Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.24351247122963190.0
AAL182W1231121632140.0
YJL074C (SMC3)1230121930700.0
Scas_711.391227121730380.0
KLLA0A00286g1280123028310.0
CAGL0H02805g1219121428080.0
CAGL0D05258g117012954997e-51
Sklu_2249.2108311233907e-38
AGL023W122213083157e-29
CAGL0L12188g13987112631e-22
KLLA0D07502g12438622504e-21
Scas_681.414098062442e-20
YLR086W (SMC4)14187342442e-20
KLLA0F19085g13727282333e-19
AGR089C13709942308e-19
YFR031C (SMC2)11702112121e-16
Scas_565.611702112065e-16
CAGL0F02079g12237052003e-15
Kwal_56.2382513961092003e-15
Kwal_55.2042111702401887e-14
YFL008W (SMC1)12252281762e-12
KLLA0D16005g11701981743e-12
AGR236W11702111718e-12
Scas_707.2312232251691e-11
Kwal_23.50431225791564e-10
KLLA0F07997g11192581262e-06
AEL337C10973451191e-05
Scas_643.1110952061144e-05
Kwal_26.720411172311101e-04
AER044W11031601010.001
Scas_719.61096238990.002
YOL034W (SMC5)109361950.006
YLR383W (RHC18)1114361940.009
CAGL0F01155g110582920.013
CAGL0H05071g111071890.031
CAGL0G08041g60783850.073
Scas_636.1460880850.091
YDR091C60880840.10
ABR227C75731830.16
KLLA0E05247g1098116820.21
Kwal_56.2342953976810.22
AGR125W60780800.30
CAGL0F01529g75731800.34
Kwal_33.13526129895780.57
CAGL0B02772g432106751.1
Kwal_26.948071950751.2
KLLA0C17556g60783751.2
Kwal_26.9380110283751.4
KLLA0A10131g72050741.7
YDR283C (GCN2)165979741.9
AFL158C56465732.1
Kwal_14.109076331732.1
AFR203C20466703.0
KLLA0C01991g70656713.6
AGL335W69149714.1
YIR017C (MET28)18731684.5
AFR364C797222695.9
YNL239W (LAP3)45447687.5
KLLA0E19723g214131697.8
ACR281C1259220688.2
Scas_565.144276679.2
KLLA0F11792g62181679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2435
         (1229 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2435                                                         2438   0.0  
AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...  1242   0.0  
YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...  1187   0.0  
Scas_711.39                                                          1174   0.0  
KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...  1095   0.0  
CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...  1086   0.0  
CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces c...   196   7e-51
Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement         154   7e-38
AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH] complement(...   125   7e-29
CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces...   105   1e-22
KLLA0D07502g complement(642751..646482) similar to sp|P32908 Sac...   100   4e-21
Scas_681.4                                                             99   2e-20
YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensi...    99   2e-20
KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomy...    94   3e-19
AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..90...    93   8e-19
YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of...    86   1e-16
Scas_565.6                                                             84   5e-16
CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces c...    82   3e-15
Kwal_56.23825                                                          82   3e-15
Kwal_55.20421                                                          77   7e-14
YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein ...    72   2e-12
KLLA0D16005g complement(1346492..1350004) similar to sp|P38989 S...    72   3e-12
AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH] complement(...    70   8e-12
Scas_707.23                                                            70   1e-11
Kwal_23.5043                                                           65   4e-10
KLLA0F07997g complement(748561..751920) similar to sgd|S0005394 ...    53   2e-06
AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [32...    50   1e-05
Scas_643.11                                                            49   4e-05
Kwal_26.7204                                                           47   1e-04
AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH] complement...    44   0.001
Scas_719.6                                                             43   0.002
YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing ...    41   0.006
YLR383W (RHC18) [3762] chr12 (885288..888632) Protein involved i...    41   0.009
CAGL0F01155g complement(116762..120079) similar to tr|Q08204 Sac...    40   0.013
CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces c...    39   0.031
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...    37   0.073
Scas_636.14                                                            37   0.091
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...    37   0.10 
ABR227C [821] [Homologous to ScYLR069C (MEF1) - SH] (827283..829...    37   0.16 
KLLA0E05247g complement(472583..475879) similar to sp|Q12749 Sac...    36   0.21 
Kwal_56.23429                                                          36   0.22 
AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...    35   0.30 
CAGL0F01529g 156044..158317 highly similar to sp|P25039 Saccharo...    35   0.34 
Kwal_33.13526                                                          35   0.57 
CAGL0B02772g complement(267689..268987) similar to tr|Q05919 Sac...    33   1.1  
Kwal_26.9480                                                           33   1.2  
KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...    33   1.2  
Kwal_26.9380                                                           33   1.4  
KLLA0A10131g complement(889688..891850) similar to sp|P40416 Sac...    33   1.7  
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    33   1.9  
AFL158C [3037] [Homologous to ScYAL067C (SEO1) - NSH] (137788..1...    33   2.1  
Kwal_14.1090                                                           33   2.1  
AFR203C [3395] [Homologous to ScYMR117C (SPC24) - SH] (804580..8...    32   3.0  
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    32   3.6  
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    32   4.1  
YIR017C (MET28) [2682] chr9 complement(383553..384116) Transcrip...    31   4.5  
AFR364C [3556] [Homologous to ScYEL043W - SH] (1095530..1097923)...    31   5.9  
YNL239W (LAP3) [4368] chr14 (200568..201932) Aminopeptidase of c...    31   7.5  
KLLA0E19723g 1743508..1749933 highly similar to sp|Q12680 Saccha...    31   7.8  
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    31   8.2  
Scas_565.1                                                             30   9.2  
KLLA0F11792g 1087802..1089667 similar to sgd|S0002456 Saccharomy...    30   9.8  

>Kwal_14.2435
          Length = 1247

 Score = 2438 bits (6319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1200/1229 (97%), Positives = 1200/1229 (97%)

Query: 1    MKPRRVNSIRNQSRASFRAREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGS 60
            MKPRRVNSIRNQSRASFRAREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGS
Sbjct: 1    MKPRRVNSIRNQSRASFRAREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGS 60

Query: 61   GKSNFFAAVRFVLSDDYSSLKREERQGLIHQGTGSIMSAYVEIVFHDPSDQMMMTSGIPV 120
            GKSNFFAAVRFVLSDDYSSLKREERQGLIHQGTGSIMSAYVEIVFHDPSDQMMMTSGIPV
Sbjct: 61   GKSNFFAAVRFVLSDDYSSLKREERQGLIHQGTGSIMSAYVEIVFHDPSDQMMMTSGIPV 120

Query: 121  TEEHIVRVRRTIGLKKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNA 180
            TEEHIVRVRRTIGLKKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNA
Sbjct: 121  TEEHIVRVRRTIGLKKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNA 180

Query: 181  KDKERLLLLEDVVGARSFEIKLRESSKKMEATNRDRAKITSELSELKAXXXXXXXXXXXX 240
            KDKERLLLLEDVVGARSFEIKLRESSKKMEATNRDRAKITSELSELKA            
Sbjct: 181  KDKERLLLLEDVVGARSFEIKLRESSKKMEATNRDRAKITSELSELKARLEELDEERQEL 240

Query: 241  XKYQELERDRRIFQFVLYDRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANL 300
             KYQELERDRRIFQFVLYDRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANL
Sbjct: 241  EKYQELERDRRIFQFVLYDRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANL 300

Query: 301  TKNISNVEAELKLKESTDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKN 360
            TKNISNVEAELKLKESTDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKN
Sbjct: 301  TKNISNVEAELKLKESTDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKN 360

Query: 361  LATVEEEIQNTSTQLNRLSPRYEQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQS 420
            LATVEEEIQNTSTQLNRLSPRYEQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQS
Sbjct: 361  LATVEEEIQNTSTQLNRLSPRYEQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQS 420

Query: 421  ERDAWIAKELSSLKAQTDDLKKNVEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSE 480
            ERDAWIAKELSSLKAQTDDLKKNVEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSE
Sbjct: 421  ERDAWIAKELSSLKAQTDDLKKNVEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSE 480

Query: 481  LQDIQTHLNDLKRSYLEKIDERKELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLAN 540
            LQDIQTHLNDLKRSYLEKIDERKELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLAN
Sbjct: 481  LQDIQTHLNDLKRSYLEKIDERKELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLAN 540

Query: 541  GLKAVREITQRLKLPPGAVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILM 600
            GLKAVREITQRLKLPPGAVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILM
Sbjct: 541  GLKAVREITQRLKLPPGAVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILM 600

Query: 601  SELYNTKAGRVTFIPLNRISDRNAVTFPENAQAECTPLLWKIKYDKVFEKAVRHVFGRTI 660
            SELYNTKAGRVTFIPLNRISDRNAVTFPENAQAECTPLLWKIKYDKVFEKAVRHVFGRTI
Sbjct: 601  SELYNTKAGRVTFIPLNRISDRNAVTFPENAQAECTPLLWKIKYDKVFEKAVRHVFGRTI 660

Query: 661  VVRDLGNGSKLARSYNLDAVTLDGDRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLT 720
            VVRDLGNGSKLARSYNLDAVTLDGDRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLT
Sbjct: 661  VVRDLGNGSKLARSYNLDAVTLDGDRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLT 720

Query: 721  QATQSLNAVRLKIGAIDSEIDNVNGELKAQAARKDAILANIEGLRLKMSKMTADSTFKME 780
            QATQSLNAVRLKIGAIDSEIDNVNGELKAQAARKDAILANIEGLRLKMSKMTADSTFKME
Sbjct: 721  QATQSLNAVRLKIGAIDSEIDNVNGELKAQAARKDAILANIEGLRLKMSKMTADSTFKME 780

Query: 781  NLEAMTVKLNRLKTSLTVNEEKIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPM 840
            NLEAMTVKLNRLKTSLTVNEEKIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPM
Sbjct: 781  NLEAMTVKLNRLKTSLTVNEEKIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPM 840

Query: 841  ARTTEALSELSLRIDLLKTELNVKLNPQKRDLENRLEEEYSRDDLTTNRELEHMADELKK 900
            ARTTEALSELSLRIDLLKTELNVKLNPQKRDLENRLEEEYSRDDLTTNRELEHMADELKK
Sbjct: 841  ARTTEALSELSLRIDLLKTELNVKLNPQKRDLENRLEEEYSRDDLTTNRELEHMADELKK 900

Query: 901  LAVKEQDLQTSLASLTEAIGTLSEERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIK 960
            LAVKEQDLQTSLASLTEAIGTLSEERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIK
Sbjct: 901  LAVKEQDLQTSLASLTEAIGTLSEERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIK 960

Query: 961  KTSLITRRDEVQXXXXXXXXXXXXXXXXHQNLETERILRKLNTVNDKISKMSNINRRAIE 1020
            KTSLITRRDEVQ                HQNLETERILRKLNTVNDKISKMSNINRRAIE
Sbjct: 961  KTSLITRRDEVQLRISEIGLLSEESLERHQNLETERILRKLNTVNDKISKMSNINRRAIE 1020

Query: 1021 NFKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLV 1080
            NFKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLV
Sbjct: 1021 NFKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLV 1080

Query: 1081 PAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYV 1140
            PAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYV
Sbjct: 1081 PAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYV 1140

Query: 1141 EQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFIC 1200
            EQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFIC
Sbjct: 1141 EQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFIC 1200

Query: 1201 TTFRTDMLQVADSFYRVKFENKISEIATV 1229
            TTFRTDMLQVADSFYRVKFENKISEIATV
Sbjct: 1201 TTFRTDMLQVADSFYRVKFENKISEIATV 1229

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 1242 bits (3214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1216 (51%), Positives = 867/1216 (71%), Gaps = 15/1216 (1%)

Query: 25   MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84
            MYI+ V+I+GFKTY+N T +++FSPH NVV+G NGSGKSNFFAA+RFVLSDDY++LKREE
Sbjct: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 85   RQGLIHQGTGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVNGK 144
            R+ LI+QGT S+MS YVEIVFH   ++ ++ +     +  ++ +RRT+GLKKDEY +N K
Sbjct: 61   RRSLIYQGTSSVMSGYVEIVFHGAENRTLLGA----QDGGVIHIRRTVGLKKDEYMINNK 116

Query: 145  TCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIKLRE 204
               +SD+ R+ ES GFS SNPYNIVPQGRIV++TNA+++ERL LLE+V+GA+SFE KL+E
Sbjct: 117  NASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKE 176

Query: 205  SSKKMEATNRDRAKITSELSELKAXXXXXXXXXXXXXKYQELERDRRIFQFVLYDRELNE 264
            S +KME T ++R KI  EL E++A             KY  L+R R++ QF LYDRELNE
Sbjct: 177  SLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDRELNE 236

Query: 265  VTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKESTDFQQDKS 324
            VTS +E L+ EY N L  SE+YIQEL KRE+LI  LTK+++ + +ELK+KESTD QQ K 
Sbjct: 237  VTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQAKD 296

Query: 325  RLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQLNRLSPRYEQ 384
               E+ K  ADL ++YEE   Q + +  Q A   ++L  +  +I     QL RLSPR+EQ
Sbjct: 297  SELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRFEQ 356

Query: 385  LKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSERDAWIAKELSSLKAQTDDLKKNV 444
            L +E  A +A+    Q++QR++++KRG Y+QF N++ERDAWI +ELS LK +       +
Sbjct: 357  LTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQCSSIAL 416

Query: 445  EIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDERKE 504
              +  E++ +  ++    + I ELNDS  GPGI++EL+D+Q  L  LK+++L KIDERK+
Sbjct: 417  TSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQ 476

Query: 505  LWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGPLG 564
            LWRSEQ++Q+V E+L+D VKR+E  LSETMDR+LA GLK V EI QRL LP G+V GPLG
Sbjct: 477  LWRSEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGPLG 536

Query: 565  ELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDRNA 624
            ELIK++EKYK CAE VGG SL HVVVDTE TA++LM ELYN+K GRVTFIPLNR+   + 
Sbjct: 537  ELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSN 596

Query: 625  VTFPENAQAECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLARSYNLDAVTLDG 684
            + +P N +  CTPL+ KIKYD  FE+A++HVFG+TIVV+DL  G+KLA+ + L+A+TLDG
Sbjct: 597  IVYPSNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRLNAITLDG 656

Query: 685  DRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKIGAIDSEIDNVN 744
            D+AD+RGV+TGG+HD+HK+ RLD ++D+ S K++       L  V+ K+ +ID EID +N
Sbjct: 657  DKADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDELN 716

Query: 745  GELKAQAARKDAILANIEGLRLKMSKMTADSTFKMENLEAMTVKLNRLKTSLTVNEEKIE 804
             ++K   +R++ IL  +E + +K+ K   +     E +  +  K  + K +  + ++K++
Sbjct: 717  DKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKLLQDKLD 776

Query: 805  KYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTEALSELSLRIDLLKTELNVK 864
             Y +DL + F+  L+  E E L  +A ++  L   +  TT+ALS + ++ID LK EL+ K
Sbjct: 777  MYTEDLSRDFDTELTLTEREELDEIAKKLPDLENLLNTTTDALSSVVVKIDSLKAELDSK 836

Query: 865  LNPQKRDLENRLEEEYSRDDLTTNRE-LEHMADELKKLAVKEQDLQTSLASLTEAIGTLS 923
            L PQ ++LE++  E  S   +   +E ++ + DE K L  ++  +   +  ++E I TL 
Sbjct: 837  LKPQAKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDTLK 896

Query: 924  EERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIKKTSLITRRDEVQXXXXXXXXXXX 983
              +   ++ LEKA+SQQRAL+KKLD +QKEAEKS+++K +L TRRDE+Q           
Sbjct: 897  SRQEEEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDIGLLPD 956

Query: 984  XXXXXHQNLETERILRKLNTVNDKISKMSNINRRAIENFKKFNDKREDLESRAEELEQSK 1043
                 + N+ +  +L++L+++NDKISKM+N+N+RA+ENFKKF+DK++D+  RA+EL++SK
Sbjct: 957  DSADKYHNMSSSELLKELSSINDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDESK 1016

Query: 1044 ESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGTGQR 1103
            ESIEKL++ LKKQKVEAVE TF KV+ NFT +FEK+VP G G+L+IHR   + ++ + ++
Sbjct: 1017 ESIEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEPSKPSKRQ 1076

Query: 1104 S-------PEYSPLNSNAD---TLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAI 1153
                     E    N + D   + DS+YSGVSI VSFNSK +EQ++VEQLSGGQKTVCAI
Sbjct: 1077 QKKRKRQETEDVHFNDDQDENSSQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAI 1136

Query: 1154 ALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADS 1213
            ALILAIQMVDPAPFYLFDEIDAALDKQYRT+VA T+K+LS+ AQFICTTFR DM+ VAD 
Sbjct: 1137 ALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADR 1196

Query: 1214 FYRVKFENKISEIATV 1229
            FYRV FENKIS +  V
Sbjct: 1197 FYRVNFENKISTVVEV 1212

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 1187 bits (3070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1219 (50%), Positives = 853/1219 (69%), Gaps = 21/1219 (1%)

Query: 25   MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84
            MYI+ V+I+GFKTYRN T +++FSPH NV+IG NGSGKSNFFAA+RFVLSDDYS+LKREE
Sbjct: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 85   RQGLIHQGTG-SIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVNG 143
            RQGLIHQG+G S+MSA VEIVFHDP   M++ SG+    +  V +RRT+GLKKD+Y +N 
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLND 120

Query: 144  KTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIKLR 203
            +   K DI RM E+ GFS +NPYNIVPQG+IVA+TNAKDKERL LLEDVVGA+SFE+KL+
Sbjct: 121  RNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLK 180

Query: 204  ESSKKMEATNRDRAKITSELSELKAXXXXXXXXXXXXXKYQELERDRRIFQFVLYDRELN 263
             S KKME T + + +I  E+ EL +             KY ELER+R+I+QF LYDRELN
Sbjct: 181  ASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDRELN 240

Query: 264  EVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKESTDFQQDK 323
            EV +Q+E L+ +YNN + SSE+YIQEL KRE +I  ++K +S++EA LK+K +TD QQ K
Sbjct: 241  EVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAK 300

Query: 324  SRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQLNRLSPRYE 383
             R  EI ++  ++ ++ ++ ++Q +    Q  +    L  ++  I+    +L+++ PRY+
Sbjct: 301  LRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQ 360

Query: 384  QLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSERDAWIAKELSSLKAQTDDLKKN 443
            +L  E   ++ QL+  Q+KQR++I K+G YA+F+++ ERD WI  E+  LK+   +L + 
Sbjct: 361  ELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNEL 420

Query: 444  VEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDERK 503
               ++ ++  +  +     E I EL DS+ GP    +L+D  + L  LK+   E +D RK
Sbjct: 421  ESQLQMDRTSLRKQYSAIDEEIEELIDSINGPDTKGQLEDFDSELIHLKQKLSESLDTRK 480

Query: 504  ELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGPL 563
            ELWR EQ+LQTV E LL  V +++RN++ETM R+LANG+  V+EIT++LK+ P +V G L
Sbjct: 481  ELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTL 540

Query: 564  GELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDRN 623
            GELIKVN+KYKTCAE +GGNSL H+VVDTEETA+++M+ELY  K GRVTFIPLNR+S  +
Sbjct: 541  GELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDS 600

Query: 624  AVTFPEN--AQAECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLARSYNLDAVT 681
             V FP N   Q + TPL+ KIKY+  FEKAV+HVFG+TIVV+DLG G KLA+ + L+A+T
Sbjct: 601  DVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAIT 660

Query: 682  LDGDRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKIGAIDSEID 741
            LDGDRAD RGV+TGGY D HKRTRL+ LK+++ ++ Q  +  + L+ VR ++  ID++ID
Sbjct: 661  LDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKID 720

Query: 742  NVNGELKAQAARKDAILANIEGLRLKMSKMTADSTFKMENLEAMTVKLNRLKTSLTVNEE 801
             VNG ++  +  ++++L NIE  R  ++    +     E+L A+ +KL +L T+ T  +E
Sbjct: 721  QVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQE 780

Query: 802  KIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTEALSELSLRIDLLKTEL 861
            K+  +E+DL + F+  LS EE+E L+SL  EI      +  T++AL  ++  ID L  EL
Sbjct: 781  KLNTFENDLLQEFDSELSKEEKERLESLTKEISAAHNKLNITSDALEGITTTIDSLNAEL 840

Query: 862  NVKLNPQKRDLENRLEEEYSRDDLTTNRELEHMADELKKLAVKEQDLQTS-------LAS 914
              KL PQ+ DLE+++ E         +  +  + DELK+L ++++ ++         L +
Sbjct: 841  ESKLIPQENDLESKMSE-------VGDAFIFGLQDELKELQLEKESVEKQHENAVLELGT 893

Query: 915  LTEAIGTLSEERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIKKTSLITRRDEVQXX 974
            +   I +L  E  N ++LLEKA++QQR L+KKLD FQK  EK++IKKT+L+TRR+E+Q  
Sbjct: 894  VQREIESLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTRREELQQR 953

Query: 975  XXXXXXX-XXXXXXXHQNLETERILRKLNTVNDKISKMSNINRRAIENFKKFNDKREDLE 1033
                             ++ ++++L++LN +N +IS + N+N+RA ENFKKFN++R+DL 
Sbjct: 954  IREIGLLPEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLA 1013

Query: 1034 SRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTT 1093
             RA EL++SK+SI+ L+  LK+QKV AV++TF KV+ NF  +FE+LVP G  +LIIHR  
Sbjct: 1014 ERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKN 1073

Query: 1094 EKSNRGTGQRSPEY---SPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTV 1150
            + +N        +    S  + N    + MY+GVSISVSFNSK NEQL+VEQLSGGQKTV
Sbjct: 1074 DNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTV 1133

Query: 1151 CAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQV 1210
            CAIALILAIQMVDPA FYLFDEIDAALDKQYRT+VA  +KELS +AQFICTTFRTDMLQV
Sbjct: 1134 CAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQV 1193

Query: 1211 ADSFYRVKFENKISEIATV 1229
            AD F+RVK+ENKIS +  V
Sbjct: 1194 ADKFFRVKYENKISTVIEV 1212

>Scas_711.39
          Length = 1227

 Score = 1174 bits (3038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/1217 (49%), Positives = 851/1217 (69%), Gaps = 20/1217 (1%)

Query: 25   MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84
            MYI+ V+I+GFKTYRN T ++DFSPH N+VIG NGSGKSNFF+A+RFVLSDDYS+LKREE
Sbjct: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 85   RQGLIHQGTG-SIMSAYVEIVFHDPSDQMMMTSGI-PVTEEHIVRVRRTIGLKKDEYSVN 142
            RQGLIHQG+G S+MSA VEIVFHDP  +M++ SG+ P      + +RRT+GLKKD+Y +N
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120

Query: 143  GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIKL 202
             +   K D+ RM ES GFS SNPYNIVPQG+I+++TNAKDKERL LLEDVVGA+SFE+KL
Sbjct: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180

Query: 203  RESSKKMEATNRDRAKITSELSELKAXXXXXXXXXXXXXKYQELERDRRIFQFVLYDREL 262
            + S KKME T + RA+I  E+ EL +             KY  LE++R++FQF LYDREL
Sbjct: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240

Query: 263  NEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKESTDFQQD 322
            N++ +Q+E L+D+YN    SSE+YI+EL KRE +I+N++KN+S +++ LK+K +TD  Q 
Sbjct: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300

Query: 323  KSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQLNRLSPRY 382
            KSR  E+  +  +L+++ ++ K Q      Q    +K L  + +EIQ    +L+ +SP++
Sbjct: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360

Query: 383  EQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSERDAWIAKEL----SSLKAQTD 438
            ++L  E   F+ Q ++ Q++QR+++ K+G YA+F +  ER+ WI  E+     +L+   D
Sbjct: 361  QELSKEELKFKLQYNKLQQRQRDLLLKKGRYARFASIEERNEWIQNEIEESDKTLQGLVD 420

Query: 439  DLKKNVEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRSYLEK 498
             +K  + I   E++++ ++++   E I  LNDS+ GP ++ EL+ IQ  L  LK  Y   
Sbjct: 421  -IKNKILI---ERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAAS 476

Query: 499  IDERKELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGA 558
            ID+RKELWR+EQ+++TV + LL+ VK  ERN++ETMDR+LANG+K+V+EI  +LKLP  +
Sbjct: 477  IDKRKELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDS 536

Query: 559  VHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNR 618
            V G LGELI VNEKYK CAE VGGNSL H+VVDTEETA+I+M ELY  K GRVTFIPLNR
Sbjct: 537  VFGTLGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNR 596

Query: 619  ISDRNAVTFPENAQAECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLARSYNLD 678
            I     + +P N Q   TPL+ KIKYD+ F+KAVRH+FG+TIVV+DL  G ++++ + L+
Sbjct: 597  IYLDANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKKFKLN 656

Query: 679  AVTLDGDRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKIGAIDS 738
            ++TLDGDRAD RGV+TGGY+D +K++RLD L  ++ +  +  + +  L +++  I  +DS
Sbjct: 657  SITLDGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQEVDS 716

Query: 739  EIDNVNGELKAQAARKDAILANIEGLRLKMSKMTADSTFKMENLEAMTVKLNRLKTSLTV 798
             ID +N  ++     ++++L+NIEG++ K+     D     E+L+A+ +K  + + ++ V
Sbjct: 717  NIDTLNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEINIRV 776

Query: 799  NEEKIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTEALSELSLRIDLLK 858
              +K E Y  D+   F   LS  E+E L+  ++ + ++ + +  TTE L  ++  ++ L 
Sbjct: 777  TADKKETYVKDMSSEFNSELSLVEKEELEVTSISLLEIEKKLTLTTENLETVTSEMNSLN 836

Query: 859  TELNVKLNPQKRDLENRLEEEYSRDDLTTNRELEHMADELKKLAVKEQDLQTSLASLTEA 918
             ELN KL PQK+D+ +++ +E      +  R+++ M  +L+ +  +       + ++ + 
Sbjct: 837  AELNSKLFPQKQDILSQMSQEGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKE 896

Query: 919  IGTLSEERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIKKTSLITRRDEVQXXXXXX 978
            I  L  E+ N  ++LEKA+SQQR L+KKL+TFQK+ EK++IKKT+LITRRDE+Q      
Sbjct: 897  IEDLKSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQKIREI 956

Query: 979  XXXXXXXXXXHQNLETERILRKLNTVNDKISKMSNINRRAIENFKKFNDKREDLESRAEE 1038
                        +L +E +L++LN+V++ IS + N+N+RA ENF+KF++K+++L  RA E
Sbjct: 957  GLLAEDALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVERATE 1016

Query: 1039 LEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTE---- 1094
            L++SK SI+ L+  L++QKV AV++TF KVA NF T+FEKLVP G  +LIIHR       
Sbjct: 1017 LDESKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARM 1076

Query: 1095 --KSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCA 1152
               SN        E   +N+N    +S+Y+GVSISVSFNSK NEQL+VEQLSGGQKTVCA
Sbjct: 1077 ETNSNDDDVDMDQEDEVINNN----ESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCA 1132

Query: 1153 IALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVAD 1212
            IALILAIQMVDPAPFYLFDEIDAALDKQYRT+VAN IK+LS +AQFICTTFRTDMLQVAD
Sbjct: 1133 IALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVAD 1192

Query: 1213 SFYRVKFENKISEIATV 1229
             F+RVK+ENKIS +  V
Sbjct: 1193 RFFRVKYENKISTVIEV 1209

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 1095 bits (2831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1230 (47%), Positives = 822/1230 (66%), Gaps = 45/1230 (3%)

Query: 23   VEM-YIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLK 81
            VEM +I++V+I GFKTY+N T VE+FSPH NVV+G NGSGKSNFFAA+RFVLS++ S+LK
Sbjct: 55   VEMVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLK 114

Query: 82   REERQGLIHQGTGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSV 141
            RE+R+G I+QG G +MSA+VEI+F DP + M+        E   VR+RRT+GLKKDEY +
Sbjct: 115  REDRKGFIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGE---VRIRRTVGLKKDEYMI 171

Query: 142  NGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIK 201
            N K   + D+ R+ E+VGFS SNPYNIVPQGRI+++TNAKD ERL LLEDVVGA+SFE K
Sbjct: 172  NDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENK 231

Query: 202  LRESSKKMEATNRDRAKITSELSELKAXXXXXXXXXXXXXKYQELERDRRIFQFVLYDRE 261
            L+ES KKMEA  RDR KIT+EL+EL               KY  L RDR++ QF LYDRE
Sbjct: 232  LKESLKKMEAAERDRTKITNELNELDKRLSELSDEKEELEKYNNLNRDRKVLQFCLYDRE 291

Query: 262  LNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKESTDFQQ 321
            LN++T+QIE LE EYN+++++S EY+ EL KRE L   L K ++++E+E+K+K+STD  Q
Sbjct: 292  LNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQ 351

Query: 322  DKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQLNRLSPR 381
             K+   E+    ADL+ R  + + Q D          K +  V+++I+   + +  + P+
Sbjct: 352  LKASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPK 411

Query: 382  YEQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSERDAWIAKELSSLKAQ----- 436
            +++L  EAE  + ++ +  ++QRE++SK+G Y  F   +ER+ WI ++++ L        
Sbjct: 412  FQKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSN 471

Query: 437  --TDDLKKNVEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRS 494
               D L   +  ++ + E + AEI+       +L DSV G G  ++ +D+Q  +   K+ 
Sbjct: 472  ILKDQLTSQLSTLQHDLENLNAEIE-------DLADSVNGMGSVAQQEDLQNKVTQAKKE 524

Query: 495  YLEKIDERKELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKL 554
            YL KID+RK+LWR+EQRLQT+S +L + VKR E +++ET+DR+LA GL+ V +I  RL L
Sbjct: 525  YLTKIDQRKQLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNL 584

Query: 555  PPGAVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFI 614
                V GP+GELIKV++KYK CAE VGGNSL +VVVD EETAS+L+ EL+ TK GRVTFI
Sbjct: 585  HE-HVFGPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFI 643

Query: 615  PLNRISDRNAVTFPENAQA-ECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLAR 673
            PLN++      T+P N +  +CTPL+ KIKYD  FEK ++ VFGRT+VV+ L +G+ LA+
Sbjct: 644  PLNKLHVDTNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAK 703

Query: 674  SYNLDAVTLDGDRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKI 733
             Y L+A+TLDGDRAD++GV++GGY D +K  RLD L+D   +K +  +    L  ++  +
Sbjct: 704  EYKLNAITLDGDRADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQAL 763

Query: 734  GAIDSEIDNVNGELKAQAARKDAILANIEG----LRLKMS-KMTADSTFKMENLEAMTVK 788
             +I+ EID +N  +K  AA +DA  A IE     L+ K+S K+T D + K     A+  +
Sbjct: 764  QSIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIK-----ALKAR 818

Query: 789  LNRLKTSLTVNEEKIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTEALS 848
            LN++ T L    E+   +  D+ KPF   L  +E+  L +++  I+     +      L+
Sbjct: 819  LNKIDTELEQCRERTNAFAADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLN 878

Query: 849  ELSLRIDLLKTELNVKLNPQKRDLENRLEEEYSRDDLTTNRELEHMADELKKLAVKEQDL 908
            ELS ++D L  ELN KL P+  +LE +    +S      N ++E +  E + +   ++ +
Sbjct: 879  ELSSKLDELNAELNSKLLPKLHELERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQV 938

Query: 909  QTSLASLTEAIGTLSEERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIKKTSLITRR 968
            ++ L+ L  +I +L  E+A  Q+ L+KA+SQQR+LVK++  FQK AEK ++KK++L +R+
Sbjct: 939  ESELSVLDSSIKSLRGEKATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRK 998

Query: 969  DEVQXXXXXXXXXXXXXXXXHQNLETERILRKLNTVNDKISKMSNINRRAIENFKKFNDK 1028
            +E+Q                ++ L ++ IL+KLNT    +SKM+N+N+RA EN+ +F DK
Sbjct: 999  EELQQLIREVGLLAEESLKKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDK 1058

Query: 1029 REDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLI 1088
            R +L SRAEEL++SK+SIE L++ LK+QK+ A+E TF+KVA NF+ +F  LVP GIG+LI
Sbjct: 1059 RGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLI 1118

Query: 1089 I-HR--------TTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLY 1139
            I HR        +T+K  RG  Q       LN      +S Y+GVSI VSFNSK +EQL 
Sbjct: 1119 INHRKNTDNSEVSTKKRRRGARQEQNSAEALN------ESKYTGVSIQVSFNSKKDEQLR 1172

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFI 1199
            VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR +VA TIK LS  AQFI
Sbjct: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1232

Query: 1200 CTTFRTDMLQVADSFYRVKFENKISEIATV 1229
            CTTFRTDM+ VAD+F+RVKFENK+S +  V
Sbjct: 1233 CTTFRTDMINVADTFFRVKFENKVSTVTEV 1262

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 1086 bits (2808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1214 (47%), Positives = 819/1214 (67%), Gaps = 22/1214 (1%)

Query: 25   MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84
            MYI+ V+I+GFKTYRN T + DFSPH NVVIG NGSGKSNFFAAVRFVLSDDYS+LKREE
Sbjct: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 85   RQGLIHQGTG-SIMSAYVEIVFHDPSDQMMMTSGIPVT-EEHIVRVRRTIGLKKDEYSVN 142
            RQGLIHQG G S+MSA VEIVFHDP   ++  +GI        VR+RRT+GLKKD+Y VN
Sbjct: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120

Query: 143  GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIKL 202
             +   K D+ RM ES GF  SNPYNIVPQGRIV++TNAKDKERL LLE+VVGA+SFE+KL
Sbjct: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180

Query: 203  RESSKKMEATNRDRAKITSELSELKAXXXXXXXXXXXXXKYQELERDRRIFQFVLYDREL 262
            + S K+M+ T + RA+I++E+ EL++             KY  LERDR++ ++ L+DREL
Sbjct: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240

Query: 263  NEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKESTDFQQD 322
             ++ SQIESL+ +YN+ L SS++YI EL KRE +I  + + I N++  LKLK + D +Q 
Sbjct: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300

Query: 323  KSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQLNRLSPRY 382
            K+ L+E ++R   ++++ ++ K +  Q   Q    RKNL  + E I +  ++  ++SPR+
Sbjct: 301  KAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLKLITEIIDSKKSKRRKISPRF 360

Query: 383  EQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSERDAWIAKELSSLKAQTDDLKK 442
            +QL+ E +  +  L +   KQ   + K+G YA+F+++ ERD WI  ++  L    + +K 
Sbjct: 361  DQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESINTMKA 420

Query: 443  NVEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDER 502
            +   ++ +K  +  +I + +  I EL DS+ GPGI +E++DI+  L +L+R Y   ID R
Sbjct: 421  STTELKEQKSSIDVKINESENNIEELEDSLNGPGIKAEIEDIEKELINLRRKYTANIDAR 480

Query: 503  KELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGP 562
            KE WR EQ+LQ +S++L++ VK +ER+L+ETM R+LANG K V+EI +RL L   +V G 
Sbjct: 481  KEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTESVFGT 540

Query: 563  LGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDR 622
            +GELI+VNEKYK CAE +GGNSL HVVVDT+ETASILM+EL+  K GRVTF+PLN++ + 
Sbjct: 541  VGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG 600

Query: 623  NA-VTFPENAQAECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLARSYNLDAVT 681
            N  + +P +    CTPL+ KIKYD  F+  V+ VFGR +VV+DL NG  +++ Y L  +T
Sbjct: 601  NQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSCIT 660

Query: 682  LDGDRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKIGAIDSEID 741
            LDGDR D +GV+TGGY +  K++RL+ L+ ++ +K QL + +  L  ++ ++  +D++ID
Sbjct: 661  LDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDNDID 720

Query: 742  NVNGELKAQAARKDAILANIEGLRLKMSKMTADSTFKMENLEAMTVKLNRLKTSLTVNEE 801
            + NG ++    RK+ + +N+   + K+S    +  F  +    +  K++ +  +L V+ E
Sbjct: 721  STNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVSGE 780

Query: 802  KIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTEALSELSLRIDLLKTEL 861
            K+ + + DL K F   L+ EE++ ++ L+ EI +    +  T+E LS LS+ ID +  EL
Sbjct: 781  KLTQLKIDLTKTFNNELTTEEKKEIEILSKEILENQNKLNLTSETLSHLSVEIDTITAEL 840

Query: 862  NVKLNPQKRDLENRLEEEYSRDD-----LTTNRELEHMADEL-KKLAVKEQDLQTSLASL 915
              KL PQ+ D++ +L +  S D      L  + ELE  A E   +L ++++ LQ    S+
Sbjct: 841  ESKLIPQQNDIKQKLLD--SSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQ----SI 894

Query: 916  TEAIGTLSEERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIKKTSLITRRDEVQXXX 975
             + I +   E  N +++LEKA++QQR L+KKLD +QK+ +K++IKKT+L TR+ E++   
Sbjct: 895  EKEIESTKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKI 954

Query: 976  XXXXXXXXXXXXXHQNLETERILRKLNTVNDKISKMSNINRRAIENFKKFNDKREDLESR 1035
                          + L +E +L KLN  N +IS M NIN+RA EN+KKFN+K+ +L  R
Sbjct: 955  REVGIISEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRER 1014

Query: 1036 AEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEK 1095
            A EL+ SK+SI+ L+  LK+QK+ AV+ TF KV+ NF  IFEK+VP G   L IHR    
Sbjct: 1015 ATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRI--- 1071

Query: 1096 SNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIAL 1155
            + +GT   S  ++  N +     + Y GVSISVSFNSK +EQL VEQLSGGQKTVCAIAL
Sbjct: 1072 NLQGTDDNSELFTQSNEHT----TPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIAL 1127

Query: 1156 ILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFY 1215
            ILAIQMV+PAPFYLFDEIDAALDKQYR +VA TI +LS +AQFICTTFR+DM+  A+ FY
Sbjct: 1128 ILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFY 1187

Query: 1216 RVKFENKISEIATV 1229
            RVK+ENK S +  V
Sbjct: 1188 RVKYENKQSSVIEV 1201

>CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces
            cerevisiae YFR031c SMC2 chromosome segregation protein,
            start by similarity
          Length = 1170

 Score =  196 bits (499), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 308/1295 (23%), Positives = 556/1295 (42%), Gaps = 215/1295 (16%)

Query: 25   MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLS-DDYSSLKRE 83
            M ++ ++I GFK+Y   T + D+ P FN + G NGSGKSN   A+ FVL     ++++  
Sbjct: 1    MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS 60

Query: 84   ERQGLIHQ-GTGSIMSAYVEIVFHDPSDQMMMTSGIPV--TEEHIVRVRRTIGLK-KDEY 139
              Q LI++ G   +  A V IVF D +D+    S  P+  +E   + V R I L    +Y
Sbjct: 61   NLQDLIYKRGQAGVTKASVTIVF-DNTDK----SNTPIGFSEYPKISVTRQIVLGGTSKY 115

Query: 140  SVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFE 199
             +NG    +  + ++F+SV  + +NP  ++ QG+I  + N K  E L L+E+  G + FE
Sbjct: 116  LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSEILSLIEEAAGTKMFE 175

Query: 200  IKLRESSKKMEATNRDRAKITSELSELKAXXXXXXXXXXXXXKYQELERDRRIF---QFV 256
             +            +++A+ T +  E K              + ++L  ++R+F   Q +
Sbjct: 176  DR------------KEKAERTMQKKETKLQENRTLLKEEIDPQLEKLRNEKRLFLEFQTI 223

Query: 257  LYDRELNE---VTSQIESL---EDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAE 310
              D E  E   + +  + +    D    VL++S   + EL K+  L+    + ISN+  +
Sbjct: 224  QADLETTEKVVIATDYQKMLNSRDSIKTVLETSNSKMDELQKKIDLV---NREISNLNED 280

Query: 311  LKLKESTDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQN 370
            L+       +Q K  L+       D  I+  E+K   D++  + A  + NL    + I +
Sbjct: 281  LQ----QTMKQKKKELEN------DTNIKAMESKE--DKLLSEIAKLKANLKINGDNILD 328

Query: 371  TSTQLNRLSPRYEQLK---------LE--------AEAFEAQLSQYQRKQREIIS--KRG 411
               +  RL+ + E+ K         LE         EA   +L+   +++ E++S    G
Sbjct: 329  GKQKQKRLTVKIEKSKQLLDSKSQLLEDSKSKSRNCEADLTRLNSIFKQKEELLSVLSTG 388

Query: 412  IYAQFENQSERDAWIAKELSSLKAQTDDLKKNVEIMEAEKEQVAAEIQQDKEAITELNDS 471
            I +    +   +A I    SS+  + +D    +E  + + E +  E  +++E I +    
Sbjct: 389  ISSTGGTEGGYEAQI----SSVNDKINDNSIEIEKNKMKIELLKKEFMENEEKIGK---- 440

Query: 472  VRGPGISSELQDIQTHLNDLKR--SYLEKIDERKELWRSEQRLQTVSEALLDGVKRSERN 529
                   S+LQ ++TH+ + K+     +K++E  +++    R +   E     +K  E  
Sbjct: 441  -------SQLQ-VETHMKERKQLTEICKKLEE--DIFSHGFRPEAFKE-----LKNREYE 485

Query: 530  LSETM---DRNLANGLKAVREITQRLKLP-----PGAVHGPLGELIKV---NEKYKTCAE 578
            L + +   +R+     + V  I  +   P     P +V G   EL  +   N KY    +
Sbjct: 486  LDQAIYKTNRDCEGLRRRVAGIEFQYSKPFESFDPNSVKGVTAELFSIPEQNMKYVIGLQ 545

Query: 579  AVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDR----NAVTFPEN-AQA 633
               G  L +V+VD E+T S L+ +    K  RVT IPL+++  R    N +   +  A  
Sbjct: 546  ICAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTIIPLDKVISRPLNQNKLKLAKQLAPG 603

Query: 634  ECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLARSYNLD--AVTLDGDRADNRG 691
            +    L  I Y     KA+  +FG +++  D     K+  +  +   ++TL+GD  D  G
Sbjct: 604  KVELALNLIGYSDEVVKAMEFIFGNSLICDDAETAKKITFNPGIRTRSITLEGDIYDPEG 663

Query: 692  VITGGYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKIGAIDSEIDNVNGELKAQA 751
             ++GG  +      +D                Q  N ++ ++ A++ E  N++ +LK   
Sbjct: 664  TLSGGTRNNTNTLLVDI---------------QQYNTLKKELLAMNEEKQNIHKQLKILE 708

Query: 752  ARKDAILANIEGLRLKMSK-------MTADSTFKMEN-----------LEAMTVKLNRLK 793
            A+ +      + L LK  +       M ++ +  M+N           LE  T +     
Sbjct: 709  AKSNETSNLQKELSLKKHRLDILERTMNSEPSLMMQNRNGEIENEVKTLEDSTKQKMLEN 768

Query: 794  TSLTVNEEKIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMA-------RTTEA 846
            +SL   E +IEK   D+   F KN    +   LK L  E+ +L+E +        +  + 
Sbjct: 769  SSL---EAEIEKLRKDMV-DFSKN----KGAKLKELKAEVHELNEQIKDLESESEKLNDT 820

Query: 847  LSELSLRIDLLKTELNV---KLNPQKRDLENRLEEEYSRDDL--TTNRELEHMADELKKL 901
              ++ +  + +  E++     L+   +D+E +LEEE   + +  T+  EL  + ++L   
Sbjct: 821  YEKIKVETEQIANEIDTDTKSLDSTVQDIEKKLEEEIKINKMLKTSEEELMSVQNDLNVE 880

Query: 902  AVKEQDLQTSLASLTEAIGTLSEERANYQ----QL---LEKADSQQRALVKKLDTFQKEA 954
              +  ++   L  L   I    E +  Y+    QL   L K  +    + K L+  Q+E 
Sbjct: 881  RKRISNIDDELEELERTIKQKEESKNTYELELKQLHHDLSKYKNSTDGIEKALNDIQEEH 940

Query: 955  EKSVIKKTSLITRRDEVQXXXXXXXXXXXXXXXXHQNLETERILRKLNTVNDKISKMSNI 1014
            E        ++ R    Q                 +N +  R  RK   VN  I  M   
Sbjct: 941  EWVT---DEMLVRSICEQNAGVNVNEYRHRMEQLQKNFDELR--RK---VNPNIMNM--- 989

Query: 1015 NRRAIENFKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTT 1074
                IE+ +K   K E L++    +E+ K+ IE  +  L + K E +  T+ KV  +F  
Sbjct: 990  ----IESVEK---KGEALKTMIRTIEKDKKKIEDTISKLNEYKKETLVKTWKKVTKDFGN 1042

Query: 1075 IFEKLVPAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKN 1134
            IF  L+P    +L+                    P      T      G+ + V   +  
Sbjct: 1043 IFCDLLPNSSAKLV--------------------PCEGKDIT-----EGLEVKVKLGNLW 1077

Query: 1135 NEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSA 1194
             E L   +LSGGQ+++ A++LI+A+    PAP Y+ DE+DAALD  +  ++ + IK    
Sbjct: 1078 KESLV--ELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFK 1135

Query: 1195 HAQFICTTFRTDMLQVADSFYRVKFENKISEIATV 1229
             +QFI  + +  M   A+  +R +F++  S ++ +
Sbjct: 1136 GSQFIVVSLKEGMFTNANRVFRTRFQDGTSVVSIM 1170

>Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement
          Length = 1083

 Score =  154 bits (390), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 265/1123 (23%), Positives = 492/1123 (43%), Gaps = 126/1123 (11%)

Query: 25   MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLS-DDYSSLKRE 83
            M ++ ++I GFK+Y   T + ++ P FN + G NGSGKSN   ++ FVL      +++  
Sbjct: 1    MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRAS 60

Query: 84   ERQGLIHQ-GTGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRV---RRTIGLKKDEY 139
              Q LI++ G   +  A V IVF D +D+    S  P+  E   ++   R+ I     +Y
Sbjct: 61   NLQDLIYKRGQAGVTKASVTIVF-DNTDK----SSSPIGFESYPKISVTRQIILGGTSKY 115

Query: 140  SVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFE 199
             +NG    +  +  +F+SV  + +NP  ++ QG+I  V N K  E L L+E+  G R FE
Sbjct: 116  LINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAAGTRMFE 175

Query: 200  IKLRESSKKMEATNRDRAKITSEL-SELKAXXXXXXXXXXXXXKYQELERDRRIFQFVLY 258
             +  ++ K M        +I + L  E++              ++QE + D      +L 
Sbjct: 176  DRREKAEKTMAKKETKLQEIRTLLEEEIEPKLEKLRNQKRAFLEFQETQTDLEKTLRILN 235

Query: 259  DRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKESTD 318
              E  ++ ++  ++++   N     EE    + K +  I+NL +++  +    K+++   
Sbjct: 236  AYEYYDMATKNSTIKETLQNSTARVEELNNFIQKTKNEISNLDEDLKTI----KIQKQEQ 291

Query: 319  FQQDK--SRLQ--------EIVKRKADLEIRYE---ETKRQRDQVHGQCAVYRKNLATVE 365
             Q+D   S+L+        EI + K  L I  E   E   +  ++H     + ++L+   
Sbjct: 292  VQKDGKLSQLEKQENDLANEISRLKTALGISVENINEESYKLKKLHENVQKFERDLSEKS 351

Query: 366  EEIQNTSTQLNRLSPRYEQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSE---- 421
                +T ++ N L+   ++LK + +A E  LS        I S  G  + + +Q      
Sbjct: 352  VIYTSTESEFNDLNEGVKRLKGQFKAKEELLSTLTTG---ISSTGGTDSGYNSQLSAAKT 408

Query: 422  --RDAWIAKELSSLKAQTDDLKKNVEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISS 479
               DA I  + S++K   D LKK   I E    ++A   +++++ I E+       G   
Sbjct: 409  KLNDAQICIKRSTMK--IDMLKKESAINEP---KIAHAERENEQNIREI------KGYEQ 457

Query: 480  ELQDIQTHLNDLKRSYLEKIDERKELWRSEQRLQTVSEAL---LDGVKRSERNLSETMDR 536
              ++++  LNDL  + +      K+L + E +L+  S  L    + ++R   NL  T   
Sbjct: 458  VCENLKAQLNDLGFNPM----MIKDLKQKEFKLRNESYQLSNDTEHLRRKTANLEFTYST 513

Query: 537  NLANGLKAVREITQRLKLPPGAVHGPLGELI---KVNEKYKTCAEAVGGNSLLHVVVDTE 593
              AN               P +V G   +L    K N    T  +   G  L +VVVD E
Sbjct: 514  PSAN-------------FDPKSVKGVAAQLFTLEKENFDSATALQVCAGGRLFNVVVDNE 560

Query: 594  ETASILMSELYNTKAGRVTFIPLNRISDR----NAVTFPEN-AQAECTPLLWKIKYDKVF 648
             TAS L+      K  RVT IPLN+I+ R    NA+   ++ A       L  I Y+   
Sbjct: 561  VTASQLLERGRLRK--RVTIIPLNKIASRTLNENALKLAKSVAPGNVELALNLIGYEDEV 618

Query: 649  EKAVRHVFGRTIVVRDLGNGSKLARSYNLDA--VTLDGDRADNRGVITGGYHDYHKRTRL 706
             +A+  +FG +++ +D     ++     + A  +TLDGD  D  G ++GG     + T+ 
Sbjct: 619  SRAMEFIFGTSLICKDAETAKRVTFHPQIRARSITLDGDIYDPEGTLSGG----SRNTKN 674

Query: 707  DCLKDISSAKEQLTQATQSLNAVRLKIGAIDSEIDNVNGELKAQAARKDAILANIEGLRL 766
              L DI +       A++ LN + L++  I+S+I       +   + ++ +      L L
Sbjct: 675  SLLIDIQT----FNAASKRLNEMELELKQINSKIAEYEQTSQKTKSLQNELNLATHKLSL 730

Query: 767  KMSKMTADSTFKM--------ENLEAMTVKLNRLKTSLTVNEEKIEKYEDDLKKPFEKNL 818
                + A+S  ++        + + + T ++NR        E++I K + D+++      
Sbjct: 731  AKKSLAANSATQIIRRNNEISDEISSCTAEINRQTLLSEEFEQEIIKIQKDMEE-----F 785

Query: 819  SDEEEEALKSLAVEIRKLSEPMART---TEALSELSLRIDLLKTELNVKLNPQK---RDL 872
            + ++   L+ L  EI  LS+ +       E   +L   + L K +L   ++  K    DL
Sbjct: 786  NQDKGSKLRELKEEITNLSKKIEEQDAFIEKKFDLYQNLQLEKDQLTSDISASKGSIEDL 845

Query: 873  ENRLEE-EYSR----DDLTTNR-ELEHMADELKKLAVKEQDLQTSLASLTEAIGTLSEER 926
            E  ++E E +R    DDL+  + EL  + ++L +   +  D+   +  L   +   +E+ 
Sbjct: 846  EQAIKELENTRNSIEDDLSLRQTELNQIQNDLNEEKTRLLDIDDEIRELESLLMKKNEQL 905

Query: 927  ANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIKKTSLITRRDEVQXXXXXXXXXXXXXX 986
            +N +  L+K       L  +L+ F+   +K   +  SL+   ++ +              
Sbjct: 906  SNSELELQK-------LTHELNKFKSSTDKIEQRIESLL---EDNRWLNDKGLVLNIINQ 955

Query: 987  XXHQNLETERILRKLNTVNDKISKMS-NINRRAIENFKKFNDKREDLESRAEELEQSKES 1045
                NLE  R  ++ N + +K   M   +N   +   +    K   L++  + +E+ K  
Sbjct: 956  NEGINLEEYR--QRGNQLQEKFQGMKRKVNPNIMSMIENVEKKETALKTMIKTIEKDKTK 1013

Query: 1046 IEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLI 1088
            I++ +E L + K + +  T+ KV+ +F  IF  L+P    +L+
Sbjct: 1014 IQETIEKLNEYKRDTLLKTWEKVSVDFGNIFGDLLPNSFAKLV 1056

>AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH]
            complement(670883..674551) [3669 bp, 1222 aa]
          Length = 1222

 Score =  125 bits (315), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 301/1308 (23%), Positives = 540/1308 (41%), Gaps = 214/1308 (16%)

Query: 32   IQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREERQGLIHQ 91
            ++ FK+Y+ +  V     +F  ++G NGSGKSN   A+ FVL    S L+      LI++
Sbjct: 9    VKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLIYR 68

Query: 92   G----TGSIM-----SAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142
            G     GS       SAYV   F+   D     SG     E   RV    G     Y ++
Sbjct: 69   GRMEEGGSAHENNPKSAYV-TAFYVKQD----ASGAERRME-FTRVIHNTG--DSTYKLD 120

Query: 143  GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIKL 202
            GKT    +   + E           +V QG +  + +    +   L E V G+  ++   
Sbjct: 121  GKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIASQSGVDLTKLFEQVSGSVQYQ--- 177

Query: 203  RESSKKMEATNRDRAKITSELSE-LKAXXXXXXXXXXXXXKYQE--------LERDRRIF 253
                ++ E    D  K ++E +E LKA               Q+         ER +   
Sbjct: 178  ----REYERLKDDYEKASAEYNESLKARRKMQIDLKSFKEGVQKEEQYISLLAERVKLQQ 233

Query: 254  QFVLYDRELNEVTSQ----IESLEDEYNNVLQ-----SSEEYIQELYKRETLIANLTKNI 304
            QF+L+  +L  + S+    + SL+D    + Q     S+EE I  L K ++L+A     +
Sbjct: 234  QFMLW--QLFHLQSKRSGLVASLKDSKAKLSQLKRQLSNEEAI--LGKSKSLVAKEELLL 289

Query: 305  SNVEAELKLKESTDFQQDKSRL-----------QEIVKRKADLEIRYEETKRQRD----- 348
            +     L  K     QQDK+RL           Q   +R  ++E R +  +R  +     
Sbjct: 290  ARRRETLLQK-----QQDKARLNAQLLPVGSARQGTTRRMVNIEKRIDSLQRDIERQESY 344

Query: 349  --QVHGQCAVYRKNLATVEEEIQNTSTQLNRLS----PRYEQLK-----LEAEAFEAQLS 397
              Q+  Q  V  K  A+ E E++ +++    LS      YE+LK          FE +L+
Sbjct: 345  VKQLKNQLKVVGKTKASFEAELEKSASGKFTLSEEQKKEYEELKEVYLSSGGSEFEEKLA 404

Query: 398  QYQRKQREIISKRGIYAQFENQSERDAWIAKELSSLKAQTD-DLKKNVEIMEAEKEQVAA 456
              Q K+ E+             SE  A   K +   K + + DLK ++E +E E  +   
Sbjct: 405  ILQNKKEEL-------------SEEIAVFEKRIGISKTRAEHDLKVDIERLEVEVSERTG 451

Query: 457  EIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDERKELWRSEQRLQTVS 516
             +  DK AI   ++ VR      E + IQ+ +        E   + +E+           
Sbjct: 452  NL-NDKNAIH--SEKVR------EWKQIQSEIESANNKEYELSYKLREVL---------- 492

Query: 517  EALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGPLGELIKV-NEKYKT 575
             A LD +  ++R  ++  +R L   +  +R      +L PG V G + +L +   EKY  
Sbjct: 493  -AKLDDLSANQRETNK--ERKLRENVATLR------RLFPG-VRGLVHDLCRPKKEKYAV 542

Query: 576  CAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDRNAVTFPENAQAEC 635
                + G +   V+VD+   A   +S L   ++G  +FIPL+ I D ++ T P      C
Sbjct: 543  GVSTILGKNFDSVIVDSLSVAQQCISYLKKHRSGVASFIPLDTI-DTSSPTLPAGDNTGC 601

Query: 636  TPLLWKIKYDKVFEKAVRHVFGRTIVVR--DLGNGSKLARSYNLDAVTLDGDRADNRGVI 693
               L  I+Y+   EKA+++V   +I+    D+    K  R+     VTL+G      G++
Sbjct: 602  ILTLDAIEYESSLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGALIHRAGLM 661

Query: 694  TGGY-------HDYHKRTRLDCLKD-ISSAKEQLTQA--TQSL------NAVRL---KIG 734
            TGG         D  +   L  LKD IS+   +LT    T S+      N V L   +I 
Sbjct: 662  TGGITKNNTNRWDKEEYQSLLLLKDKISTELSELTTGIRTGSIKSRDYENEVSLLSTEIS 721

Query: 735  AIDSEIDNVNGELKAQ---------------AARKDAILANIEGLRLKMSKMTADSTFKM 779
            ++ S+++ +N  +K                 + + D++   +E +  +M+ +  D     
Sbjct: 722  SLRSQLNQLNRSMKEALTELNYHDDLIEKEYSPKVDSLHKMVEEVDGQMADIAKDKA--- 778

Query: 780  ENLEAMTVKLNRLKTSLTVNEEKIEKYEDDLKKPFEKNLSDEEEEAL---KSLAVEIRKL 836
             NL+A   K    K    + E   E++     +   + L   ++E +     L  E  +L
Sbjct: 779  -NLQASVYKDFSKKIGFDIGE--YEQHTGGRLRKHSRELQQLQKEVMNIENKLEFETERL 835

Query: 837  SEPMARTTEALSELSLRIDLLKTELNV-KLNPQKRDLENRLEEEYSRDDLTTNRELEHMA 895
               + R  +A      R DL K +  +  L  Q+ D+++ LE+  ++    T + LE   
Sbjct: 836  ESTIKRQQKA------REDLKKVQGELDSLTSQETDIQSNLEQVTNQIAEET-KVLEEAQ 888

Query: 896  DELKKLAVKEQDLQTSLASLTEAIGTLSEERANYQQLLEKADSQQRALVK--KLDTFQKE 953
            ++LKK     + ++ ++  L ++I T   E   +++ +EK   ++  ++K  K+   +  
Sbjct: 889  EKLKKKGNNIKIIEDTINDLHDSIQTCKREITEWKEDIEKVGIERVNILKNCKMTNIELP 948

Query: 954  AEKSVIKKTSL-------ITRRDEVQXXXXXXXXXXXXXXXXHQNLETERILRKLNTVND 1006
             + S ++  ++       I   + +                 H   E E  ++ ++    
Sbjct: 949  LDSSALEDLAIERIDAETIEAGNNISVDYSRLSARYKESSSHHIRDEFESSIKAIDNTLT 1008

Query: 1007 KISKMSNINRRAIENFKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFS 1066
            ++   S    +A+E F +  D+   +   +++L++S+   ++L   +K++++    A F+
Sbjct: 1009 ELQPNS----KAVERFDEARDQFNAVSGESDKLKESERKAKELYLKIKEKRINTFLACFN 1064

Query: 1067 KVATNFTTIFEKLV--PAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGV 1124
             V  N   I+ +L   P     L           G+   + E        D  +    G+
Sbjct: 1065 HVRDNIDRIYRELTRNPGSTAELA---------GGSASLTLE--------DEDEPYLGGI 1107

Query: 1125 SISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTS 1184
                +   K  + +  + LSGG+KT+ A+AL+ AI    P+PF++ DE+DAALD      
Sbjct: 1108 RYHATPPMKRFKDM--DYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVER 1165

Query: 1185 VANTI-KELSAHAQFICTTFRTDMLQVADSF---YRVKFENKISEIAT 1228
            +A  I +  S   QFI  + ++++   ++S    +R + EN    I T
Sbjct: 1166 IAAYIRRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVITT 1213

>CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces
           cerevisiae YLR086w Stable Maintenance of Chromosomes,
           start by similarity
          Length = 1398

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 157/711 (22%), Positives = 322/711 (45%), Gaps = 67/711 (9%)

Query: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84
           ++I  +++  FK+Y     +  F   F+ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187

Query: 85  RQGLIHQGT--GSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142
              LIH+      + S  VE+ F    D+   ++ I  T+ ++V  R+       +Y VN
Sbjct: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVN 247

Query: 143 GKTCHKSDISRMFESVGFSASNPYNIVPQGRI--VAVTNAK-----DKERLLLLEDVVGA 195
           GK  + ++++ + +  G    +   ++ QG +  +A   AK     D   L  LED++G 
Sbjct: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307

Query: 196 RSFEIKLRESSKKMEATNRDRAKITSELSELKAXXXXXXXXXXXXXKYQELERDRRIFQF 255
             ++  + + S ++E+ N    +  +  S ++              ++   E++  + + 
Sbjct: 308 SKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELVLEKS 367

Query: 256 VLYDRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKE 315
            LY   L +   +++ + ++  NV Q   +   E  K  + I+++T +++ ++A+L+   
Sbjct: 368 KLYQYNLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVH 427

Query: 316 STDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQL 375
           + +    K++ + +  +K + E        +R +   Q  + +  + + ++EIQ    + 
Sbjct: 428 TEEVNLSKTK-RTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQ 486

Query: 376 NRLSPRYEQLKLEAEAFEAQLSQYQRKQREIISKRGI-YAQFENQSERDAWIAKELSSLK 434
           + L+     L    +  + +L   + K RE      I  A++E          KELS   
Sbjct: 487 SSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYE----------KELSPWN 536

Query: 435 AQTDDLKKNVEIMEAEKEQVAAEIQQDKEAITELNDSVRG--PGISSELQDIQTHLNDLK 492
            Q+  LKK ++I E+E     + I+++++    L + + G    I S+ +D++    ++K
Sbjct: 537 EQSQQLKKEIKITESE----LSIIEENRKG---LENDIAGLENAILSQKRDLEVQEQEIK 589

Query: 493 RSYLE---KIDERKELWRSEQRLQTVSEALLDGVK-------------RSERNLSETMDR 536
            S LE   K+ + +EL   E +    ++A L  V+             RS  + +E  ++
Sbjct: 590 -SLLEQKTKVIQERELGERECK---NAQATLANVREKVEALRQKAIEIRSTYSATENNNK 645

Query: 537 NLANGLKAVREITQRLKLPPGAVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETA 596
            L+  L+  +  + RL       HG LG+L  ++ KY   A +     L  +VVDT E+ 
Sbjct: 646 VLSALLRLQK--SGRL----NGFHGRLGDLAVIDPKY-DVAISTACPRLNDLVVDTVESG 698

Query: 597 SILMSELYNTKAGRVTFIPLNRIS--DRNAVTFPENAQAECTPLLWKIKYDKVFEKAVRH 654
              +  L   K G   FI L++++  + N +  P+ +Q     +  K   +K F  A   
Sbjct: 699 QQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVK---EKRFNNAFYS 755

Query: 655 VFGRTIVVRDLGNGSKLA---RSYNLDAVTLDGDRADNRGVITGGYHDYHK 702
           V   T+V +++   +++A   + Y +  VTLDG+  D  G +TGG  +  K
Sbjct: 756 VLRDTLVCQNMEQANRVAYGKKRYRV--VTLDGNLIDLSGTMTGGGRNVSK 804

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 99/209 (47%), Gaps = 31/209 (14%)

Query: 1022 FKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVP 1081
            F +FN ++ DL S      QS++S++  +E +K+++ +     F  ++     +++ +  
Sbjct: 1212 FVEFNKRKNDLNSAV----QSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267

Query: 1082 AGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVE 1141
             G   L +                         D+LD    GV+ SV    K+     + 
Sbjct: 1268 GGNAELEL------------------------VDSLDPFSEGVTFSVMPPKKSWRN--IS 1301

Query: 1142 QLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICT 1201
             LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IKE + +AQFI  
Sbjct: 1302 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1361

Query: 1202 TFRTDMLQVADSFYRV-KFENKISEIATV 1229
            + R +M ++      + K EN     A V
Sbjct: 1362 SLRNNMFELTKQLVGIYKHENMTKSAALV 1390

>KLLA0D07502g complement(642751..646482) similar to sp|P32908
           Saccharomyces cerevisiae YFL008w SMC1 chromosome
           segregation protein, start by similarity
          Length = 1243

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 199/862 (23%), Positives = 350/862 (40%), Gaps = 139/862 (16%)

Query: 32  IQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREERQGLIHQ 91
           +  FK+Y++   V     +F  +IG NGSGKSN   A+ FVL    + L+      LI++
Sbjct: 9   LHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLIYR 68

Query: 92  G---TGSIMSAYVEIVFHDPSDQMMMTSGIPVTEE-----------------HIVRVRRT 131
           G    G   +   + +    +D          +EE                    +  RT
Sbjct: 69  GRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTKFTRT 128

Query: 132 IGLKKDE-YSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLE 190
           I    D  Y +N +       +   ES          +V QG +  + +   +   LLLE
Sbjct: 129 INTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQGPESLTLLLE 188

Query: 191 DVVGARSFEI---KLRESSKKMEATNRD----RAKITSELSELKAXXXXXXXXXXXXXKY 243
            V G+ +++    KL+E  K   A   D    R K+ ++L   K                
Sbjct: 189 QVSGSINYKNDYEKLKEEHKLALAEFTDAHNSRKKVQNDLKSFKEGVQRDEQYRTS---- 244

Query: 244 QELE-RDRRIFQFVLYDRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTK 302
             LE RD+    F+L+  EL  +  + + L D        +     +L   E ++  +  
Sbjct: 245 --LEIRDQLKHNFILW--ELFHILKRRKKLVDSLTVSKTETTALKNKLSDEERILTKIKS 300

Query: 303 NISNVEAEL-KLKES-TDFQQDKSRLQE-----------IVKRKADLEIRYEETKRQRD- 348
             +  E +L KLK++    + +K+ LQ             +KR  +LE R    K+  + 
Sbjct: 301 TTAKHELQLSKLKDTLVQLENEKTSLQSSLLPVGSERLATIKRIHNLEKRISSFKKDMER 360

Query: 349 ------QVHGQCAVYRKNLATVEEEIQNTSTQLNRLSPRYEQLKLEAEAFEAQLSQYQRK 402
                 Q   Q  V  K   + E+E++N    LN+ +   E LK           QY+  
Sbjct: 361 QQAYVKQFENQLKVVSKTKKSFEKELENIHANLNKFNLSEEDLK-----------QYELL 409

Query: 403 QREIISKRGIYA----------QFENQSERDAWIAKELSSLKAQ-TDDLKKNVEIMEAEK 451
           + + +S  G +           +FE  +E    I K L + + + +D+L+ +V+ +EA+ 
Sbjct: 410 KEKYLSSGGSHIEEKLAILKNDEFE-LNEESELINKRLKTTRERISDELQVDVDALEADL 468

Query: 452 EQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLK----------RSYLEKIDE 501
            +V   +  DK +I            S E + IQT+L  LK          R  L KID+
Sbjct: 469 NEVTQRL-NDKNSI--------AAAKSKEWKGIQTNLESLKNKEYELNFSLRDVLLKIDD 519

Query: 502 RKELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGAVHG 561
                 ++QR             + ER L E               ++   +L PG V G
Sbjct: 520 ----LNADQR-----------ETKKERKLREN--------------VSMLKRLYPG-VKG 549

Query: 562 PLGELIKV-NEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRIS 620
            + +L     EKY      + G +   ++VD+  TA   ++ L   +AG  +FIPL+ I 
Sbjct: 550 LVHDLCHPKKEKYAIAVSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLDTI- 608

Query: 621 DRNAVTFPENAQAECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLARSYNLDA- 679
           D N  + P +    C   +  I+Y+   EKA+++V   +I+  +L    +L  S N+ A 
Sbjct: 609 DVNPPSLPVSNVQGCLLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAK 668

Query: 680 -VTLDGDRADNRGVITGGYHDYHK-RTRLDCLKDISSAKEQLTQATQSLN----AVRLKI 733
            VTL+G      G +TGG    ++ R   D  + +   K+Q+T+   +L+    A  +K 
Sbjct: 669 LVTLNGALIHKAGQMTGGTAQKNQNRWNKDEYQGLMVLKDQITEELTALSDKFRADNMKS 728

Query: 734 GAIDSEIDNVNGELKAQAARKDAILANIEGLRLKMSKMTADSTFKME-NLEAMTVKLNRL 792
             +++EI  +N E+ +   +   +   + G  +++       T + E  L++ T ++  L
Sbjct: 729 RELENEISLLNNEISSLRTQITQLERTLSGKNVEIKHNEDLITTEYEPQLKSFTQRIEEL 788

Query: 793 KTSLTVNEEKIEKYEDDLKKPF 814
           K+ LT  E + +  ++ + +PF
Sbjct: 789 KSKLTKLESEKDVLQEQIFRPF 810

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIK-ELSAHAQF 1198
            +E LSGG+KT+ A+AL+  I    P+PF++ DE+DAALD      +A+ IK   + +AQF
Sbjct: 1143 MEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQF 1202

Query: 1199 ICTTFRTDMLQVADSFYRV 1217
            I  + +  M + + S   +
Sbjct: 1203 IVISLKNAMFEKSQSLVGI 1221

>Scas_681.4
          Length = 1409

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 179/806 (22%), Positives = 334/806 (41%), Gaps = 129/806 (16%)

Query: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84
           ++I  + +  FK+Y     V  F   F+ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208

Query: 85  RQGLIHQGT--GSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142
              LIH+      + S  V++ F    D+    + I  T+  +V  R+       +Y +N
Sbjct: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268

Query: 143 GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER-------LLLLEDVVGA 195
           GK  + +D++++ +  G    +   ++ QG +  +   K K         L  LED++G 
Sbjct: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 328

Query: 196 RSFEIKLRESSKKMEATN------RDRAKITSELSELKAXXXXXXXXXXXXXKYQELERD 249
             ++  + +   ++E+ N       +R +I     E  +             K ++L   
Sbjct: 329 SKYKQLIEKDLIEIESLNEICIEKENRFEIVDR--EKNSLESGKNLALEFLEKEKQLTLS 386

Query: 250 R-RIFQFVLY--DRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISN 306
           + ++ Q+ L+  + +L     +I +L +EY NV +S  + +Q    R       TK + N
Sbjct: 387 KSKLLQYNLWQNNSKLTNTLQKISALNEEY-NVEKSKNQTLQNEINR-------TKQLLN 438

Query: 307 -VEAELKLKESTDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVE 365
             ++++K+ E  + QQ KS+ + +      L+ + +   +++ +     A   K ++++ 
Sbjct: 439 ESQSKIKVLEGEEKQQLKSK-RILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLT 497

Query: 366 EEIQNTSTQLNRLSPRYE----QLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSE 421
            EIQ         S   E    QL+ E E+ EA   + + K   I  +  I+     + +
Sbjct: 498 SEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIH-----EHD 552

Query: 422 RDAW-------------IAKELSSLKAQTDDLKKNVEIMEAE-KEQVAAEIQQDKEAITE 467
            + W             +  ++S L+     LK +++++  E   Q A +I+++++ +  
Sbjct: 553 LEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLV-- 610

Query: 468 LNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDERKELWRSEQRLQTVSEALLDGVKRSE 527
            N   +   I+ E+ + +T  ND  RS L+++     + R     Q  SEA L       
Sbjct: 611 -NLKKQQSSITKEISNGETECND-GRSKLKEMKNVLNMQR-----QRASEARL------- 656

Query: 528 RNLSETMDRNLANGLKAVREITQRLKLPPG----AVHGPLGELIKVNEKYKTCAEAVGGN 583
                     LAN     + +T   KL         HG LG+L  ++  Y   A +    
Sbjct: 657 ---------ALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTY-DVAVSTACP 706

Query: 584 SLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRIS--DRNAVTFPENAQAECTPLLWK 641
            L  +VV+T E     +  L   K G   FI L+++   + N +  P+N      P L+ 
Sbjct: 707 RLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNV-----PRLFD 761

Query: 642 I--KYDKVFEKAVRHVFGRTIVVRDLGNGSKLA---RSYNLDAVTLDGDRADNRGVITGG 696
           +    D  F  A   V   T+V +DL   +++A   R Y +  VTLDG   D  G ++GG
Sbjct: 762 LIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRV--VTLDGKLIDVSGTMSGG 819

Query: 697 ------------------YHDYHKRTRLDCLKDISSAKEQLTQAT----------QSLN- 727
                             + DY+        KD+S  ++    A           Q LN 
Sbjct: 820 GNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNN 879

Query: 728 ---AVRLKIGAIDSEIDNVNGELKAQ 750
               + L+I  I  EID  + E+K++
Sbjct: 880 RKPEIELEISKIIMEIDTYSAEIKSK 905

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 87/181 (48%), Gaps = 27/181 (14%)

Query: 1043 KESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGTGQ 1102
            +E++ K +E LKK + E     F  ++     +++ +   G   L +             
Sbjct: 1236 RETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELEL------------- 1282

Query: 1103 RSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMV 1162
                        D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+   
Sbjct: 1283 -----------VDSLDPFSEGVTFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKY 1329

Query: 1163 DPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRV-KFEN 1221
             P P Y+ DEIDAALD +  + VAN IKE + +AQFI  + R +M ++A     + K EN
Sbjct: 1330 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCEN 1389

Query: 1222 K 1222
            +
Sbjct: 1390 R 1390

>YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensin
           protein complex required for proper chromosome
           condensation and segregation, coiled-coil protein of the
           SMC family [4257 bp, 1418 aa]
          Length = 1418

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 166/734 (22%), Positives = 315/734 (42%), Gaps = 99/734 (13%)

Query: 10  RNQSRASFRAREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAV 69
           R+QS +  ++R    ++I  ++++ FK+Y     V  F   F+ V+G NGSGKSN   ++
Sbjct: 143 RHQSSSKQQSR----LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSM 198

Query: 70  RFVLSDDYSSLKREERQGLIHQGTG--SIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVR 127
            FV     + ++++    LIH+     S+ S  V + F    D+   TS I   +  ++ 
Sbjct: 199 LFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLII 258

Query: 128 VRRTIGLKKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER-- 185
            R+       +Y +N K    ++++++ ++ G    +   ++ QG +  +   K K    
Sbjct: 259 TRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKE 318

Query: 186 -----LLLLEDVVGARSFEIKLRESSKKMEATNRDRAKITSELSELKAXXXXXXXXXXXX 240
                L  LED++G  +++  + E   ++E  N        E+                 
Sbjct: 319 SDDGLLEYLEDIIGTANYKPLIEERMGQIENLN--------EVC---------------- 354

Query: 241 XKYQELERDRRIFQFVLYDRELNEVTS----QIESLEDEYNNVLQSSEEYIQELYKRETL 296
                LE++ R   F + DRE N + S     +E LE E    L  S+ +  +L +  + 
Sbjct: 355 -----LEKENR---FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSK 406

Query: 297 IANLTKNISNVEAELKLKESTDFQQDKSRLQEIVKRKADLEIRYEETKR-------QRDQ 349
           +A+  + IS+   +L+  E   FQ+   ++ EI  ++ +++ R             +R +
Sbjct: 407 LASTLEKISSSNKDLE-DEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRE 465

Query: 350 VHGQCAVYR---KNLAT----VEEEIQNTSTQLNRLSPRYEQLKLEAEAFEAQ---LSQY 399
           + G         KNL +     E+ +++T   ++      E+L+ +    E +   L+Q 
Sbjct: 466 LEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQL 525

Query: 400 QRKQREIIS--KRGIYAQFENQSERDAWIAKELSSLKAQTDDLKKNVEIMEAE---KEQV 454
             K+R I+   K  +  + +N S       KEL     Q  + +  +++ E+E    E+ 
Sbjct: 526 LEKERSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEET 585

Query: 455 AAEIQQDKEAITE--LNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDER----KELWRS 508
            A+++++ E + E  L        +   + D++  LN LK       DER    K    +
Sbjct: 586 QAKLKKNVETLEEKILAKKTHKQELQDLILDLKKKLNSLK-------DERSQGEKNFTSA 638

Query: 509 EQRLQTVSEALLDGVKRS-ERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGPLGELI 567
             +L+ + + L    +R+ E   S +  +N +  L A+  + +  ++     HG LG+L 
Sbjct: 639 HLKLKEMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRI--NGFHGRLGDLG 696

Query: 568 KVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDRN--AV 625
            +++ +   A +     L  VVVDT E A   +  L   K G   FI L+R+   N   +
Sbjct: 697 VIDDSF-DVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPI 755

Query: 626 TFPENAQAECTPLLWKIKYDK--VFEKAVRHVFGRTIVVRDLGNGSKLARSYN-LDAVTL 682
           + PEN      P L+ +   K   F  A   V   T+V ++L   + +A        VT+
Sbjct: 756 STPENV-----PRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTV 810

Query: 683 DGDRADNRGVITGG 696
           DG   D  G ++GG
Sbjct: 811 DGKLIDISGTMSGG 824

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173
             D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1296 VDSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1353

Query: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRV 1217
            DAALD +  + VAN IKE + +AQFI  + R +M ++A     V
Sbjct: 1354 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397

>KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomyces
           cerevisiae YLR086w SMC4 Stable Maintenance of
           Chromosomes, start by similarity
          Length = 1372

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 168/728 (23%), Positives = 305/728 (41%), Gaps = 129/728 (17%)

Query: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84
           + I  +++  FK+Y  I  +  F   F+ V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182

Query: 85  RQGLIHQGT--GSIMSAYVEIVFHDPSD------QMMMTSGIPVTEEHIVRVRRTIGLKK 136
              LIH+     S+ S  V+I FH   D      +++ ++G  V E      RR      
Sbjct: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVE------RRAFKNNS 236

Query: 137 DEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAK-------DKERLLLL 189
            +Y VNGK  + ++++R+ +  G    +   ++ QG + ++   K       D   L  L
Sbjct: 237 SKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYL 296

Query: 190 EDVVGARSFEIKLRESSKKMEATNR------------DRAKITSELSELKAXXXXXXXXX 237
           ED++G   F+ ++ +  +++E  N             D+ K   E  + +A         
Sbjct: 297 EDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERK 356

Query: 238 XXXXKYQELERDRRIFQFVLYD--RELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRET 295
               K Q L+R        +YD  R+L     +I +L  E+    +S  E++Q+  + ET
Sbjct: 357 HTILKAQLLQRQ-------IYDSNRKLATSCDKISALNMEFQEE-KSQYEHLQK--EAET 406

Query: 296 L---IANLTKNISNVEAELKLKES------TDFQQDKSRLQEIVKRKADLEIRYEETKRQ 346
           L   I N  K  + +E E K   S       DF     +L+ I ++     ++  E    
Sbjct: 407 LTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARK-----LKAAEKAFS 461

Query: 347 RDQVHGQCAV-----YRKNLATVEEEIQNTSTQLN-----------RLSPRYEQLKLEAE 390
           + + +G+ AV      +KN    E E+ N +  ++            L  + + L  E E
Sbjct: 462 QSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEME 521

Query: 391 AFEAQL----SQYQRKQREI-ISKRGIYAQFENQSERDAWIAKELSSLKAQTDDLKKNVE 445
           + E QL     Q Q KQ EI +S+  I     + S     + KE ++++++ +DL    +
Sbjct: 522 SLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSN----LLKEKATIESKIEDL----Q 573

Query: 446 IMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDERKEL 505
           + E ++++    ++ +K  +       R      E ++ Q   N+++   +         
Sbjct: 574 LEELKQKETETSLRNEKSKV-----EARISTAQKECEEAQKQTNEMRDVLI--------- 619

Query: 506 WRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGPLGE 565
               Q+ Q V EA        + NL+   ++N    L A+ ++    ++     HG LG+
Sbjct: 620 ----QQRQIVEEA--------KANLNGFQNKNRV--LLALTKLQNSGRIT--GFHGRLGD 663

Query: 566 LIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDRNA- 624
           L  ++++Y   A +     L  +VV+T E     +  L   K G   FI L+++   N  
Sbjct: 664 LGTIDDQY-DIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLD 722

Query: 625 -VTFPENAQAECTPLLWKI--KYDKVFEKAVRHVFGRTIVVRDLGNGSKLARS-YNLDAV 680
            +  PEN      P L+ +      +F  A   V   T+V RDL   +++A        V
Sbjct: 723 RIATPENV-----PRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVV 777

Query: 681 TLDGDRAD 688
           TLDG   D
Sbjct: 778 TLDGKLID 785

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 67/116 (57%), Gaps = 2/116 (1%)

Query: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173
             D+LD    GV  SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1250 VDSLDPFSEGVLFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1307

Query: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRVKFENKISEIATV 1229
            DAALD +  + VAN IKE + +AQFI  + R +M ++A +   +   N +++  T+
Sbjct: 1308 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTL 1363

>AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..905555)
            [4113 bp, 1370 aa]
          Length = 1370

 Score = 93.2 bits (230), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 212/994 (21%), Positives = 409/994 (41%), Gaps = 162/994 (16%)

Query: 18   RAREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDY 77
            + +++  + I++++++ FK+Y     V  F   F+ V+G NGSGKSN   ++ F      
Sbjct: 99   KQKKVERLCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA 158

Query: 78   SSLKREERQGLIHQGT--GSIMSAYVEIVFH----DPSDQMMMTSGIPVTEEHIVRVRRT 131
            + +++ +   LIH+      +    VEI F     +P     + SG P     +  +R+ 
Sbjct: 159  NKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKP----ELSVMRKA 214

Query: 132  IGLKKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER------ 185
                  +Y +NGK    ++++R+    G    +   ++ QG + ++   K K        
Sbjct: 215  FKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDG 274

Query: 186  -LLLLEDVVGARSFEIKLRESSKKMEATNRDRAKITSELSELKAXXXXXXXXXXXXXKYQ 244
             L  LED++G   ++ ++ ++  ++++ N    +  +    ++               + 
Sbjct: 275  LLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFL 334

Query: 245  ELERDRRI-----FQFVLYD------RELNEVTSQIESLEDEYNNVLQSSEEYIQELYKR 293
            + E+D  +     +Q+ L+       + L+ V++ +  LE E    +++ +E + EL   
Sbjct: 335  KKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNKLEQEKAKKVEAQKEIV-ELTDA 393

Query: 294  ETLIAN--LTKNISNVEAELKLKE-----STDFQQDKSRLQEIVKRKADLEIRYEETKRQ 346
               +AN  ++ N +N E+  K+++      ++ ++ KS LQ+  K +  L    +  K+ 
Sbjct: 394  SEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQC 453

Query: 347  RDQVH---GQCAVYRKNLATVEEEIQNTSTQLNR----LSPRYEQLKLEAEAFEAQLSQY 399
             +++     Q   Y  +L T+   I +   +L +    LS +   +  E    E +L  +
Sbjct: 454  ENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPW 513

Query: 400  QRKQREIISKRGIYAQFENQSERDAWIAKELSSLKAQTDDLKKNVEIMEAEKEQVAAEIQ 459
              K              E +      +  E+S +K     L+  +  +  E EQ+   I 
Sbjct: 514  TNK-------------VEEKKSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNIS 560

Query: 460  QDKEAITELN---DSVRGPGISSELQDIQTHLNDLKRSYLEKIDERKELWRSEQRLQTVS 516
              +E+I  LN    S+R   +  E +          RS LE++  +K L    QR+    
Sbjct: 561  HREESIETLNVESSSIRDYILVGERECTSA------RSKLEEM--KKVLVTHRQRVNDAR 612

Query: 517  EALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGPLGELIKVNEKYKTC 576
             A           +S   ++N    L A+  + +  ++     HG LG+L  +++KY   
Sbjct: 613  SA-----------VSSAENKNKV--LTALSRLQKSGRI--DGYHGRLGDLGTIDDKY-DI 656

Query: 577  AEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDRN--AVTFPENAQAE 634
            A +     L  +VVDT E     +  L   K G   FI L+++   N      PEN    
Sbjct: 657  AISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENV--- 713

Query: 635  CTPLLWKIKYDK--VFEKAVRHVFGRTIVVRDLGNGSKLA---RSYNLDAVTLDGDRADN 689
              P L+ +   K   F  A   V   T+V  DL   +++A   + Y +  VTLDG   D 
Sbjct: 714  --PRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRV--VTLDGKLIDI 769

Query: 690  RGVITG-------GYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKIGAIDSEIDN 742
             G +TG       G     +++ L   +++   +E+L +  ++          ++S + N
Sbjct: 770  SGTMTGGGDRAASGLMKSTQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQN 829

Query: 743  -------VNGELKAQAARKDAILANIEG-----LRLKMSKMTA--DST---FKMENLEAM 785
                   +  EL  Q    + I A +E      L L+ S  T+  DS+      E L A+
Sbjct: 830  YLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAAL 889

Query: 786  TVKLNRLKTSLTVNEEKIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTE 845
               LN     ++ +E K ++ ++                 L++  +EI  L         
Sbjct: 890  NADLNSF---MSASESKNQRIKE-----------------LRAKIMEIGGLE-------- 921

Query: 846  ALSELSLRIDLLKTELNVKLNPQKRD--LENRLEEEYSR---DDLTTNRELEHMADELKK 900
             L  L+ ++D L  ++ +    QK+D   + + E E  R     +T   ++EH   E++K
Sbjct: 922  -LQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRARKQQITAKDDIEHCDIEIQK 980

Query: 901  L-------AVKEQDLQTSLASLTEAIGTLSEERA 927
            +       +   Q+LQ  L+ L E IGTL++E A
Sbjct: 981  MKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHA 1014

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 59/98 (60%), Gaps = 2/98 (2%)

Query: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173
             D+LD    GV  SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1248 VDSLDPFSEGVLFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1305

Query: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVA 1211
            DAALD +  + VAN IKE + +AQFI  + R +M ++A
Sbjct: 1306 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1343

>YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of
            condensin protein complex required for chromosome
            condensation and segregation, coiled-coil protein of the
            SMC family [3513 bp, 1170 aa]
          Length = 1170

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 101/211 (47%), Gaps = 30/211 (14%)

Query: 1019 IENFKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEK 1078
            IEN +K   K   L++  + +E+ K  I++ +  L + K E +  T+ KV  +F  IF  
Sbjct: 990  IENVEK---KEAALKTMIKTIEKDKMKIQETISKLNEYKRETLVKTWEKVTLDFGNIFAD 1046

Query: 1079 LVPAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQL 1138
            L+P    +L+                    P      T      G+ + V   +   E L
Sbjct: 1047 LLPNSFAKLV--------------------PCEGKDVT-----QGLEVKVKLGNIWKESL 1081

Query: 1139 YVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQF 1198
               +LSGGQ+++ A++LI+A+    PAP Y+ DE+DAALD  +  ++ + IK     +QF
Sbjct: 1082 I--ELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQF 1139

Query: 1199 ICTTFRTDMLQVADSFYRVKFENKISEIATV 1229
            I  + +  M   A+  +R +F++  S ++ +
Sbjct: 1140 IVVSLKEGMFANANRVFRTRFQDGTSVVSIM 1170

>Scas_565.6
          Length = 1170

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 99/211 (46%), Gaps = 30/211 (14%)

Query: 1019 IENFKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEK 1078
            IEN +K   K   L+     +E+ K  I++ +  L + K + +  T+ KV  +F  IF  
Sbjct: 990  IENVEK---KESALKVMIRTIEKDKVKIQETISKLNEYKRDTLIKTWEKVTEDFGHIFAD 1046

Query: 1079 LVPAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQL 1138
            L+P    +L+                P              +  G+ + V   +   + L
Sbjct: 1047 LLPNSFAKLV----------------PSEGK---------DVTEGLEVRVKLGNLWKDSL 1081

Query: 1139 YVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQF 1198
               +LSGGQ+++ A++LI+A+    PAP Y+ DE+DAALD  +  ++ + IK     +QF
Sbjct: 1082 V--ELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQF 1139

Query: 1199 ICTTFRTDMLQVADSFYRVKFENKISEIATV 1229
            I  + +  M   A+  +R +F+N  S ++ +
Sbjct: 1140 IVVSLKEGMFSNANRVFRTRFQNGTSVVSII 1170

>CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces
           cerevisiae YFL008w SMC1 chromosome segregation protein,
           start by similarity
          Length = 1223

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 168/705 (23%), Positives = 300/705 (42%), Gaps = 87/705 (12%)

Query: 32  IQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREERQGLIHQ 91
           +  FK+Y+    V+    +F  +IG NGSGKSN   A+ FVL    SSL+    + LI++
Sbjct: 9   LYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLIYR 68

Query: 92  GTGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEH---IVRVRRTIG-LKKDEYSVNGKTCH 147
               I+S        D  +    T+ +    E+   +V + R I  L    Y ++G T  
Sbjct: 69  ---DIISRENTPTGADNDENGNRTAYVKAFYEYDGKVVELMRLISRLGDTSYKLDGNTVT 125

Query: 148 KSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIKLRE--- 204
             + S+  ES          +V QG +  + +        L+E+V G+  ++ +  E   
Sbjct: 126 YKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPLGLTKLIEEVSGSMQYKKEYEELKD 185

Query: 205 -SSKKMEATN---RDRAKITSELSELKAXXXXXXXXXXXXXKYQELERDRRIFQFVLYDR 260
              K  +A+    + R +I +EL   K              K + ++ +  ++Q  LY  
Sbjct: 186 QYDKICQASTESIKKRRRIHAELKTYKEGMSRDEEYRKYVQKKKRVQTNLSLWQ--LYHM 243

Query: 261 ELNEVTSQIESLEDEYNNV------LQSSEEYIQE-----------LYKRETLIANLTKN 303
           E +E    ++ LE+  N+V      L++ E+ ++            L K++  I +++K 
Sbjct: 244 E-DERYQCLQKLEESQNDVDVIREKLEAEEKNLEVFKKALSKEAVLLTKKKNHIRSISKE 302

Query: 304 ISNVEAELKLKESTDFQQDKS--RLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNL 361
               E++LK+       Q+ S  RL+ + KR   L+   E  +   ++   Q  V   + 
Sbjct: 303 KEKAESDLKV---VKIPQNASINRLKNLDKRVDSLQKDLEREEANLEKYKHQLKVVTDSK 359

Query: 362 ATVEEEIQNTSTQLNRLSPRYEQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSE 421
              E+EI + S   N+ +   + LKL           Y   + E ++  GI         
Sbjct: 360 NAFEQEILSKSKNNNKFTLSEDDLKL-----------YDELKGEYLNNGGIE-------- 400

Query: 422 RDAWIAKELSSLKAQTDDLKKNVEIM----EAEKEQVAAEIQQDKEAITELNDSVRGPG- 476
               I   L+ L  + +++  +++I+    E  K+++  E+   KE   E +  +R    
Sbjct: 401 ----IEDTLNLLDNKKEEITADLKIINDKVEISKQRIEDELVTKKE---EQDAKIRDSTL 453

Query: 477 ISSELQDIQTHLNDLKRSYLEKIDERKELWRSEQRLQTVSEALLDG-VKRSERNLSETMD 535
           + +E  D+ +H    K   L K  +  E W +++    ++  L D  VK  + N ++   
Sbjct: 454 LLNEKNDLHSH----KLDELRKTQKDIEYWNNKEF--DLNHKLRDTLVKLDDLNATQRE- 506

Query: 536 RNLANGLKAVREITQRLK-LPPGAVHGPLGELIKVN-EKYKTCAEAVGGNSLLHVVVDTE 593
              +N  + +RE    LK   PG V G + EL K   +KYK     V G +   V+VD+ 
Sbjct: 507 ---SNKERKLRENVAMLKRFFPG-VRGLVHELCKPKRDKYKLAVSTVLGKNFDSVIVDSL 562

Query: 594 ETASILMSELYNTKAGRVTFIPLNRISDRNAVTFPENAQAECTPLLWKIKYDKVFEKAVR 653
             A   +S L   +AG ++FIPL+ I D      P       T  +  ++Y     +A+ 
Sbjct: 563 SVAQECISFLKKQRAGVISFIPLDTI-DAATPRMPVPESETYTLAINTVEYKDDLVRAMY 621

Query: 654 HVFGRTIVVR--DLGNGSKLARSYNLDAVTLDGDRADNRGVITGG 696
           +V   TI+    D+    K  ++ N+  VTLDG   +  G++TGG
Sbjct: 622 YVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALINKTGLMTGG 666

>Kwal_56.23825
          Length = 1396

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173
             D+LD    GV  SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1274 VDSLDPFSEGVLFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1331

Query: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRVKFENK 1222
            DAALD +  + VAN IKE + +AQFI  + R +M ++A     V ++NK
Sbjct: 1332 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV-YKNK 1379

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 95/208 (45%), Gaps = 12/208 (5%)

Query: 1   MKPRRVNSIRNQ-SRASFRAREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNG 59
           MK  R+ S + Q SRA   +  I  + I  +++  FK+Y     V  F   F+ V+G NG
Sbjct: 104 MKKSRLESQKFQESRAMMGS--IQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNG 161

Query: 60  SGKSNFFAAVRFVLSDDYSSLKREERQGLIHQG--TGSIMSAYVEIVFHDPSDQMMMTSG 117
           SGKSN   ++ FV     + +++ +   LIH+      + S +V+I F    D+   T+ 
Sbjct: 162 SGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTS 221

Query: 118 IPVTEEHIVRVRRTIGLKKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAV 177
           I   +  +V  R+       +Y +NGK    + I+++    G    +   ++ QG + ++
Sbjct: 222 IIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESI 281

Query: 178 TNAKDKER-------LLLLEDVVGARSF 198
              K K         L  LED++G   +
Sbjct: 282 AQMKPKAEKESDDGLLEYLEDIIGTAQY 309

>Kwal_55.20421
          Length = 1170

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 115/240 (47%), Gaps = 30/240 (12%)

Query: 991  NLETERILRKLNTVNDKISKMS-NINRRAIENFKKFNDKREDLESRAEELEQSKESIEKL 1049
            NLE  R  ++ + +N+K S +   +N   +   +    K   L++    +E+ K  I++ 
Sbjct: 960  NLEAYR--QRADQLNEKFSALRRKVNPNIMSMIESVEKKESALKTMISTIEKDKRKIQET 1017

Query: 1050 VESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGTGQRSPEYSP 1109
            V  L + K E +  T+ KV  +F  IF  L+P    +L+                    P
Sbjct: 1018 VAKLNEYKRETLIKTWEKVTVDFGNIFGDLLPNSFAKLV--------------------P 1057

Query: 1110 LNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYL 1169
            +        S+  G+ + +   S   E L   +LSGGQ+++ A++LILA+    PAP Y+
Sbjct: 1058 IEGK-----SVTEGLEVKIRLGSIWKESLV--ELSGGQRSLIALSLILALLQFKPAPMYI 1110

Query: 1170 FDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRVKFENKISEIATV 1229
             DE+DAALD  +  ++ + IK     +QFI  + +  M   A+  +R +F++  S ++++
Sbjct: 1111 LDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFRTRFQDGTSVVSSI 1170

>YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein of
            the SMC family involved in chromosome condensation and
            segregation [3678 bp, 1225 aa]
          Length = 1225

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 101/228 (44%), Gaps = 40/228 (17%)

Query: 1015 NRRAIENFKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTT 1074
            N RA+E + +   + E + +  E+L+  ++ I      +KK++ E  E TF  V+ +   
Sbjct: 1018 NARALERYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDA 1077

Query: 1075 IFEKL---------VPAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVS 1125
            I+ +L         +  G   L I    E  N G    +    PL    D          
Sbjct: 1078 IYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHAT--PPLKRFKD---------- 1125

Query: 1126 ISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSV 1185
                          +E LSGG+KTV A+AL+ AI    P+PF++ DE+DAALD      +
Sbjct: 1126 --------------MEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRI 1171

Query: 1186 ANTI-KELSAHAQFICTTFRTDMLQVADSF---YRVKFENKISEIATV 1229
            A  I +  +   QFI  + +  M + +D+    YR + EN  S+I T+
Sbjct: 1172 AAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENS-SKIITL 1218

>KLLA0D16005g complement(1346492..1350004) similar to sp|P38989
            Saccharomyces cerevisiae YFR031c SMC2 chromosome
            segregation protein, start by similarity
          Length = 1170

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 99/198 (50%), Gaps = 27/198 (13%)

Query: 1032 LESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHR 1091
            L++  + +E+ K+ I++ +E L + K E +  T+ KV+ +F  IF  L+P    +L    
Sbjct: 1000 LKTMIKTIEKDKQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKL---- 1055

Query: 1092 TTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVC 1151
              E S    G+   E                G+ + V       E L   +LSGGQ+++ 
Sbjct: 1056 --EPSE---GKDVTE----------------GLEVKVKLGKIWKESLV--ELSGGQRSLI 1092

Query: 1152 AIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVA 1211
            A++LILA+    PAP Y+ DE+DAALD  +  ++ + IK     +QFI  + +  M   A
Sbjct: 1093 ALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNA 1152

Query: 1212 DSFYRVKFENKISEIATV 1229
            +  +R +F++  S ++ +
Sbjct: 1153 NRVFRTRFQDGTSVVSVM 1170

>AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH]
            complement(1189851..1193363) [3513 bp, 1170 aa]
          Length = 1170

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 102/211 (48%), Gaps = 30/211 (14%)

Query: 1019 IENFKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEK 1078
            IEN +K   K   L +  + +E+ K  I + +E L + K +A+  T+ KV  +F  IF +
Sbjct: 990  IENVEK---KEAALRTMIKTIEKDKMKIVETIEKLNEYKRDALVKTWEKVNVDFGNIFAE 1046

Query: 1079 LVPAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQL 1138
            L+P    +L                          A     + +G+ + V   +   E L
Sbjct: 1047 LLPNSFAKLA-------------------------AIEGKDVTAGLEVKVKLGTLWKESL 1081

Query: 1139 YVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQF 1198
               +LSGGQ+++ A++LILA+    PAP Y+ DE+DAALD  +  ++ + IK     +QF
Sbjct: 1082 V--ELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQF 1139

Query: 1199 ICTTFRTDMLQVADSFYRVKFENKISEIATV 1229
            I  + +  M   A+  ++ +F++  S ++ +
Sbjct: 1140 IVVSLKEGMFTNANRVFKTRFQDGTSVVSVL 1170

>Scas_707.23
          Length = 1223

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 110/225 (48%), Gaps = 34/225 (15%)

Query: 1015 NRRAIENFKKFNDKREDLESRAEELE-QSKESIEKLVESLKKQKVEAVEATFSKVATNFT 1073
            N RA+E F    ++ E +E   E+L+ + K+++ + ++ +KK++ E  E  F  V  +  
Sbjct: 1016 NARAVERFDDAQERFEVVEKETEDLKAREKKALTQFLK-IKKRRRELFENAFDFVNEHLD 1074

Query: 1074 TIFEKLVPAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNAD---TLDSMYSGVSISVSF 1130
             I+ +L                       R+P  S L S  +   TL+      +  + +
Sbjct: 1075 PIYRELT----------------------RNPNSSALLSGGNASLTLEDEDEPFNAGIKY 1112

Query: 1131 NSKNNEQLY--VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANT 1188
            ++    + +  +E LSGG+KTV A+AL+ AI    P+PF++ DE+DAALD      +A  
Sbjct: 1113 HAMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAY 1172

Query: 1189 I-KELSAHAQFICTTFRTDMLQVADSF---YRVKFENKISEIATV 1229
            I +  +   QFI  + +  M + +D+    YR + EN  S+I T+
Sbjct: 1173 IRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQQENS-SKIVTL 1216

>Kwal_23.5043
          Length = 1225

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTI-KELSAHAQF 1198
            +E LSGG+KT+ A+AL+ AI    P+PF++ DE+DAALD      VA+ I ++  A  QF
Sbjct: 1126 MEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYIRRKAGADLQF 1185

Query: 1199 ICTTFRTDMLQVADSFYRV 1217
            I  + +  M + + +   V
Sbjct: 1186 IVISLKNTMFEKSQALVGV 1204

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 79/182 (43%), Gaps = 26/182 (14%)

Query: 32  IQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREERQGLIHQ 91
           +  FK+Y+   ++     +F  +IG NGSGKSN   A+ FVL      L+      LI++
Sbjct: 9   LNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLIYR 68

Query: 92  GTGS--------------IMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKD 137
           GT S                SAYV+  F+ PS+           E+ +V + RT+   ++
Sbjct: 69  GTLSEEEASSADFESENHPNSAYVK-AFYSPSN----------NEDDVVELSRTVTRSQE 117

Query: 138 E-YSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGAR 196
             Y ++GKT      S+  ES          +V QG +  V   K +E   L E V G+ 
Sbjct: 118 STYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQELTDLFEQVSGSL 177

Query: 197 SF 198
            +
Sbjct: 178 QY 179

>KLLA0F07997g complement(748561..751920) similar to sgd|S0005394
           Saccharomyces cerevisiae YOL034w, start by similarity
          Length = 1119

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 108/258 (41%), Gaps = 24/258 (9%)

Query: 32  IQGFKTYRNITAVEDF--SPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREER-QGL 88
           +  F TY    A+ +F  SP  N++IG NGSGKS F  A+   L+     + R ++ +  
Sbjct: 65  LTNFVTY----ALTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKVEEY 120

Query: 89  IHQGTGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGL--KKDEYSVNGKTC 146
           I  GT       +EI   + S  +     +  T++ +V V+R + +  KK +Y +N K  
Sbjct: 121 IKNGTD---EGVIEITLKNSSALLHSDFNMINTDDDVVHVKRVLSMEKKKSKYYINNKVV 177

Query: 147 HKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIKLRESS 206
            +  +  M   +     N    + Q R+     A+ K   LL E +   RS E  L E  
Sbjct: 178 TEEVVKSMVRVLNIQLDNLCQFLSQERVEEF--ARLKPDTLLNETI---RSIEAGLLEKL 232

Query: 207 KKMEATNR-------DRAKITSELSELKAXXXXXXXXXXXXXKYQELERDRRIFQFVLYD 259
            ++++          D     ++L EL +              Y+E  R+  I Q +L  
Sbjct: 233 SELKSLQAEGNELQIDLGAKENKLKELTSSRAALESQAHALELYEEKARELDIHQKLLNY 292

Query: 260 RELNEVTSQIESLEDEYN 277
             L E   +I  L+D+ N
Sbjct: 293 TYLKEHKEKIRGLKDKRN 310

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 6/91 (6%)

Query: 1124 VSISVSFNSKNN-EQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQ-- 1180
            + I V F   +  +QL     SGG++ V  +  ++A+Q    +PF + DEI+  +D+   
Sbjct: 993  IEIKVKFRDNSELQQLNPHVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNE 1052

Query: 1181 ---YRTSVANTIKELSAHAQFICTTFRTDML 1208
               +R  V N   E ++    I     T++ 
Sbjct: 1053 RIVHRIMVENACAENTSQYFLITPKLLTNLF 1083

>AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [3294
           bp, 1097 aa]
          Length = 1097

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 79/345 (22%), Positives = 153/345 (44%), Gaps = 44/345 (12%)

Query: 27  IQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREER- 85
           I S+ +  F TY    A    SP  N++IG NGSGKS F  A+   L+     + R +R 
Sbjct: 46  IVSIRLTNFVTYS--LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRV 103

Query: 86  QGLIHQGTGSIMSAYVEIVFHDPSDQMMMTSGIPV--TEEHIVRVRRTI--GLKKDEYSV 141
           +  I  GT     + +EI   +  +     SG+P+   E+  + VR  +    +K  Y +
Sbjct: 104 EDFIKNGTA---ESTIEIQLRNSRN----VSGLPMISAEDEAINVRTVLMKARRKCAYYI 156

Query: 142 NGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAK-DKERLLLLEDVVGARSFEI 200
           NG+   ++ +  +   +     N    + Q R+      K DK    LLE  V +    +
Sbjct: 157 NGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADK----LLEQTVRSVDASL 212

Query: 201 -----KLRESSKKMEATNRD----RAKITSELSELKAXXXXXXXXXXXXXKYQELERDRR 251
                +L+ S ++  + NR+    + K+   ++  ++             K +E++  +R
Sbjct: 213 LGLLEQLKTSQQEELSLNREVELGQKKLEKLMTHKESLENQVRALEEYERKKEEIDIHKR 272

Query: 252 IFQFVLYDRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIAN--LTKNISNVEA 309
           +  +V     +     Q++ L+ EY  V Q  +E++++  K+   IA+  L   + N + 
Sbjct: 273 LLPYV----RVKNHKRQLKDLKSEYERVKQELKEFLKD--KKPFKIASNALLSEVENSQR 326

Query: 310 ELKLKESTDFQ---QDKSRLQEIVKRKADLE-----IRYEETKRQ 346
           + + KES   Q     +S ++E+ K++ ++E     + Y  T+R+
Sbjct: 327 QKQGKESEYIQVKSTQRSLIEELGKQRTEVEDLKKKVTYYRTRRE 371

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 1144 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKE 1191
            SGG++ V  +  ++A+Q    APF + DEI+  +D +Y   V   + E
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVE 1039

>Scas_643.11
          Length = 1095

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 97/206 (47%), Gaps = 19/206 (9%)

Query: 27  IQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREER- 85
           I  + +Q F TYR +T   + SP  N++IG NGSGKS F  AV   L+     + R +R 
Sbjct: 38  IVKIKLQNFVTYR-LTEF-NLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRV 95

Query: 86  QGLIHQGTGSIMSAYVEIV---FHDPSD-QMMMTSGIPVTEEHIVRVRRTI---GLK-KD 137
              I  G     ++ +EI    + DP++ Q  +     +  + +++V R I   G K K 
Sbjct: 96  DDFIKNGED---TSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGNKCKS 152

Query: 138 EYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARS 197
           +Y +N K   ++ I  + + +     N    + Q R+     A+ K   LL+E V   RS
Sbjct: 153 DYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEF--ARLKSDKLLVETV---RS 207

Query: 198 FEIKLRESSKKMEATNRDRAKITSEL 223
            + +L +    ++++  D   + +E+
Sbjct: 208 IDAQLLQILDDLKSSQNDETTLENEV 233

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 79/193 (40%), Gaps = 51/193 (26%)

Query: 1039 LEQSKESIEKLVESLKKQKVE-----------------AVEATFSKVATNFTTIFEKLVP 1081
            L+Q ++ I +L E+L KQ+VE                  ++    K++T F+ +F+ +  
Sbjct: 893  LKQVEKEISQLEETLPKQQVELKSIKEKIKQGRSTLEPKLDEIIEKISTRFSRLFKNVGS 952

Query: 1082 AGIGRLI-IHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSF-NSKNNEQLY 1139
            AG   L+  H+ +E                             + I V F ++   ++L 
Sbjct: 953  AGAVNLVKPHQFSEWK---------------------------IEIMVKFRDNATLKRLD 985

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQ-----YRTSVANTIKELSA 1194
                SGG++ V  +  ++A+Q    APF + DEI+  +D +     ++  V N   E ++
Sbjct: 986  SHTQSGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTS 1045

Query: 1195 HAQFICTTFRTDM 1207
                I     TD+
Sbjct: 1046 QYFLITPKLLTDL 1058

>Kwal_26.7204
          Length = 1117

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 99/231 (42%), Gaps = 24/231 (10%)

Query: 6   VNSIRNQS--RASFRAREIVEMYIQSVL---IQGFKTYRNITAVEDFSPHFNVVIGGNGS 60
           +N I  QS  R  F   ++ +    S++   ++ F TY ++T     SP  N++IG NGS
Sbjct: 43  LNEIEMQSSKRLKFGKEDLSQFQPGSIVKLRLENFVTY-SLTEFH-LSPSLNMIIGPNGS 100

Query: 61  GKSNFFAAVRFVLSDDYSSLKREER-QGLIHQGTGSIMSAYVEIVF-HDPSDQMMMTSGI 118
           GKS F  AV   L+     + R +R    I  G        +E+    DP       +G 
Sbjct: 101 GKSTFVCAVCLGLAGKPEYIGRGKRVDSFIKNGEN---RGLIEVTLKRDPG-----RTGS 152

Query: 119 PVTEEHIVRVRRTIGL-KKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAV 177
            V  +   +V R + + KK EY +N +   +  +  +   +     N    + Q R+   
Sbjct: 153 FVAVDGTTKVSRVLWVGKKSEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEF 212

Query: 178 TNAKDKERLLLLEDVVGARSFEIKLRESSKKMEATNRDRAKITSELSELKA 228
             A+ K   LL+E V   RS  + L ES K ++    ++     EL ELK 
Sbjct: 213 --ARLKSDKLLMETV---RSVNVNLLESFKNLKTLQEEQITEAKEL-ELKT 257

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query: 1144 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQ-----YRTSVANTIKELSAHAQF 1198
            SGG++ V  +  ++A+Q    APF + DEI+  +D +     ++  V N   E +  +Q+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKT--SQY 1069

Query: 1199 ICTT 1202
            I  T
Sbjct: 1070 ILVT 1073

>AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH]
           complement(714355..717666) [3312 bp, 1103 aa]
          Length = 1103

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 69/160 (43%), Gaps = 29/160 (18%)

Query: 26  YIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKRE-E 84
           Y++ + ++ F  + +     +F P  N ++G NGSGKS    A+  V     S   R   
Sbjct: 61  YMKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKASDTNRGVS 118

Query: 85  RQGLIHQGTGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHI----VRVRRTIGLKKD--- 137
            + LI +G G   +A + IV        +   G+   E+ +    + + RT  LK+D   
Sbjct: 119 LKSLIREGCG---TARIAIV--------LANQGLGAFEQGVYGSEITIERT--LKRDGQS 165

Query: 138 -EYSV---NGK--TCHKSDISRMFESVGFSASNPYNIVPQ 171
             +S+   NG+  +  K D+ R+ +       NP   + Q
Sbjct: 166 SHFSIKSENGREVSNKKRDLQRIVDYFSIPVLNPMCFLSQ 205

>Scas_719.6
          Length = 1096

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 103/238 (43%), Gaps = 18/238 (7%)

Query: 354 CAVYRKNLATVEEEIQNTSTQLNRLSPRYEQLKLEAEAFEAQLSQY--------QRKQRE 405
           C   R+N+ T + +I     ++     + E+   +  + E ++ +         Q  Q  
Sbjct: 305 CQELRQNIKTFQTKIAEVMAKIESKKEKIERYTADGASIEKEIDEKVVTVSQKDQEHQAT 364

Query: 406 IISKRGIYAQFENQSERDAWIAKELSSLKAQTDDLKKNVEIMEAEKEQVAAEIQQDKEAI 465
             S R +   FE +        + ++  + +   L K +E +E   + +  E+  DKE +
Sbjct: 365 RDSLREVRKVFETEKSNQREAEQNITQCRNRIKTLDKTIEHLE---QDLKKEMGGDKEQM 421

Query: 466 TELNDSVRGPG--ISSELQDIQTHLNDLKRSYLEKIDERK-ELWRSEQRLQTVSEALLDG 522
            E   S+      +  EL D+Q  ++++K    + I +R+ EL   E+ +Q   +  L+ 
Sbjct: 422 REEQISLEHESDQLRKELSDLQISMDEMKNEERDIIRQRQTELQGIERSIQQ-KKLELNK 480

Query: 523 VKRSERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGPLGELIKVNEKYKTCAEAV 580
           + + E NL    DRN+   L A+++  Q+ + PP    GPLG  I +   ++     +
Sbjct: 481 IAQGENNLLSNFDRNMDRLLNAIQQNIQKFQTPP---LGPLGMYISIKSGFEQWTRPI 535

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 71/185 (38%), Gaps = 41/185 (22%)

Query: 21  EIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSL 80
           EI   YI+ V ++ F  + N     +  P  N ++G NGSGKS    A+   L    S  
Sbjct: 58  EIRSGYIKKVSLRNFMCHENFEL--ELGPKLNFIVGSNGSGKSAILTAITIALGAKASDT 115

Query: 81  KR-EERQGLIHQGTGSIMSAYV----------------EIVFH-------DPSDQMMMTS 116
            R    + LI +G  S     V                EI+          PS  +   S
Sbjct: 116 NRGNSLKELIKEGCYSAKITLVIENGKQGAYDQGTYGKEIIIERTLRRDGSPSFSLKSES 175

Query: 117 GIPVTEEHIVRVRRTIGLKKDEYS--VNGKTCHKS-DISRMFESVGFSASNP---YNIVP 170
           G+ ++ +     +R I    D +S  VN   C  S D +R F     +AS P   YN   
Sbjct: 176 GVEISNK-----KRDIQTVVDFFSVPVNNPMCFLSQDAARSF----LTASTPQDKYNHFG 226

Query: 171 QGRIV 175
           +G ++
Sbjct: 227 KGTLL 231

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR----TSVANTIKELSAH 1195
            V+ LSGG+K+   +AL+LA      +     DE D  +D+  R    T V   +K+L+  
Sbjct: 994  VDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLART 1053

Query: 1196 AQFICTTFRTDMLQVAD 1212
               I T    D+ ++AD
Sbjct: 1054 QTIIITP--QDIGKIAD 1068

>YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing
          an SMC domain N-terminal domain, which bind ATP in
          chromosome-associated proteins, has low similarity to
          S. pombe Spr18p, which is likely to be involved in the
          maintenance of chromosome structure [3282 bp, 1093 aa]
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 9/61 (14%)

Query: 15 ASFRAREIVEMYIQSVLIQGFKTYRNITAVE-DFSPHFNVVIGGNGSGKSNFFAAVRFVL 73
          +SF+   I++     + +Q F TY   T  E + SP  N++IG NGSGKS F  AV   L
Sbjct: 35 SSFQPGSIIK-----IRLQDFVTY---TLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGL 86

Query: 74 S 74
          +
Sbjct: 87 A 87

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 1144 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1178
            SGG++ V  +  ++A+Q    APF + DEI+  +D
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMD 1021

>YLR383W (RHC18) [3762] chr12 (885288..888632) Protein involved in
           recombination repair, homologous to S. pombe rad18 [3345
           bp, 1114 aa]
          Length = 1114

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 75/361 (20%), Positives = 145/361 (40%), Gaps = 31/361 (8%)

Query: 26  YIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREER 85
           YI+ V+++ F  + +     +     N ++G NGSGKS    A+   L    S   R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 86  -QGLIHQGTGSIMSAYVEIVFH-DPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEY-SVN 142
            + LI +G  S      +I+ H D S       GI   E  + R+ +  G       S N
Sbjct: 139 LKDLIREGCYS-----AKIILHLDNSKYGAYQQGIFGNEIIVERIIKRDGPASFSLRSEN 193

Query: 143 GK--TCHKSDISRMFESVGFSASNPYNIVPQG---RIVAVTNAKDKERLL----LLEDVV 193
           GK  +  K DI  + +      SNP   + Q      +  + ++DK        LL+++ 
Sbjct: 194 GKEISNKKKDIQTVVDYFSVPVSNPMCFLSQDAARSFLTASTSQDKYSHFMKGTLLQEIT 253

Query: 194 GARSFEIKLRESSKKMEATNRDRAKITSELSELKAXXXXXXXXXXXXXKYQELERDRRIF 253
               +   + +S+++  A + +       L  LKA             +  +L   + + 
Sbjct: 254 ENLLYASAIHDSAQENMALHLE------NLKSLKAEYEDAKKLLRELNQTSDLNERKMLL 307

Query: 254 QFVLYDRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKL 313
           Q      ++   T   ++LE+E + + Q  +E  +++  R+  I   T + + +EA++  
Sbjct: 308 QAKSLWIDVAHNTDACKNLENEISGIQQKVDEVTEKIRNRQEKIERYTSDGTTIEAQIDA 367

Query: 314 K------ESTDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEE 367
           K      + ++ Q  +  L+++  R    +    E +   DQ   +     K +A +EEE
Sbjct: 368 KVIYVNEKDSEHQNARELLRDVKSRFEKEKSNQAEAQSNIDQGRKKVDALNKTIAHLEEE 427

Query: 368 I 368
           +
Sbjct: 428 L 428

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR----TSVANTIKELSAH 1195
            V+ LSGG+K+   +AL+LA      +     DE D  +D+  R    T +   +K+++  
Sbjct: 1016 VDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIART 1075

Query: 1196 AQFICTTFRTDMLQVAD 1212
               I T    D+ ++AD
Sbjct: 1076 QTIIITP--QDIGKIAD 1090

>CAGL0F01155g complement(116762..120079) similar to tr|Q08204
           Saccharomyces cerevisiae YOL034w, hypothetical start
          Length = 1105

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 6/82 (7%)

Query: 27  IQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREER- 85
           I  + ++ F TY N T   + SP  N++IG NGSGKS +  AV   L+     + R ++ 
Sbjct: 38  IVKIRLENFVTY-NYTEF-NLSPSLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQV 95

Query: 86  QGLIHQGTGSIMSAYVEIVFHD 107
           +  I  G     ++ +EIV  D
Sbjct: 96  EDFIKNGQD---TSKIEIVLKD 114

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 1144 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQY 1181
            SGG++ V  +  ++A+Q    APF + DEI+  +D  +
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNF 1037

>CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces
           cerevisiae YLR383w RHC18, hypothetical start
          Length = 1110

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 26  YIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKR-EE 84
           YI+ + +  F  +RN     +  P  N ++G NGSGKS    A+   L    S   R   
Sbjct: 79  YIKKLTLHNFMCHRNFDV--ELGPGLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 85  RQGLIHQGTGS 95
            + LI  G  S
Sbjct: 137 LKDLITAGCNS 147

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
            Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 37.4 bits (85), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 36/83 (43%), Gaps = 13/83 (15%)

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ-- 1197
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  I+    H +  
Sbjct: 464  VKHLSGGELQRVAIVLSLGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1198 -------FICTTFRTDMLQVADS 1213
                   FI  T+  D + V D 
Sbjct: 520  AFIVEHDFIMATYLADKVIVFDG 542

>Scas_636.14
          Length = 608

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ-- 1197
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  I+    H +  
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520

Query: 1198 -------FICTTFRTDMLQV 1210
                   FI  T+  D + V
Sbjct: 521  AFVVEHDFIMATYLADKVIV 540

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
            ortholog of human Rnase L inhibitor (RLI) of the
            interferon-regulated 2-5A pathway, putative ortholog of
            C. elegans Y39E4B.1, member of the non-transporter group
            in the ATP-binding cassette (ABC) superfamily [1827 bp,
            608 aa]
          Length = 608

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ-- 1197
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  I+    H +  
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520

Query: 1198 -------FICTTFRTDMLQV 1210
                   FI  T+  D + V
Sbjct: 521  AFIVEHDFIMATYLADKVIV 540

>ABR227C [821] [Homologous to ScYLR069C (MEF1) - SH]
           (827283..829556) [2274 bp, 757 aa]
          Length = 757

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 534 MDRNLANGLKAVREITQRLKLPPGAVHGPLG 564
           MDR  A+  KA+++I  +L++P  AVH P+G
Sbjct: 202 MDRMGADPFKAIQQINTKLRIPAAAVHVPIG 232

>KLLA0E05247g complement(472583..475879) similar to sp|Q12749
           Saccharomyces cerevisiae YLR383w RHC18 recombination
           repair protein, start by similarity
          Length = 1098

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 12/116 (10%)

Query: 26  YIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKR-EE 84
           +I+ + +  F  + N +      P  N ++G NGSGKS    A+   L    ++  R   
Sbjct: 63  FIKEIKLTNFMCHSNFSL--RLGPRLNFIVGNNGSGKSAILTAITIGLGAKATTTNRGTS 120

Query: 85  RQGLIHQGTGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYS 140
            + LI QG     ++ + IV  +      + S  P      +R+ RTI  +++ YS
Sbjct: 121 LKDLIKQGCN---TSKIVIVLCNEG----LNSFEPGVYGKEIRIERTI--RREGYS 167

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 18/114 (15%)

Query: 1122 SGVSISVSFN-----------SKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLF 1170
            SG S S+SF            + ++    V+ LSGG+K+   IAL+LA  +   +     
Sbjct: 970  SGYSGSLSFTDSGQLNVMVKTTNDHHARNVDTLSGGEKSFSQIALLLATWLTMRSRIIAL 1029

Query: 1171 DEIDAALDKQYRTSVANTI-----KELSAHAQFICTTFR--TDMLQVADSFYRV 1217
            DE D  +D+  R    N I     K++ +  Q I  T +    M  + D ++ +
Sbjct: 1030 DEFDVFMDQVNRKIGTNLIIRRLGKDVKSDTQTIIITPQDIGKMANIDDKYFNI 1083

>Kwal_56.23429
          Length = 539

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 33/76 (43%), Gaps = 13/76 (17%)

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ-- 1197
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   +  I+    H +  
Sbjct: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520

Query: 1198 -------FICTTFRTD 1206
                   FI  T+  D
Sbjct: 521  AFLVEHDFIMATYLAD 536

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
            complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ-- 1197
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   +  I+    H +  
Sbjct: 464  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1198 -------FICTTFRTDMLQV 1210
                   FI  T+  D + V
Sbjct: 520  AFIVEHDFIMATYLADKVIV 539

>CAGL0F01529g 156044..158317 highly similar to sp|P25039
           Saccharomyces cerevisiae YLR069c MEF1, start by
           similarity
          Length = 757

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 534 MDRNLANGLKAVREITQRLKLPPGAVHGPLG 564
           MDR  AN  KA+ ++  +LKLP  AV  P+G
Sbjct: 201 MDRMGANPFKAIEQLNSKLKLPAAAVQVPIG 231

>Kwal_33.13526
          Length = 1298

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 9/95 (9%)

Query: 32  IQGFKTY-RNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREERQG-LI 89
           IQG +++  N     +F     +++G NGSGK+     +++  + D   L    + G  +
Sbjct: 9   IQGIRSFDSNERETIEFGKPLTLIVGSNGSGKTTIIECLKYATTGD---LPPNSKGGAFV 65

Query: 90  HQG--TGSI-MSAYVEIVFHDPSD-QMMMTSGIPV 120
           H    TG   + A V++ F  P+D  M++T  I +
Sbjct: 66  HDPKITGEKDVRAQVKLAFTSPNDVSMIVTRNIQL 100

>CAGL0B02772g complement(267689..268987) similar to tr|Q05919
           Saccharomyces cerevisiae YLR360w VPS38, start by
           similarity
          Length = 432

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 10/106 (9%)

Query: 261 ELNEVTSQIESLEDEYNNV---LQSSEEYIQELYKRETL-IANLTKNISNVEAELKLKES 316
           ELN+V S IE+  DEY N+   L +++E I++L K++ + + N+ KN    + ++ L  S
Sbjct: 252 ELNDVDSNIETYRDEYANIYSKLSNAKEAIEKLQKKKLIQLINVFKNTFLFDKDVGLI-S 310

Query: 317 TDFQQDKSRLQEIVKRKADLEI-----RYEETKRQRDQVHGQCAVY 357
             F  D+  ++E  K    + I     RY E  +    ++     Y
Sbjct: 311 FQFDDDEIEVEEFCKNLERVSIEQIYDRYNEYPKSVKIINAMLGFY 356

>Kwal_26.9480
          Length = 719

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 1142 QLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKE 1191
             +SGG+K   AIA +L    +  AP   FDE  +ALD     ++  TIKE
Sbjct: 599  MISGGEKQRLAIARVL----LKDAPIMFFDEATSALDTHTEQALLRTIKE 644

>KLLA0C17556g complement(1544404..1546227) highly similar to
            sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1, start
            by similarity
          Length = 607

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 35/83 (42%), Gaps = 13/83 (15%)

Query: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ-- 1197
            V+ LSGG+    AI L L +     A  YL DE  A LD + R   +  I+    H +  
Sbjct: 464  VQHLSGGELQRVAIVLSLGMN----ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1198 -------FICTTFRTDMLQVADS 1213
                   FI  T+  D + V D 
Sbjct: 520  AFIVEHDFIMATYLADKVIVFDG 542

>Kwal_26.9380
          Length = 1102

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 26  YIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREER 85
           +I+ V ++ F  + +     +  P  N ++G NGSGKS    A+   L    +   R   
Sbjct: 69  FIKKVQLRNFMCHEHFEL--ELGPRLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 126

Query: 86  -QGLIHQGTGSIMSAYVEIVFHD 107
            + LI +G     S+ + IV ++
Sbjct: 127 LKDLIREG---CQSSKISIVLNN 146

>KLLA0A10131g complement(889688..891850) similar to sp|P40416
            Saccharomyces cerevisiae YMR301c ATM1 ATP-binding
            cassette transporter protein, mitochondrial, hypothetical
            start
          Length = 720

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 1142 QLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKE 1191
             +SGG+K   AIA +L    +   P   FDE  +ALD     S+  TIKE
Sbjct: 592  MISGGEKQRLAIARVL----LKDTPIMFFDEATSALDTHTEQSLLKTIKE 637

>YDR283C (GCN2) [1112] chr4 complement(1025062..1030041)
           Serine/threonine protein kinase that regulates
           initiation of translation by phosphorylation of
           eIF2alpha (Sui2p), involved in general amino acid
           control response and salt tolerance [4980 bp, 1659 aa]
          Length = 1659

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 490 DLKRSYLEKIDERKELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREIT 549
           +L  SY    + +KE+   E+ L+TV +A  D V R      E M RN A  +  +R +T
Sbjct: 288 ELDNSYFNTSNGKKEIANLEKELETVLKAKHDNVNRLFGYTVERMGRNNATFVWKIRLLT 347

Query: 550 QRLKLPPGAVHGPLGELIK 568
           +         + PLG+LI+
Sbjct: 348 EYCN------YYPLGDLIQ 360

>AFL158C [3037] [Homologous to ScYAL067C (SEO1) - NSH]
           (137788..139482) [1695 bp, 564 aa]
          Length = 564

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 794 TSL-TVNEEKIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTEALSELSL 852
           TSL T  EEK E Y D+ K+P+ K L ++E    K+ A + R  S     T++A  +L  
Sbjct: 58  TSLDTFTEEKYE-YRDESKRPWWKYLDEQEYRVTKAHASKRRSWSWFGTATSKAEKKLLF 116

Query: 853 RIDLL 857
           ++D+L
Sbjct: 117 KLDVL 121

>Kwal_14.1090
          Length = 763

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 534 MDRNLANGLKAVREITQRLKLPPGAVHGPLG 564
           MDR  AN  +A+ +I ++LK P  A+  P+G
Sbjct: 206 MDRMGANPFRAIEQINKKLKTPAAAIQVPIG 236

>AFR203C [3395] [Homologous to ScYMR117C (SPC24) - SH]
           (804580..805194) [615 bp, 204 aa]
          Length = 204

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 7/66 (10%)

Query: 427 AKELSSLKAQTDDLKKNVEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQT 486
           A+ELS L+AQ  +  +  E M AEKE  A  +Q    A+T   D VR   +++EL++++ 
Sbjct: 56  AQELSELQAQQTERAQAAEAMRAEKETQAQHLQ----ALTHSQDLVR---LANELEELEQ 108

Query: 487 HLNDLK 492
            L  L+
Sbjct: 109 QLVSLR 114

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
            cerevisiae YLR188w MDL1 ATP-binding cassette transporter
            family member, hypothetical start
          Length = 706

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 1142 QLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ 1197
            QLSGGQK   A+A      ++DP+   + DE  +ALD Q    VA ++++ SA  +
Sbjct: 569  QLSGGQKQRIALARAF---LLDPS-ILILDEATSALDSQSEEVVAQSLQQRSARGK 620

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
            complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 1143 LSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKE 1191
            +SGG+K   AIA +L    +  AP   FDE  +ALD     ++ +TI++
Sbjct: 572  ISGGEKQRLAIARVL----LKDAPLMFFDEATSALDTHTEQALLHTIQQ 616

>YIR017C (MET28) [2682] chr9 complement(383553..384116)
           Transcriptional activator regulating sulfur amino acid
           metabolism that functions with Met4p and Cbf1p, member
           of the basic leucine zipper (bZIP) family [564 bp, 187
           aa]
          Length = 187

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 23/31 (74%)

Query: 367 EIQNTSTQLNRLSPRYEQLKLEAEAFEAQLS 397
           ++QN +TQ+N+L  R EQL  E E ++A+L+
Sbjct: 136 KLQNLNTQINKLRDRIEQLNKENEFWKAKLN 166

>AFR364C [3556] [Homologous to ScYEL043W - SH] (1095530..1097923)
           [2394 bp, 797 aa]
          Length = 797

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 91/222 (40%), Gaps = 33/222 (14%)

Query: 245 ELERDRRIFQFVLYDRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNI 304
           EL+RDR +    +   +LN++   ++    E NN L             +TL  N     
Sbjct: 306 ELKRDRLLKTIEVSSNKLNKMHMDMDMWSSEQNNALH-----------MDTLRQNY---- 350

Query: 305 SNVEAELKLKESTDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATV 364
            N+E E     +T      SRLQ +      LE   E+ KR            +K L T 
Sbjct: 351 -NLEKE---HINTQIAATTSRLQSMQHELNQLE---EQNKRLNR--------LKKTLDTT 395

Query: 365 EEEIQNTSTQLNRLSPRYEQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSERDA 424
           ++ + NT++ ++  S  +   +     FEA   +      E+  +  I     ++ E+D 
Sbjct: 396 KDSVHNTASPVSWRSMSHSVSEQMISHFEAFCDESNGSLSELPQQLPIVQLLRDELEKDI 455

Query: 425 WIAKELSSLKAQTDDLKKNVEIMEAEKEQVAAEIQQDKEAIT 466
            + +E +  K Q     K++E +E   EQV+   QQ + AIT
Sbjct: 456 ALYEECNENKLQA---YKHLEYLETMWEQVSMTNQQYRTAIT 494

>YNL239W (LAP3) [4368] chr14 (200568..201932) Aminopeptidase of
           cysteine protease family, homologous to rabbit bleomycin
           hydrolase [1365 bp, 454 aa]
          Length = 454

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 562 PLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKA 608
           P G+LIK++         +GG++++++ VD E  + +++  L N KA
Sbjct: 278 PYGKLIKIDR----LGNVLGGDAVIYLNVDNETLSKLVVKRLQNNKA 320

>KLLA0E19723g 1743508..1749933 highly similar to sp|Q12680
            Saccharomyces cerevisiae YDL171c GLT1 glutamate synthase
            (NAPDPH) (GOGAT) singleton, start by similarity
          Length = 2141

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 1089 IHRTTEKSNRGTGQRSPEYSPLNSNADTLDS 1119
            ++R   KSN G G   PE S +NSN DT+ S
Sbjct: 966  MNRLGAKSNCGEGGEDPERSIVNSNGDTMRS 996

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 80/220 (36%), Gaps = 47/220 (21%)

Query: 995  ERIL-------RKLNTVNDKISKMSNINRRAIENFKKFNDKREDLESRAEELEQSKES-- 1045
            ERIL       RKL T+  +I  M+ +N++  EN  +  D  ED E    E     E+  
Sbjct: 1033 ERILVDTWVRDRKLGTIPSEIQIMATLNKKPHENIMRLLDFFEDDEYYYIESPMHGETGS 1092

Query: 1046 --IEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGTGQR 1103
              +  L+E          +  F +VA+    + E          I+HR  +  N     R
Sbjct: 1093 IDLFDLIELKTNMTEHEAKLLFKQVASGLRHLHEN--------GIVHRDIKDENVIVDNR 1144

Query: 1104 ---------SPEY---SPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVC 1151
                     S  Y    P +    T+D  Y+             E L  +   G  + V 
Sbjct: 1145 GRVKIIDFGSAAYVKRGPFDVFVGTID--YAA-----------PEVLGGDPYEGKPQDVW 1191

Query: 1152 AIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKE 1191
            A+ ++L   +    PFY  DEI   LD   R S A  + E
Sbjct: 1192 AVGVLLYTIIYKENPFYNIDEI---LDGDLRISPAVVVSE 1228

>Scas_565.1
          Length = 442

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 6/76 (7%)

Query: 259 DRELNEVTSQIESLEDEYNNVLQSSEEYIQELY-----KRETLIANLTKNISNVEAELKL 313
           D ++NE  S I++  +E N VLQ   ++  +L      + ETLI+   + +S++   L L
Sbjct: 335 DLKINETNSIIDTYNNELNTVLQKGNDWTSKLLNDYSIRVETLISASDRILSDINTTLTL 394

Query: 314 KESTDFQQDKSRLQEI 329
           K    FQ++  R   +
Sbjct: 395 KLKL-FQENTERYGSV 409

>KLLA0F11792g 1087802..1089667 similar to sgd|S0002456 Saccharomyces
           cerevisiae YDR049w, hypothetical start
          Length = 621

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 13/81 (16%)

Query: 436 QTDDLKKNVEIMEAEKEQ---VAAEIQQDKEAITELNDSVRGPG--ISSELQDIQTHLND 490
           Q D+  K +  +E EKE+   +  E+Q  KE I E  D+ RGPG  + +   ++Q +LN 
Sbjct: 535 QIDERHKKI-ALEEEKEKKDLIEKELQAAKERIKEEKDAKRGPGMKLGAASSNVQINLNS 593

Query: 491 LKRSYLEKIDERKELWRSEQR 511
           L        D+R  L R EQR
Sbjct: 594 LTD------DQRMRLMR-EQR 607

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,685,932
Number of extensions: 1529907
Number of successful extensions: 10661
Number of sequences better than 10.0: 627
Number of HSP's gapped: 9940
Number of HSP's successfully gapped: 1300
Length of query: 1229
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1116
Effective length of database: 12,684,275
Effective search space: 14155650900
Effective search space used: 14155650900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)