Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.24211205118847740.0
AAL181C122166510471e-122
KLLA0C09394g11846979931e-115
YJL076W (NET1)11897877991e-88
CAGL0H02783g17854736836e-73
Scas_675.2413194106647e-71
Scas_711.389986855715e-60
CAGL0B03179g9273283574e-34
YKR010C (TOF2)7712382592e-22
YAL044C (GCV3)17052692.8
Scas_670.2243776713.4
Kwal_56.23825139641688.9
Scas_625.1*106169688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2421
         (1188 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2421                                                         1843   0.0  
AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF...   407   e-122
KLLA0C09394g 817925..821479 weakly similar to sp|P47035 Saccharo...   387   e-115
YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein r...   312   1e-88
CAGL0H02783g 251169..256526 some similarities with sp|P47035 Sac...   267   6e-73
Scas_675.24                                                           260   7e-71
Scas_711.38                                                           224   5e-60
CAGL0B03179g complement(309816..312599) weakly similar to sp|P47...   142   4e-34
YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein t...   104   2e-22
YAL044C (GCV3) [23] chr1 complement(57953..58465) Glycine decarb...    31   2.8  
Scas_670.22                                                            32   3.4  
Kwal_56.23825                                                          31   8.9  
Scas_625.1*                                                            31   8.9  

>Kwal_14.2421
          Length = 1205

 Score = 1843 bits (4774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/1188 (79%), Positives = 950/1188 (79%)

Query: 1    MYKLQVVLVPPGFSGVTFALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQQTGSSN 60
            MYKLQVVLVPPGFSGVTFALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQQTGSSN
Sbjct: 1    MYKLQVVLVPPGFSGVTFALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQQTGSSN 60

Query: 61   NLFMSSFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVEVLTLQDS 120
            NLFMSSFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVEVLTLQDS
Sbjct: 61   NLFMSSFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVEVLTLQDS 120

Query: 121  NECDLDPDYLVKDVFNVDNVVRAVLRNDIELSDDQSQTLYSAKRRRLNSSLPNPSGQPNV 180
            NECDLDPDYLVKDVFNVDNVVRAVLRNDIELSDDQSQTLYSAKRRRLNSSLPNPSGQPNV
Sbjct: 121  NECDLDPDYLVKDVFNVDNVVRAVLRNDIELSDDQSQTLYSAKRRRLNSSLPNPSGQPNV 180

Query: 181  LHIAKKRPHMLRNSSAMRVSTPLANQIYPPATGRQVNSDYEDDDVGDRSVLXXXXXXXXX 240
            LHIAKKRPHMLRNSSAMRVSTPLANQIYPPATGRQVNSDYEDDDVGDRSVL         
Sbjct: 181  LHIAKKRPHMLRNSSAMRVSTPLANQIYPPATGRQVNSDYEDDDVGDRSVLPPPQPQSQP 240

Query: 241  XXXXXGVGSAKKINFNEDTVSRSEAVDPDKSRQQRLPSGTPMRHINNGTATTPNRLNVLD 300
                 GVGSAKKINFNEDTVSRSEAVDPDKSRQQRLPSGTPMRHINNGTATTPNRLNVLD
Sbjct: 241  IRISSGVGSAKKINFNEDTVSRSEAVDPDKSRQQRLPSGTPMRHINNGTATTPNRLNVLD 300

Query: 301  GTLQADEVTNKSSATPVATNKRITSGMLRIPEPKISEIENELRQGPASPSAELPPRPDRI 360
            GTLQADEVTNKSSATPVATNKRITSGMLRIPEPKISEIENELRQGPASPSAELPPRPDRI
Sbjct: 301  GTLQADEVTNKSSATPVATNKRITSGMLRIPEPKISEIENELRQGPASPSAELPPRPDRI 360

Query: 361  PMKKQQFPXXXXXXXXXXXGNENPTLMEKANNLILEHGSKPSASRQTSIADNNGSPIKDG 420
            PMKKQQFP           GNENPTLMEKANNLILEHGSKPSASRQTSIADNNGSPIKDG
Sbjct: 361  PMKKQQFPQSDDEEQSQSSGNENPTLMEKANNLILEHGSKPSASRQTSIADNNGSPIKDG 420

Query: 421  NKIGNVNLAELPQVGRRITRKSSLESKVESLIKSATNLSEEARGDLQRLKDNSNNAIRKD 480
            NKIGNVNLAELPQVGRRITRKSSLESKVESLIKSATNLSEEARGDLQRLKDNSNNAIRKD
Sbjct: 421  NKIGNVNLAELPQVGRRITRKSSLESKVESLIKSATNLSEEARGDLQRLKDNSNNAIRKD 480

Query: 481  TFSEEDDMEGQLPEDPNDTVRVNHLDNSGNSSFQKSELLSMLKGNKFNIPSDFNKRSLRS 540
            TFSEEDDMEGQLPEDPNDTVRVNHLDNSGNSSFQKSELLSMLKGNKFNIPSDFNKRSLRS
Sbjct: 481  TFSEEDDMEGQLPEDPNDTVRVNHLDNSGNSSFQKSELLSMLKGNKFNIPSDFNKRSLRS 540

Query: 541  NTGYVETGGNKISINSTDAKNQRQQRGAARKASRLLXXXXXXXXXXXXXXXXXXXXIETD 600
            NTGYVETGGNKISINSTDAKNQRQQRGAARKASRLL                    IETD
Sbjct: 541  NTGYVETGGNKISINSTDAKNQRQQRGAARKASRLLSSGKSKDQEESSESDEESSGIETD 600

Query: 601  RSENGRVNVVENQALRKLNIHPLKERVIGEGGEEASQVEISPSPKNDKKTGQTSEGGSSA 660
            RSENGRVNVVENQALRKLNIHPLKERVIGEGGEEASQVEISPSPKNDKKTGQTSEGGSSA
Sbjct: 601  RSENGRVNVVENQALRKLNIHPLKERVIGEGGEEASQVEISPSPKNDKKTGQTSEGGSSA 660

Query: 661  VKSRQKXXXXXXXXXXXXXXXXXXXXXXXXXFNKTRDSVKSPRALSKSVTREEISTKLMK 720
            VKSRQK                         FNKTRDSVKSPRALSKSVTREEISTKLMK
Sbjct: 661  VKSRQKTSNTSRSTSASSETSSSETSASSEEFNKTRDSVKSPRALSKSVTREEISTKLMK 720

Query: 721  GISPAPGDRETRTYQSPEFIEDSDEDMSTNETKSSNAVAGDSKPVEKKLAPSILXXXXXX 780
            GISPAPGDRETRTYQSPEFIEDSDEDMSTNETKSSNAVAGDSKPVEKKLAPSIL      
Sbjct: 721  GISPAPGDRETRTYQSPEFIEDSDEDMSTNETKSSNAVAGDSKPVEKKLAPSILKRREEA 780

Query: 781  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIAQXXXXXXXXXXXXXXXXXXXXLG 840
                                              LIAQ                    LG
Sbjct: 781  EKKRQQRQAIKKAREEETAKKKAEKEARRREKEALIAQKKAEREAKRKAKEEGATRKKLG 840

Query: 841  RDLKSTXXXXXXXXXXXXXXNSTAVTHEKADDKVDPAQNADDTQDAEKVAKKGVPSESTG 900
            RDLKST              NSTAVTHEKADDKVDPAQNADDTQDAEKVAKKGVPSESTG
Sbjct: 841  RDLKSTAKGSRGSSKRASAANSTAVTHEKADDKVDPAQNADDTQDAEKVAKKGVPSESTG 900

Query: 901  TKDIQHGSDNLKPQDLAQYFNTGDKSTQSSPQNGIAAESPSKEAGEKDESKLARLKSQFT 960
            TKDIQHGSDNLKPQDLAQYFNTGDKSTQSSPQNGIAAESPSKEAGEKDESKLARLKSQFT
Sbjct: 901  TKDIQHGSDNLKPQDLAQYFNTGDKSTQSSPQNGIAAESPSKEAGEKDESKLARLKSQFT 960

Query: 961  SGQSAVAENPKSSSKDNLSKDEGKAPSDASISDVPXXXXXXXXXXXXXXXXXXXXXXXXR 1020
            SGQSAVAENPKSSSKDNLSKDEGKAPSDASISDVP                        R
Sbjct: 961  SGQSAVAENPKSSSKDNLSKDEGKAPSDASISDVPDADSSSNDNDSSGDDSSDDESAGSR 1020

Query: 1021 KSRRGIVDTPKGAIISLPKRGKKGDLSGVENAPQSTQQGHVSTSAEKTPAKVPVTRMMEM 1080
            KSRRGIVDTPKGAIISLPKRGKKGDLSGVENAPQSTQQGHVSTSAEKTPAKVPVTRMMEM
Sbjct: 1021 KSRRGIVDTPKGAIISLPKRGKKGDLSGVENAPQSTQQGHVSTSAEKTPAKVPVTRMMEM 1080

Query: 1081 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGVPEVKDLPVNGSKVPLNSTSEKX 1140
                                               RGVPEVKDLPVNGSKVPLNSTSEK 
Sbjct: 1081 SSPVSLSNSNSPPKASKKPESKPSRSLSSLSDLVSRGVPEVKDLPVNGSKVPLNSTSEKG 1140

Query: 1141 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFISAKSASKALGRS 1188
                                              FISAKSASKALGRS
Sbjct: 1141 ESNNDQSQEESDQSDSEEDSDSSTDDSSDGQGSNFISAKSASKALGRS 1188

>AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF2)
           - SH] (20056..23721) [3666 bp, 1221 aa]
          Length = 1221

 Score =  407 bits (1047), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 276/665 (41%), Positives = 367/665 (55%), Gaps = 70/665 (10%)

Query: 1   MYKLQVVLVPPGFSGV--TFALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQQTG- 57
           MYKLQVVLVPP          LP    + DNS     +     ++ +   R E     G 
Sbjct: 1   MYKLQVVLVPPSIETELPVVGLPAG--SLDNSGFAQGHAQPISTSSIAGGRGEFSSGIGN 58

Query: 58  -SSNNLFMSSFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVEVLT 116
            S+N +++S     H    + RK LHFTKPTN+L+ LA+EIVE+C K+YP L    E++T
Sbjct: 59  TSANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEPEIVT 118

Query: 117 LQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDI-ELSDDQSQTLYSAKRRRLNS-----S 170
           LQD NECDLDPD++VKDVFN+DN VR +LRND+ E + D  +T+Y  K+R+LN+      
Sbjct: 119 LQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLDEAAGD--RTIY-MKKRKLNTGAAGVP 175

Query: 171 LPNPSGQPNVLHIAKKRPHMLRNSSAMRVSTPLANQIYPPATGRQVNSDYEDDDVGDRSV 230
               S Q  VL++AKKR  +   +SA+RVSTPLANQIYPP T +QVNSD+EDDDV D+S+
Sbjct: 176 AAGGSVQAAVLNVAKKRASI--KTSALRVSTPLANQIYPPPTKKQVNSDFEDDDVADKSI 233

Query: 231 LXXXXXXXXXXXXXXGVGSAKKINFNEDTVSRSEAVDPDKSRQQRLPSGTPMRHINNGTA 290
           L              G+   K+IN N++ VS+SE VDP+KSRQQRLPSGTPMR ++    
Sbjct: 234 LPPPPPQSPPIRISSGMDQ-KRINMNDNAVSKSETVDPNKSRQQRLPSGTPMRPVS--MV 290

Query: 291 TTPNRLNVLDGT-LQADEVTNKSSATPVATNKRITSGMLRIPEPKISEIENELRQGPASP 349
            TPNR+++   T L    V+ KS+ATP+ TN RITSGMLRIPEP++SE+E EL++GPASP
Sbjct: 291 ETPNRVSLTGPTVLSESTVSQKSTATPIITNIRITSGMLRIPEPRLSEVEKELKEGPASP 350

Query: 350 SAELPPRPDRIPMKKQQFPXXXXXX---XXXXXGNENPTLMEKANNLILEHGSKPSASRQ 406
           + +LP RP RIPMKK   P                +N   +   N   LE      A+RQ
Sbjct: 351 AVDLPARPSRIPMKKPYNPSMQQDEDLSSSSSSTEDNVPAVPYENE--LERSGPTMATRQ 408

Query: 407 TS--IADNNGSPIKDGN-KIGNVNLAELPQVGRRITRKSSLESKVESLIKS-ATNLSEEA 462
           +S  IAD+ GSP K    +  N+ L ELP       RKSSLE KV  L K  A++   E 
Sbjct: 409 SSSTIADDQGSPTKKSRFEKNNIGLVELPS-----PRKSSLEKKVSKLNKGLASDKGHE- 462

Query: 463 RGDLQRLKDNSNNAIRKDTFSEEDDMEGQLPEDPNDTVRVNHLDNSGNSSFQKSELLSML 522
                   D++    RKD FS+E+    Q     N +V VN  +     SFQKSELL + 
Sbjct: 463 --------DSTGGITRKDHFSDEESEASQ-----NGSVVVNRPETQREKSFQKSELLKIF 509

Query: 523 KGNKFNIPSDFNKRS----------LRSNTGYVETGGNKISINSTDAKN---QRQQRGAA 569
              +F++P  F   +           R    YV      I  +S D +N   +R QR AA
Sbjct: 510 NSKRFDLPPRFKNSASEDEPTSSNQSRKKKPYVTVLNKDIDNSSPDPRNIIPRRTQRHAA 569

Query: 570 RKASRLLXXXXXXXXXXXXXXXXXXXX------IETDRSENGRVNVVENQALRKLNIHPL 623
           +KA++ +                          I +D  +N  V V E+ AL+KLN+HPL
Sbjct: 570 QKAAQSISSGTSRSNVFSGEEKNKYSEENQGDNIASD--DNEGVYVHESNALKKLNVHPL 627

Query: 624 KERVI 628
           KE V+
Sbjct: 628 KESVV 632

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 6/60 (10%)

Query: 1020 RKSRRGIVDTPKGAIISLPKRGKKGDLSGVENAPQSTQQGHVSTSAEKTPAKVPVTRMME 1079
            +K RRGIV  PKG++ +  K   +   S +E  PQSTQ  + +T+        P+T++++
Sbjct: 1045 KKPRRGIVQPPKGSVSAPVKHVPQSLSSELEGVPQSTQIPNEATNT------APLTKLLD 1098

>KLLA0C09394g 817925..821479 weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1184

 Score =  387 bits (993), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 280/697 (40%), Positives = 389/697 (55%), Gaps = 106/697 (15%)

Query: 1   MYKLQVVLVPPGFS-GVTFALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQ----Q 55
           M+KLQVVLVP G +    F LP+   ++++SQ +    V       G N P+L      Q
Sbjct: 1   MFKLQVVLVPAGANRSFNFGLPSV--SSESSQFI--LPVQQQVLQQGGNAPQLANNIPAQ 56

Query: 56  TG--------SSNNLFMSSFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPN 107
            G        S+N  ++SSF ++H + PKL+K L FTKPTNTL+ L++EI+++C+KIYPN
Sbjct: 57  NGIGALDPNVSTNTAYLSSFMTSHITRPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPN 116

Query: 108 LTRPVEVLTLQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDIELSD--DQSQTLYSAKRR 165
           L+  +E+ TLQD +ECDLDPD++VKDVFNV N VR +LRND++L    D+ ++LYS+KRR
Sbjct: 117 LSTELEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDLESNPDRQESLYSSKRR 176

Query: 166 RLNSSLPNPSGQPNV---------LHIAKKRPHMLRNSSAMRVSTPLANQIYPPATGR-- 214
           +LN    N + Q N          + +AK+RP  L+N SA+R+STPLA+QIYPP + R  
Sbjct: 177 KLN----NGNSQQNTSTGATLDQPVTVAKRRPQALKN-SALRISTPLAHQIYPPPSQRNP 231

Query: 215 -QVNSDYE-----DDDVGDRSVLXXXXXXXXXXXXXXGVGSAK--KINFNEDTVSRSEAV 266
            QVNSDYE     DD++GD+S+L                 + K  KIN +EDTVS+SE V
Sbjct: 232 KQVNSDYEEDEYGDDEIGDKSILPPPTVPQSPPIRISSSIAQKRLKINGSEDTVSKSETV 291

Query: 267 DPDKSRQQRLPSGTPMRHINNGTATTPNRLNVLDGTLQADEVTNKSSATPVATNKRITSG 326
           DP K++QQRLPSGTPM+ +N     TPNR   L    QA  +  + ++TPV TNKRITSG
Sbjct: 292 DPSKAKQQRLPSGTPMKPMN--VIETPNRPGFLAMPQQAQHLL-RINSTPVVTNKRITSG 348

Query: 327 MLRIPEPKISEIENELRQGPASPSAE-LPPRPDRIPMKKQQFPXXXXXXXXXXXGNEN-- 383
           MLRIPEP+ISE+E  + +G +SP+A  LPP+  +IPMKKQ  P             E+  
Sbjct: 349 MLRIPEPRISEMERTMHEGLSSPAAGLLPPKSAKIPMKKQYIPDEHDSSSSEGEFTEDKE 408

Query: 384 --PTLMEKANNLILEHGSK-PSASRQTSIADNNGSPIK----DGNKIGNVNLAELPQVGR 436
             P  +     L +   S+ PS     SIAD+NGSP K    D  K  NV +A+LP    
Sbjct: 409 SVPVRVNSKAPLPVSVQSRAPS-----SIADDNGSPTKKSPLDATKRMNVKVADLPP--- 460

Query: 437 RITRKSSLESKVESLIKSATNLSEEARGDLQRLKDN--SNNAIRKDTFSEEDDMEGQLPE 494
              RKSSLE+KVE L K+A+ L          + DN  S+N  RK+ FSE +    +   
Sbjct: 461 --QRKSSLEAKVEKLAKNASEL----------VADNHLSSNTTRKEGFSESESENAESEN 508

Query: 495 DPNDTVRVNHLDNSGNSSFQKSELLSMLKGNKFNIPSDF---------NKRSLRSNTGYV 545
           + NDTV + H  +  + SFQKSELL +LKG+KF++P  F         N  + RS   Y+
Sbjct: 509 EANDTVCI-HPTDRMDGSFQKSELLELLKGSKFDVPPAFRRAAGALQENDINKRSRKPYL 567

Query: 546 ETGGNKISINSTDAKN---QRQQRGAARKASRLLXXXXX-----------XXXXXXXXXX 591
                 I  +  D +N    +  R AA+KA++ +                          
Sbjct: 568 TVLNKDIDNSEPDPRNILPSKLPRQAAQKAAQFISTGTSRRPLQSSSSSSSSSAVVSEEP 627

Query: 592 XXXXXIETDRSENGRVNVVENQALRKLNIHPLKERVI 628
                IET+ S+N    V     L++LN+HPL+  ++
Sbjct: 628 SSDSDIETENSDNSMDEV----NLKRLNVHPLRPVMV 660

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 40/61 (65%), Gaps = 6/61 (9%)

Query: 1020 RKSRRGIVDTPKGAIISLPKRGKKGDLSGVENAPQSTQQGHVSTSAEKTPAKVPVTRMME 1079
            +K+RRGIVDTPKG I S+ K       S +ENAPQSTQQ + S      P KVPVT+MME
Sbjct: 1005 KKTRRGIVDTPKGLIGSISKSAIDKGTSDLENAPQSTQQSNSS------PIKVPVTKMME 1058

Query: 1080 M 1080
             
Sbjct: 1059 Y 1059

>YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein
           required for rDNA chromatin silencing and nucleolar
           integrity, has similarity to Tof2p, component of RENT
           complex [3570 bp, 1189 aa]
          Length = 1189

 Score =  312 bits (799), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 269/787 (34%), Positives = 380/787 (48%), Gaps = 193/787 (24%)

Query: 1   MYKLQVVLVPPGFSGVT-FALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQQTGSS 59
           MYKLQVVLVPP             P  A++SQ+LP             NR  + Q  G +
Sbjct: 1   MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLP-------------NRTNMAQSAGDA 47

Query: 60  NNLFMS------SFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVE 113
           +  + +      SF  ++ +  + RK L FTKPTNTL +L++EI+++C+K+YP+L   +E
Sbjct: 48  SLQYANLRSANVSFTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIE 107

Query: 114 VLTLQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDIELSDDQSQTLY-SAKRRRLNS--- 169
           +L+LQD++ CDLDPD+LVKDVFNV+N+VR +L+N+I+L D    +LY S KR +LN+   
Sbjct: 108 ILSLQDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGSP 167

Query: 170 -------SLPNPSGQPNVLHIAKKRP-------HMLRNSS--AMRVSTPLANQIYPPATG 213
                   +P+ SG   VL IAKKRP         +R+++  +MRVSTPLA QIYPP + 
Sbjct: 168 QSVQPQQQIPSSSG---VLRIAKKRPPTGTTTTTTIRSATNGSMRVSTPLARQIYPPPSS 224

Query: 214 RQV--NSDYEDDDVGDRSVLXXXXXXXXXX-XXXXGVGSAKKIN---FNEDTVSRSEAVD 267
           + V  NSD ED+D+G+RS L               G+ + KKI      ED VSRS  VD
Sbjct: 225 KIVSNNSDDEDEDIGERSFLPPPTQPQSPPIRISSGIDAGKKIKSSIVEEDIVSRSATVD 284

Query: 268 PDKSRQQRLPSGTPMRHINNGTATTPNRLNVLDGTLQADEVTNKSSAT------------ 315
           PDK++QQRL SGTP+      +  TPNR+  L G     E  +K+               
Sbjct: 285 PDKTKQQRLLSGTPIM-----STMTPNRV-TLTGQRVVSEHAHKNELVFSASASSSSFAN 338

Query: 316 --------------PVATNKRITSGMLRIPEPKISEIENELRQGPASPSAELPPRPDRIP 361
                         P  T  RITSGML+IPEP+ISEIE EL++GP+SP++ LP +  +IP
Sbjct: 339 GGTAAVTAQDINRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSPASILPAKAAKIP 398

Query: 362 MKKQQFPXXXXXXXXXXXGNENPTLMEKANNLILEHGSKPSASR-QTSIADNNGSPIKD- 419
           MKK                +EN    E       E  SK S  R Q+SIADNNGSP+K+ 
Sbjct: 399 MKKPYLENGENYESDDSSSSENQETPE------TEPHSKASLQRSQSSIADNNGSPVKNS 452

Query: 420 --GNKI-GNVNLAELPQVGR-RIT-----------------RKSSLESKVE--------S 450
             G+ +  NV+LAELP+     IT                 RKSSLE+ VE         
Sbjct: 453 PLGDAMPHNVHLAELPKASNTSITKSSNGESWGKQQEHQPPRKSSLETIVEKKSQAEPSG 512

Query: 451 LI--KSATNL-----------------------------------SEEARGDLQRL--KD 471
           ++  K  TN                                    S+++ G L+ L  K 
Sbjct: 513 IVEPKRMTNFLDDNQVREKEDTNDKLLEKEILPTIPHNDQPILASSDKSNGTLKSLAGKV 572

Query: 472 NSNNAIRKDTFSEEDD--MEGQLPEDPND------TVRVNHLDNSGNSSFQKSELLSMLK 523
           +SNN       S+ED   + G + +D ND      TVR+   D S +SSF KS+L  M++
Sbjct: 573 SSNN-----NASKEDGTIINGTIEDDGNDNDEVDTTVRIVPQD-SDSSSFPKSDLFKMIE 626

Query: 524 GNKFNIPSDFNKRSLRSNTG------YVETGGNKISINSTDAKN---QRQQRGAARKASR 574
           G+  ++P  F  ++ R++        Y       I  +  D +N   QR  R AA++A++
Sbjct: 627 GDDTDLPQWFKGKNSRTSGNSKNSKPYTTVLNKDIDNSKPDPRNILPQRTPRSAAKRAAQ 686

Query: 575 LLXXXXXXXXXXXXXXXXXXXXIETDRSENG------------RVNV-VENQALRKLNIH 621
           LL                       D SE+G            R N+ V N   + +++H
Sbjct: 687 LLAGAKKNEVPQKSTEDSSSAASTDDESESGIETDFSSDDDFKRKNMSVPNNGPKDISLH 746

Query: 622 PLKERVI 628
            LK  V+
Sbjct: 747 SLKGSVV 753

>CAGL0H02783g 251169..256526 some similarities with sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1785

 Score =  267 bits (683), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 188/473 (39%), Positives = 269/473 (56%), Gaps = 60/473 (12%)

Query: 1   MYKLQVVLVPPGFSGVTFAL-----PTNPPTADNSQVLPPNIVSNGS---TILGANRPE- 51
           MYKLQV+LVPP      F+L       N   AD SQ LP  +  NG+   T  G ++P+ 
Sbjct: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKV--NGTFNNTFNGQSQPDS 58

Query: 52  --LGQQTGSSNNLFMSSFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLT 109
                 T S+++L   ++ +       ++K LHFTK  NTL  L++EI ++C  +YP+L 
Sbjct: 59  SIFPVLTRSNSSLLTPNYYAQRS----MKKFLHFTKANNTLLDLSDEINDKCKAMYPSLE 114

Query: 110 RPVEVLTLQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDIELSDDQSQTLY-SAKRRRLN 168
             +++L+LQDSN CDLDPD++VKDVFNVDN+VR +L +++++S+    + Y S KRRRLN
Sbjct: 115 ADLDILSLQDSNGCDLDPDFVVKDVFNVDNIVRVILNDELDISEITPVSSYRSIKRRRLN 174

Query: 169 -SSLPNPSGQPNV------LHIAKKR---PHMLRNSSAM--RVSTPLANQIYPP-ATGRQ 215
             SL +   Q +       + + KKR    ++++  S +  R+STPLA Q+YPP A    
Sbjct: 175 PESLADSKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRISTPLARQLYPPSAIFEP 234

Query: 216 VNSDYEDDDVGDRSVLXXXXXXXXXX-XXXXGVGS-AKKINF---NEDTVSRSEAVDPDK 270
            NSD  D++V DRS L               G+ +  +KI      +DTVSRS  VDPDK
Sbjct: 235 QNSD--DEEVADRSFLPPPIQPGSPPIRISSGIDTNVRKITSRIGEQDTVSRSATVDPDK 292

Query: 271 SRQQRLPSGTPMRHINNGTATTPNRLNVLDGTLQADEVTNKSSATPV-------ATNKRI 323
           SRQQRL SGTP+      +  TPNR+ +    + +++  N S  T         + ++RI
Sbjct: 293 SRQQRLLSGTPVM-----STMTPNRVTLTGQRVISEQRPNDSVLTFTNRHINEPSHSRRI 347

Query: 324 TSGMLRIPEPKISEIENELRQGPASPSAELPPRPDRIPMKKQQFPXXXXXXXXXXXGNEN 383
           TSGML+IPEPKI+E+E EL +GP+SPS  LPP PD+IPMKK   P            +E 
Sbjct: 348 TSGMLQIPEPKIAEMEKELLEGPSSPSTILPPIPDKIPMKK---PFIETERYYSEDSSET 404

Query: 384 PTLMEKANNLILEHGSKPSASRQTSIADNNGSPIKDGNKIGNVNLAELPQVGR 436
            +   + N       +K S  RQTSIADNNGSP++       V+LA+LP++ +
Sbjct: 405 ESNSGEIN-------AKSSLHRQTSIADNNGSPLRTNFLNEAVHLADLPELQK 450

>Scas_675.24
          Length = 1319

 Score =  260 bits (664), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 169/410 (41%), Positives = 234/410 (57%), Gaps = 56/410 (13%)

Query: 1   MYKLQVVLVPPGF--SGVTFALPTNPPTADNSQVLPPNIVSNGSTILGANRP----ELGQ 54
           MYKLQVVLVPP    S V  + P N P  D+SQ +      NGS IL  +      ++  
Sbjct: 1   MYKLQVVLVPPSARDSLVPLSYPANQP--DSSQFMND---GNGSNILPKSMINGTGDMSM 55

Query: 55  QTGSSNNLFMSSFAS-THGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVE 113
           Q  ++N + + S     + +  K +K LHFTKPTN+L +L++E++ +C+K+YPNL   +E
Sbjct: 56  QFSNNNTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDLE 115

Query: 114 VLTLQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDIELSDDQSQTLY-SAKRRRLNSS-- 170
           +LTLQD N CDLDPD+ VKD+FN+DNVV  +++N++++S   S ++Y + KR++LN+   
Sbjct: 116 ILTLQDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNGGA 175

Query: 171 ---LPNPSGQPN-VLHIAKKRPHM---LRN-----SSAMRVSTPLANQIYP-PATGRQVN 217
                +P  Q    L I KKRP     +RN     +S +R+STPLANQIYP P      N
Sbjct: 176 QQLKTSPRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYPSPIMKMTNN 235

Query: 218 SDYEDDDVGDRSVLXXXXXXXXXX-XXXXGVGSAKKIN---FNEDTVSRSEAVDPDKSRQ 273
           SD E DDV +RS L               G+  +K+I      EDTVSRS  VDPDKS+Q
Sbjct: 236 SDDERDDVRERSFLPPPSQPQSPPIRISSGINQSKRIRSTIVEEDTVSRSGTVDPDKSKQ 295

Query: 274 QRLPSGTPMRHINNGTATTPNRLNVLDGTLQADEVT-----------------NKSS--A 314
           Q +  GTP  +       TPNR+ +    + ++                    NKS    
Sbjct: 296 QVMLPGTPANY-----TMTPNRVTLTGQRVLSENYNTNGNNNGLIFVSSTQGPNKSQQGQ 350

Query: 315 TPVATNKRITSGMLRIPEPKISEIENELRQGPASPSAELPPRPDRIPMKK 364
            P  +  RITSGMLRIPEP+I+EIE EL +GP+SP++ LP + DRIPMKK
Sbjct: 351 QPTLSTPRITSGMLRIPEPRIAEIERELHEGPSSPASALPAKSDRIPMKK 400

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 25/36 (69%)

Query: 1022 SRRGIVDTPKGAIISLPKRGKKGDLSGVENAPQSTQ 1057
            SRR +V TPKG +  +PK+  + D S +EN PQSTQ
Sbjct: 1132 SRRLVVATPKGELSFIPKKPSQTDFSDLENMPQSTQ 1167

>Scas_711.38
          Length = 998

 Score =  224 bits (571), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 208/685 (30%), Positives = 321/685 (46%), Gaps = 136/685 (19%)

Query: 61  NLFMSSFASTHGSTP-KLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVEVLTLQD 119
           N F+S     + S P K +K L FTKPTN LF+L+ EIVE+C+ +YP+L+  +E+ TL+D
Sbjct: 47  NRFLSFGLPLNFSIPTKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRD 106

Query: 120 SNECDLDPDYLVKDVFNVDNVVRAVLRNDIEL-SDDQSQTLYSAKRRRLNSSLPNP---- 174
           S +CDLDPD++V++VF+  N+V+ +L+NDI+  S +Q     S KRR+ N+    P    
Sbjct: 107 STDCDLDPDFIVEEVFSSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTGSYQPLSNK 166

Query: 175 --SGQPNVLHIAKKRPHMLRNSS------AMRVSTPLANQIYPPATGRQVNSDYEDDDVG 226
               Q N ++   ++ ++  +S+        R+STPLA QIYP    +  N   ED +  
Sbjct: 167 VSQQQANGVYGIPRKQYLAISSTKTPSNVGRRISTPLAQQIYPDIDEQLENE--EDRNAA 224

Query: 227 DRSVLXXXXXXXXXX-XXXXGVGSAKKIN--FNEDTVSRSEAVDPDKSRQQRLPSGTPMR 283
           DRS L               G+  +KKI+    +D+VSRSE VDPDKS+QQRL  GTP+ 
Sbjct: 225 DRSFLPPPAQPQSPQIRVSSGIDRSKKIDGIAKDDSVSRSEVVDPDKSKQQRLLLGTPIM 284

Query: 284 HINNGTATTPNRLNVLDGTLQADEVT---------NKSSATPVA---TNKRITSGMLR-I 330
                T  TPNR+ +    + ++  T         NK ++T      +N+R+ S +L+ I
Sbjct: 285 -----TTMTPNRVTLTGQRVVSESHTSNSLQFIPNNKENSTQRLSSNSNRRVNSAVLKNI 339

Query: 331 PEPKISEIENELRQGPASPSAELPPRPDRIPMKKQQFPXXXXXXXXXXXGNENPTLMEKA 390
           PEPKI+E+E  L+ GP+SP++ LP + +R+PMK+                +++ T     
Sbjct: 340 PEPKITEVEKVLKAGPSSPASLLPEKSERLPMKRPFLTGVSSSYSDENISSDSST----- 394

Query: 391 NNLILEHGSKPSASRQTSIADNNGSPIKDG----NKIGNVNLAELP---QVGR----RIT 439
                   S+P+  RQ+SIADNNGSP+K+     N   ++ LAELP    V R     ++
Sbjct: 395 -------HSRPTLQRQSSIADNNGSPVKNSPNEENNPDSMQLAELPLDKNVARVQNDLLS 447

Query: 440 RKSSLESKVE--SLIKSATNLSEEARGDLQRLKDNSN-------NAIRK----------- 479
              +  S+VE  +L      +++E R D  + +D  N       NA+ K           
Sbjct: 448 EIDNRRSRVEDNNLSHLFKPITQENRDDNDKTEDTDNNIKHTSKNAVEKQSNITPSFIGD 507

Query: 480 ---DTFSEEDDMEGQLP---------------------EDPNDTVRVN----HLDNSGNS 511
              +  + E ++   LP                     ++ N TVR+N       NS N 
Sbjct: 508 EERELLTNESEVGSTLPPTDKHQNRNGQITPSEETDDEDEANTTVRINPPGRGDKNSTNV 567

Query: 512 SFQKSELLSMLKGNKFNIPSDF--NKRSLRSNTGYVETGGNKISINSTDAKN---QRQQR 566
           S QK ++L + +G    IPS    +K   +    Y       I  +  D +N   +R  R
Sbjct: 568 SLQKVDVLKIFEGESLKIPSWLKGSKSKSQRRKPYTTVLYKDIDNSKPDPRNILPERTPR 627

Query: 567 GAARKASRLLXXXXXXXXXXXXXXXXXXXX----------------------IET-DRSE 603
            AA++A++LL                                          IET D  E
Sbjct: 628 SAAKRAAQLLSGSQLARNQSKEGEEEQEESNEEVFDNSEQEEFSSDEDSSSGIETADSEE 687

Query: 604 NGRVNVVENQALRKLNIHPLKERVI 628
             RV + EN  ++ +  H LKE V+
Sbjct: 688 MERVMITENNKVKVIKAHALKEAVV 712

>CAGL0B03179g complement(309816..312599) weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 927

 Score =  142 bits (357), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 114/328 (34%), Positives = 158/328 (48%), Gaps = 67/328 (20%)

Query: 1   MYKLQVVLVPPGFSGVTFALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQQTGSSN 60
           MYKLQVVL+ P                         + +NG +I G N         S +
Sbjct: 1   MYKLQVVLIQPQ----------------------NQLKANGYSIDGDN---------SDD 29

Query: 61  NLFMSSFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNL-TRPVEVLTLQD 119
               +     H      RK LHFTKP NTL  LA+EI  R  K+Y NL     E+L+LQD
Sbjct: 30  QTITTIRNGGHIIRDHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSLQD 89

Query: 120 SNECDLDPDYLVKDVFNVDNVVRAVLRNDIE------------LSDDQSQTLYSAKRRRL 167
            N CDLD  YLVKDVF++DN V  +L+N++E            L D    + YS+ R+R 
Sbjct: 90  INHCDLDATYLVKDVFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRKRR 149

Query: 168 NS-SLPNPSG-QPNVLHIAKKRPHMLR-NSSAMRVSTPLANQI-------YPPATGRQVN 217
           +S +  N S  +P +L   + +P+ L   S+ +RV++PLAN+I             R V+
Sbjct: 150 SSKAFGNSSRIEPQILVPKRSKPNNLAPLSNNLRVTSPLANEISNDEINSSTVVINRNVS 209

Query: 218 SDYEDD--DVGDRSVLXXXXXXXXXX-XXXXGVGSAKKINFNE----DTVSRSEAVDPDK 270
           + +  +   + DRS L               G+G  K+I F+E    D VSRSE VDPDK
Sbjct: 210 TAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRI-FSESQNLDVVSRSEVVDPDK 268

Query: 271 SRQQRLPSGTPMRHINNGTATTPNRLNV 298
           S+QQ +    PM  I     +TPNR+N+
Sbjct: 269 SKQQLIVPDIPMEFI-----STPNRVNL 291

>YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein that
           interacts with DNA topoisomerase I [2316 bp, 771 aa]
          Length = 771

 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 117/238 (49%), Gaps = 31/238 (13%)

Query: 1   MYKLQVVLVPPGFSGVTFALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQQTGSSN 60
           M++LQ+VLVPP    +   L     T    Q + P +  N   I   N          ++
Sbjct: 4   MWRLQIVLVPPSAQDIITFLEARLNTP---QSVSPMVQYNEDIITHNNSINNCSDPSPTS 60

Query: 61  NLFMSSFASTHGS-----TPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVEVL 115
               +S  S   S      P  +K LHFT   NTL  L+ EI+ + D++YPN    +E++
Sbjct: 61  PSSQNSIQSNRSSDFINYLPNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIV 120

Query: 116 TLQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDIELSDDQ-------------------S 156
           +LQD + CDLD ++++KDVF  D VV  +L+++++ S +Q                   +
Sbjct: 121 SLQDRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHISLLQLARQRRRQDNKPST 180

Query: 157 QTLYSAKRRRLNSSLPNPSGQPNVLHIAKKRPHMLRNS--SAMRVSTPLANQIYPPAT 212
           +++ + KR++++    +     + +H+  K    L+N+  +  RVSTPL N+I P A+
Sbjct: 181 KSIVTEKRKKISKEDLSSISNKDTMHLIAKSS--LKNNFINKSRVSTPLMNEILPLAS 236

>YAL044C (GCV3) [23] chr1 complement(57953..58465) Glycine
           decarboxylase hydrogen carrier protein H subunit
           (glycine cleavage H protein), functions in the pathway
           for glycine degradation [513 bp, 170 aa]
          Length = 170

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 421 NKIGNVNLAELPQVGRRITRKSSLESKVESLIKSATNLSEEARGDLQRLKDN 472
           + +G+    ELP+VG  I++  SL S +ES +KSA+ + + A G ++ +  N
Sbjct: 72  DSLGDATYVELPEVGTEISQGESLGS-IES-VKSASEIYQPADGTVEEINTN 121

>Scas_670.22
          Length = 437

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 15/76 (19%)

Query: 465 DLQRLKDNSNNAIRKDTFSEEDDME-----GQLPEDPNDTVRVNHLDNSGNSSFQKSELL 519
           D + +++N     ++D F  ED++E      Q+ E P D   + H D  GN         
Sbjct: 355 DFEEIEENIEYQEKEDEFDLEDELEQQQEMTQVEEVPIDLRTMEHYDVRGND-------- 406

Query: 520 SMLKGNKFNIPSDFNK 535
             L+  KF IP+D+ +
Sbjct: 407 --LRREKFIIPTDYER 420

>Kwal_56.23825
          Length = 1396

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 25/41 (60%)

Query: 906  HGSDNLKPQDLAQYFNTGDKSTQSSPQNGIAAESPSKEAGE 946
            H  ++LK +D+       D+S ++  +N +AAE+P +E GE
Sbjct: 1082 HSLNSLKIRDVTATLQALDESLENESKNEVAAETPGEEDGE 1122

>Scas_625.1*
          Length = 1061

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 10/69 (14%)

Query: 92  SLAE---EIVERCDKIYPNLTRPVEVLTLQDSNECDLDPDYLVKDVFNVDNVVRAVLRND 148
           +LAE   +++ERC+K   N     EVL ++   +  LDP+YL+    N  NV++ +L +D
Sbjct: 339 ALAEFVSKLLERCEKSLNN----CEVLFIKTLLDLRLDPNYLIN---NHINVLKNILMDD 391

Query: 149 IELSDDQSQ 157
           +   +D  Q
Sbjct: 392 VNKLNDYVQ 400

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.125    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 32,112,123
Number of extensions: 1360260
Number of successful extensions: 4422
Number of sequences better than 10.0: 89
Number of HSP's gapped: 4460
Number of HSP's successfully gapped: 139
Length of query: 1188
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1075
Effective length of database: 12,684,275
Effective search space: 13635595625
Effective search space used: 13635595625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 67 (30.4 bits)