCSRQIP---KCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTRF 67
           C  CR +  +C   IP   KC  C     +CF+P      S K NK+ + DN   
Sbjct: 151 CNYCRQKGTKC-FMIPNLGKCIECETNRIQCFFP-----NSVKSNKRERVDNNNL 199

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
          that activates the proline utilization pathway genes,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 9  QGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRK--TSTKLNKKRKND 63
          Q  S ++C  CR R ++C    P C+ C   N  C Y +  +K   STK  ++ + D
Sbjct: 27 QQRSSVACLSCRKRHIKCPGGNP-CQKCVTSNAICEYLEPSKKIVVSTKYLQQLQKD 82

>Kwal_26.8109
          Length = 970

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 15 SCRQCRDRKVRC--SRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKND 63
          +C QCR +K RC  S + P C SC + +  C + +   K        R N+
Sbjct: 38 ACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGYTRANE 88

>Scas_661.23
          Length = 741

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 6/47 (12%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRK 61
            C +C+ R+++C    P C  C + + EC Y           NKKRK
Sbjct: 131 GCAECKRRRMKCDETKPICWQCARLSRECVY------IVKSGNKKRK 171

>CAGL0F07755g complement(755947..757782) similar to sp|P40969
          Saccharomyces cerevisiae YMR168c CEP3 kinetochore
          protein complex, start by similarity
          Length = 611

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 1/27 (3%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCE 42
          C  C  RKV+C R +P C  C KR  E
Sbjct: 14 CSVCSKRKVKCDRLVP-CGHCRKRGTE 39

>AFR171W [3363] [Homologous to NOHBY] complement(752592..754430)
          [1839 bp, 612 aa]
          Length = 612

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 15/31 (48%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
           C +C+ RKV+C    P C  C+     C Y
Sbjct: 21 GCSECKRRKVKCDETKPACWQCSHLGKRCVY 51

>Scas_702.7d
          Length = 978

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 3/62 (4%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTRFYGLSSVN 74
          +C  CR RK++CS  I  C +C    C C +        T +N   K   T F+  +S++
Sbjct: 17 ACSNCRRRKIKCS-GIQPCPNCEIYGCLCVFEPVN--GMTPMNFSSKPSETEFHHGNSMH 73

Query: 75 RV 76
           V
Sbjct: 74 SV 75

>Scas_596.4
          Length = 701

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 19  CRDRKVRCSRQIPKCKSCTKRNCECFY 45
           CR RK +C+ + P C +C + N +CF+
Sbjct: 571 CRLRKKKCTEEKPACFNCQRLNLDCFF 597

>Sklu_2384.6 YKL015W, Contig c2384 10929-13424
          Length = 831

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 9  QGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRK--TSTKLNKKRKND 63
          Q  S ++C +CR R V+C    P C  C   N  C Y +  +K   S K  +K ++D
Sbjct: 41 QKRSSMACVRCRRRHVKCPGGNP-CSKCIAANIACEYIEPNKKLIVSMKYLQKLQSD 96

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
          complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 7/49 (14%)

Query: 5  ITDSQGLSII------SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQ 47
          +++S GL +       +C +CR +KV+C  + P C  CT  + EC Y Q
Sbjct: 1  MSESAGLGLKRRRVTRACDECRKKKVKCDSRHP-CIHCTVYSYECTYNQ 48

>YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2310 bp, 769 aa]
          Length = 769

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 16/30 (53%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          C +C+ RK++C +  P C  C   +  C Y
Sbjct: 15 CLRCKQRKIKCDKLWPTCSKCKASSSICSY 44

>YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component
          (subunit b) of the Cbf3 kinetochore protein complex
          [1827 bp, 608 aa]
          Length = 608

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 3/30 (10%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKR--NCEC 43
          C  C  RKV+C R IP C +C KR  + EC
Sbjct: 14 CSVCTRRKVKCDRMIP-CGNCRKRGQDSEC 42

>Scas_711.31
          Length = 932

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 16/29 (55%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          +C +CR +K++C  + P C  C K    C
Sbjct: 44 ACDRCRLKKIKCDDRTPDCTPCMKAGIPC 72

>Scas_542.8
          Length = 902

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRK 51
          ++C  CR R ++CS   P C  C K + +C Y +  +K
Sbjct: 27 LACILCRKRHIKCSGGNP-CARCIKHDLKCEYIEPSKK 63

>Kwal_14.915
          Length = 822

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRK--TSTKLNKKRKND 63
          S ++C +CR R  +CS   P C +C   N  C Y +  +K   S K  +K ++D
Sbjct: 45 SGLACVRCRRRHAKCSGDNP-CTTCRAANIACEYLEPNKKLVVSMKYLQKLQSD 97

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRKNDNTR 66
           +C  CR +K+RC+ + P C +C K N  C Y        T + K+R+   TR
Sbjct: 80  ACDICRAKKIRCNGEEP-CVNCEKFNLGCTY--------THVIKRRQAAPTR 122

>YPL078C (ATP4) [5365] chr16 complement(408005..408739) Subunit b,
           or subunit 4, of the F0 subunit of ATP
           synthase-mitochondrial respiratory complex V, one
           molecule is present in F0 complex, ATP synthase is
           involved in ATP generation during respiration and is
           required for mitochondrial cristae formation [735 bp,
           244 aa]
          Length = 244

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 51/103 (49%), Gaps = 11/103 (10%)

Query: 58  KKRKNDNTRFYGLSSVNRVLFEVGMPFCNVD---YELENKLAPSHMKK--LTSSLVYQ-- 110
           K R +  ++   ++   +VLF+V      ++   +EL+ K+  +H  K  L S + Y+  
Sbjct: 139 KDRIDSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLDSWVRYEAS 198

Query: 111 -KYIEDPQDALAAIKRIQSSVGCSLFEEIV---DLGALEHTLS 149
            + +E  Q A + I R+QS +G   F+E V    +  +E  LS
Sbjct: 199 LRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSISEIEQLLS 241

>Sklu_2210.2 , Contig c2210 3292-4479
          Length = 395

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 84/224 (37%), Gaps = 28/224 (12%)

Query: 99  HMKKLTSSLVYQKYIEDPQDALAAIKRIQSSVGCSLFEEIVDLGALEHTLSSGREVDYQG 158
           HM  L+     Q  ++ P  +L   KR+     C   E I           S  + +++ 
Sbjct: 20  HMLHLSGRTASQP-LQKPPTSLR--KRLNKQFACPHHEPIPRQVWQSWKSKSDLDKEFEH 76

Query: 159 LILTYAVIIVSERFVTPAPDVADLIDELTFAIEECPDCLEKVSALILLADYYHYNFKIET 218
            + T++     +  +    +V++ +     AI E  +  E++   +L AD++ Y      
Sbjct: 77  NVETWSSTPDYQHHLLDDAEVSEFVKHRYAAIPEVVEAFERLPRKVLKADFFRY------ 130

Query: 219 AWKRTFLATSIAYALGLHLESSKVWPM-LVLHDALLCSIVGR----PSSIKAVDSQRTSN 273
                 LA    YA    +++S   PM   L D  L  ++ R    PS I AV      +
Sbjct: 131 ---LVILAEGGTYA---DIDTSLTTPMDEWLRDGQLADLMDRANVPPSRIAAVIG--VED 182

Query: 274 ACHDWGEIAVLLRDSNEILLAACDWTIEKVISLDFRFNDLIERV 317
            C  WG   +  R      L  C W+ +        F DL+ ++
Sbjct: 183 ECDCWGWRGIFTRR-----LQFCQWSFQAKRGHPL-FADLVAKI 220

>Kwal_26.7014
          Length = 654

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
          ++C  CR R+ +C+ + P C SC K   +C
Sbjct: 33 LACSNCRRRRKKCNMEYP-CASCVKLKVDC 61

>KLLA0F02750g complement(250368..253814) some similarities with
          sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
          transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 6/47 (12%)

Query: 15 SCRQCRDRKVRCSRQIP---KCKSCTKRNCEC---FYPQTQRKTSTK 55
          +C +CR RK++C    P   KC +C K    C   ++ +  R+T++K
Sbjct: 33 ACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPCTFHYHEEMIRRTNSK 79

>KLLA0D16753g 1418383..1419351 similar to sgd|S0004127 Saccharomyces
           cerevisiae YLR137w, start by similarity
          Length = 322

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 50/109 (45%), Gaps = 6/109 (5%)

Query: 286 RDSNEILLAACDWTIEKVISLDFRFND---LIER--VKNDMNKSSMVENPNKTLLGY-LK 339
           RD+N        WT    I     +ND   +  R  VK++++ +S+ +      L Y L+
Sbjct: 80  RDNNNSTTGYVIWTTSTFILKWLLYNDNATIFTRGGVKDEVDITSIFQCQQDDKLRYVLE 139

Query: 340 LGILTASRVKLIFSVYTKNEVSATKKETLKSLLDQNCCDLTQCLRGVFK 388
           LG  T+    ++FS Y    V+  +K+ L  L D    + ++C R + K
Sbjct: 140 LGTGTSPMFPIVFSNYVDKYVATDQKDILPRLKDNIQENQSECRRRLLK 188

>CAGL0H06875g complement(682518..684626) some similarities with
          sp|05085 Saccharomyces cerevisiae YML099c ARG81,
          hypothetical start
          Length = 702

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
           C  CR RKV+C    P C  C +   +C
Sbjct: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42

>Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement
          Length = 875

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 15/25 (60%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTK 38
          + C  C+ RK +C +Q P C +C +
Sbjct: 11 VVCSNCKRRKSKCDKQKPACSNCVR 35

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
          Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 7/45 (15%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKK 59
          +C +CR +K++C    P C +C K    C        TS KL ++
Sbjct: 62 ACDRCRLKKIKCDGIKPSCSNCKKIGYHC-------STSDKLTRR 99

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
          cerevisiae YKL015w PUT3 positive activator of the
          proline utilisation pathway, start by similarity
          Length = 865

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%)

Query: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRK 51
          S ++C +CR R ++C    P C  C K    C Y +  +K
Sbjct: 42 SSLACTRCRRRHIKCPGGNP-CSKCLKAGVACEYVEPNKK 80

>KLLA0E02618g 244696..248025 no similarity, hypothetical start
          Length = 1109

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 8/55 (14%)

Query: 15 SCRQCRDRKVRC--------SRQIPKCKSCTKRNCECFYPQTQRKTSTKLNKKRK 61
          +C  CR+RK++C        S    KC +C +   EC +  + R      +K ++
Sbjct: 26 ACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLECVFVASNRGGRRVFDKSKR 80

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 3/39 (7%)

Query: 15  SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY--PQTQRK 51
           +C  C+ RKV+C    P C +C+K   EC Y    T RK
Sbjct: 86  ACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRK 123

>Sklu_2297.5 YLR098C, Contig c2297 8133-9497
          Length = 454

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 19/91 (20%)

Query: 197 LEKVSALILLADYYHYNFKIETAWKRTFLATSIAYALGLHLE------------------ 238
           L  +  L+ LA Y   N +   AW  + LA  IA+ +GLHL                   
Sbjct: 121 LAYIQTLLCLAFYDIGNGENPLAWYLSGLAFRIAHEIGLHLNPKAWNNVYADDLSHVDIE 180

Query: 239 -SSKVWPMLVLHDALLCSIVGRPSSIKAVDS 268
             S+++    + D L+C + GR +S++  +S
Sbjct: 181 VRSRIYWGCYIADHLICVLFGRSTSLRLSNS 211

>KLLA0F10373g 957948..958994 some similarities with sp|P38141
          Saccharomyces cerevisiae YBR240c THI2 regulator of the
          thiamine biosynthetic genes singleton, hypothetical
          start
          Length = 348

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 18/38 (47%)

Query: 8  SQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          S+  +   C  CR +K +C  + P C  C K   EC Y
Sbjct: 2  SKDRNFTGCWACRFKKRKCDERKPICSLCLKHGVECCY 39

>Kwal_56.22605
          Length = 865

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 9/57 (15%)

Query: 15 SCRQCRDRKVRCSRQIP---KCKSCTKRNCECFYPQ----TQRKTSTKLNKKRKNDN 64
          +C  CR RK++C    P    C++C K N  C +      ++ +  T L  KR +DN
Sbjct: 28 ACDHCRKRKIKCGPVNPITGTCENCNKFNTSCTFRHHDEISRHRKFTDL--KRASDN 82

>AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH]
          complement(60109..61899) [1791 bp, 596 aa]
          Length = 596

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 3/30 (10%)

Query: 16 CRQCRDRKVRCSRQIPKCKSCTKRN--CEC 43
          C  C  RKV+C R +P C +C KR    EC
Sbjct: 12 CAVCIKRKVKCDRLVP-CTNCVKRGGAAEC 40

>Kwal_14.1631
          Length = 443

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 19/43 (44%)

Query: 3  SLITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          S  + ++  S   C  CR +K RC    P C  C K   +C Y
Sbjct: 2  STASKTKARSFTGCWACRFKKRRCDEAKPVCSLCLKHGDQCSY 44

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
          Saccharomyces cerevisiae YDR421w positive transcription
          regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 15 SCRQCRDRKVRC------SRQIPKCKSCTKRNCECFYPQTQR 50
          +C  C+ RKV+C      +   P C  C + + EC + +T+R
Sbjct: 23 ACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKR 64

>YCR106W (RDS1) [627] chr3 (310954..313452) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region, involved in resistance to cycloheximide [2499
          bp, 832 aa]
          Length = 832

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 1  MSSLITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQ 47
          M S+      L ++ C QC+  K +C +  P C  C + + +C Y +
Sbjct: 1  MDSITVKKPRLRLV-CLQCKKIKRKCDKLRPACSRCQQNSLQCEYEE 46

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKT 52
          ++C+ CR ++ +C  + P C +C K   EC      ++T
Sbjct: 15 LACQNCRIKRRKCDMERP-CSNCLKYGIECITVNNDKRT 52

>Scas_630.14
          Length = 701

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNC-ECFY 45
          SC  CR RK +C R  P C SC      EC Y
Sbjct: 25 SCTVCRLRKSKCDRIKPYCSSCVLHGIKECRY 56

>Kwal_26.6664
          Length = 579

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 20/39 (51%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTS 53
          +C +C + K +C++  P C  C + + +C Y    R  S
Sbjct: 14 ACIKCYNGKRKCNKAKPVCGRCARLHLQCLYSAELRTKS 52

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFYPQTQRKTSTK 55
          +C  CR +KV+C    P C  CT  + EC Y    ++  ++
Sbjct: 19 ACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKRLQSR 58

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
          (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 6/37 (16%)

Query: 15 SCRQCRDRKVRC------SRQIPKCKSCTKRNCECFY 45
          +C  CR RKVRC        + P C  C++   EC +
Sbjct: 31 ACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIF 67

>KLLA0E14036g complement(1239566..1241602) some similarities with
          ca|CA4758|CaPPR1 Candida albicans transcription factor
          regulating pyrimidine pathway (by homology),
          hypothetical start
          Length = 678

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 9/32 (28%), Positives = 17/32 (53%)

Query: 14 ISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          ++C  C+ R+ RC    P+C +C     +C +
Sbjct: 65 VACCFCKRRRKRCDGGFPQCGACVNAGIQCTF 96

>YDR207C (UME6) [1046] chr4 complement(865005..867515) Global
           transcriptional regulator containing a zinc binuclear
           cluster domain involved in pathway specific repression
           or induction [2511 bp, 836 aa]
          Length = 836

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 8   SQGL-SIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
           SQG  S   C  CR RK +C+ + P C +C +   +C Y
Sbjct: 762 SQGTRSRTGCWICRLRKKKCTEERPHCFNCERLKLDCHY 800

>CAGL0F09229g complement(908186..910693) weakly similar to
          sp|P39961 Saccharomyces cerevisiae YER184c,
          hypothetical start
          Length = 835

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 13 IISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          I +C  CR RKV+C    P C SC   +  C Y
Sbjct: 18 IRACDVCRKRKVKCDGDQP-CSSCMTASTVCIY 49

>YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3174 bp, 1057 aa]
          Length = 1057

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 13  IISCRQCRDRKVRC--SRQIP-KCKSCTKRNCEC-FYPQTQRKTSTKLNKKRKN 62
           + SC  CR  K++C  S+  P  C  C K    C   PQ + K  ++L   R++
Sbjct: 54  VTSCTHCRQHKIKCDASQNFPHPCSRCEKIGLHCEINPQFRPKKGSQLQLLRQD 107

>KLLA0D12650g complement(1073580..1075535) weakly similar to
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 651

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 19/44 (43%)

Query: 2  SSLITDSQGLSIISCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45
          SS  T  +  S   C  CRDR  +C  + P C  C +    C +
Sbjct: 18 SSATTLVEKRSSRGCLTCRDRHKKCDEKKPLCSGCKENFLRCVW 61

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 14  ISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43
           ++C  CR R+ +C  Q P C +C K   EC
Sbjct: 74  LACSNCRRRRKKCDLQYP-CFTCDKLGLEC 102

>Kwal_23.4016
          Length = 628

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 13 IISCRQCRDRKVRCSRQI--PKCKSCTKRNCECFYPQTQRKTST 54
          +++C  C  +K++C R     KC  CT+    C      RKTS+
Sbjct: 14 LVACDNCYRKKIKCRRNNDEEKCAQCTRLKIRC----VNRKTSS 53

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
          cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 15 SCRQCRDRKVRCSRQIPK--CKSCTKRNCECFY 45
          +C QCR +K++C R   +  C SC +    C +
Sbjct: 15 ACDQCRRKKIKCDRNQERNICTSCQRNGERCKF 47

>YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription
          factor regulating genes of branched chain amino acid
          biosynthesis pathways, acts as both a repressor and an
          inducer [2661 bp, 886 aa]
          Length = 886

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 3/41 (7%)

Query: 15 SCRQCRDRKVRC---SRQIPKCKSCTKRNCECFYPQTQRKT 52
          +C +CR +K +C    R    C  C K+N  C   +  R+T
Sbjct: 36 ACVECRQQKSKCDAHERAPEPCTKCAKKNVPCILKRDFRRT 76

>KLLA0E02222g complement(208267..209709) weakly similar to
           ca|CA1385|IPF8424 Candida albicans unknown function,
           hypothetical start
          Length = 480

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 326 MVENPNKTLLGYLKLGILTASRVKLIFSVYTKNEVSATKKETLKS 370
           + EN  KTL   ++L I T ++VKL+ +VY K  +S T ++T  S
Sbjct: 94  LTENVPKTL--DIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSS 136

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.134    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,111,001
Number of extensions: 701464
Number of successful extensions: 2338
Number of sequences better than 10.0: 243
Number of HSP's gapped: 2353
Number of HSP's successfully gapped: 246
Length of query: 560
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 453
Effective length of database: 12,891,983
Effective search space: 5840068299
Effective search space used: 5840068299
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)