Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.241559758931920.0
YOR386W (PHR1)56555414950.0
KLLA0D00462g59558814080.0
YOR291W1472146721.2
YGL206C (CHC1)165353692.8
Scas_575.787270692.8
ADL022C339282693.1
KLLA0A10835g1008126693.4
AER359W165153666.4
KLLA0E09680g307128649.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2415
         (589 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2415                                                         1234   0.0  
YOR386W (PHR1) [5159] chr15 (1066835..1068532) Deoxyribodipyrimi...   580   0.0  
KLLA0D00462g 41415..43202 similar to sp|P05066 Saccharomyces cer...   546   0.0  
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    32   1.2  
YGL206C (CHC1) [1790] chr7 complement(102545..107506) Clathrin h...    31   2.8  
Scas_575.7                                                             31   2.8  
ADL022C [1720] [Homologous to ScYLL021W - SH; ScYLR313C - SH] (6...    31   3.1  
KLLA0A10835g 938712..941738 highly similar to sp|Q08162 Saccharo...    31   3.4  
AER359W [2860] [Homologous to ScYGL206C (CHC1) - SH] complement(...    30   6.4  
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    29   9.4  

>Kwal_14.2415
          Length = 597

 Score = 1234 bits (3192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/589 (100%), Positives = 589/589 (100%)

Query: 1   MKKTCKLQLRLSIRIFRTLPTTMKRSLSPPPAETKKQKVAENFEAYYDLDSRYYPKPITW 60
           MKKTCKLQLRLSIRIFRTLPTTMKRSLSPPPAETKKQKVAENFEAYYDLDSRYYPKPITW
Sbjct: 1   MKKTCKLQLRLSIRIFRTLPTTMKRSLSPPPAETKKQKVAENFEAYYDLDSRYYPKPITW 60

Query: 61  KQAHEFNNGKRTKPITLLDDYIKKQALPAGFKVSTVIHWFRTDLRVHDNVGLYNAVQQVK 120
           KQAHEFNNGKRTKPITLLDDYIKKQALPAGFKVSTVIHWFRTDLRVHDNVGLYNAVQQVK
Sbjct: 61  KQAHEFNNGKRTKPITLLDDYIKKQALPAGFKVSTVIHWFRTDLRVHDNVGLYNAVQQVK 120

Query: 121 KAKKSNPQAQLIALYTINEHDWRAHLDSGWKLTFALNAVESLRKKLESMNVSLILRVFQS 180
           KAKKSNPQAQLIALYTINEHDWRAHLDSGWKLTFALNAVESLRKKLESMNVSLILRVFQS
Sbjct: 121 KAKKSNPQAQLIALYTINEHDWRAHLDSGWKLTFALNAVESLRKKLESMNVSLILRVFQS 180

Query: 181 EEPLLSCSAKYADWFKEQCLSISQGSVLVAANAQYESDELYRDWKLCKRQDNRFQFQVYH 240
           EEPLLSCSAKYADWFKEQCLSISQGSVLVAANAQYESDELYRDWKLCKRQDNRFQFQVYH
Sbjct: 181 EEPLLSCSAKYADWFKEQCLSISQGSVLVAANAQYESDELYRDWKLCKRQDNRFQFQVYH 240

Query: 241 DQCTVQPGSLTTGKGSQYTVFTPWYKKWVEYLTTHQKGKDVVKMQIIDSDDKINEKPSTL 300
           DQCTVQPGSLTTGKGSQYTVFTPWYKKWVEYLTTHQKGKDVVKMQIIDSDDKINEKPSTL
Sbjct: 241 DQCTVQPGSLTTGKGSQYTVFTPWYKKWVEYLTTHQKGKDVVKMQIIDSDDKINEKPSTL 300

Query: 301 QSDDYTLAKEFVANLPAEISELLPPATEENAHQILDDFIKKGDAKQYNEKKDIIPLDSTS 360
           QSDDYTLAKEFVANLPAEISELLPPATEENAHQILDDFIKKGDAKQYNEKKDIIPLDSTS
Sbjct: 301 QSDDYTLAKEFVANLPAEISELLPPATEENAHQILDDFIKKGDAKQYNEKKDIIPLDSTS 360

Query: 361 HLSCYITSGLISTRAVVNRGFHENGDSLMRKDIRQNNSMENFIKEVAWRDFYKHVACNWP 420
           HLSCYITSGLISTRAVVNRGFHENGDSLMRKDIRQNNSMENFIKEVAWRDFYKHVACNWP
Sbjct: 361 HLSCYITSGLISTRAVVNRGFHENGDSLMRKDIRQNNSMENFIKEVAWRDFYKHVACNWP 420

Query: 421 YMSMEIAIKFETMDIKWVNDEEMFRKWCMGETGLPIVDAIMRKLLYTGYINNRSRMIVAS 480
           YMSMEIAIKFETMDIKWVNDEEMFRKWCMGETGLPIVDAIMRKLLYTGYINNRSRMIVAS
Sbjct: 421 YMSMEIAIKFETMDIKWVNDEEMFRKWCMGETGLPIVDAIMRKLLYTGYINNRSRMIVAS 480

Query: 481 FLSKNLLVDWRWGERWFRKHLMDADLTSNSGGWGFCSSTGIDAQPYFRIFNMKLQSEKYD 540
           FLSKNLLVDWRWGERWFRKHLMDADLTSNSGGWGFCSSTGIDAQPYFRIFNMKLQSEKYD
Sbjct: 481 FLSKNLLVDWRWGERWFRKHLMDADLTSNSGGWGFCSSTGIDAQPYFRIFNMKLQSEKYD 540

Query: 541 PKGAFVKEWIPELRNINDVKILREGLANQPSVNGYPKPIVDLKESREKA 589
           PKGAFVKEWIPELRNINDVKILREGLANQPSVNGYPKPIVDLKESREKA
Sbjct: 541 PKGAFVKEWIPELRNINDVKILREGLANQPSVNGYPKPIVDLKESREKA 589

>YOR386W (PHR1) [5159] chr15 (1066835..1068532)
           Deoxyribodipyrimidine photolyase, involved in
           light-dependent repair of pyrimidine dimers [1698 bp,
           565 aa]
          Length = 565

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/554 (50%), Positives = 386/554 (69%), Gaps = 20/554 (3%)

Query: 39  VAENFEAYYDLDSRYYPKPITWKQAHEFNNGKRTKPITLLDDYIKKQALPAGFK-VSTVI 97
           +  +FE Y+ L+ +YYP+PIT   A++FNN  R KP+ +++   KKQ     F+ VSTV+
Sbjct: 21  IEHDFEQYHSLNKKYYPRPITRTGANQFNNKSRAKPMEIVEKLQKKQK--TSFENVSTVM 78

Query: 98  HWFRTDLRVHDNVGLYNAVQQVKKAKKSNPQAQLIALYTINEHDWRAHLDSGWKLTFALN 157
           HWFR DLR++DNVGLY +V   ++ ++ N +A+L A+Y INE DWRAH+DSGWKL F + 
Sbjct: 79  HWFRNDLRLYDNVGLYKSVALFQQLRQKNAKAKLYAVYVINEDDWRAHMDSGWKLMFIMG 138

Query: 158 AVESLRKKLESMNVSLILRVFQSEEPLLSCSAKYADWFKEQCLSISQGS-VLVAANAQYE 216
           A+++L++ L  +++ L+L  F + +  LS S ++ ++FKE+C+++S G+  ++ AN +Y+
Sbjct: 139 ALKNLQQSLAELHIPLLLWEFHTPKSTLSNSKEFVEFFKEKCMNVSSGTGTIITANIEYQ 198

Query: 217 SDELYRDWKLCKRQDNRFQFQVYHDQCTVQPGSLTTGKGSQYTVFTPWYKKWVEYLTTHQ 276
           +DELYRD +L + +D+R Q + YHD C V PG +TT +G+ Y+VFTPWYKKWV Y+  ++
Sbjct: 199 TDELYRDIRLLENEDHRLQLKYYHDSCIVAPGLITTDRGTNYSVFTPWYKKWVLYVNNYK 258

Query: 277 KG-KDVVKMQIIDSDDKINEKPSTLQSDDYTLAKEFVANLPAEISELLPPATEENAHQIL 335
           K   ++  + II+   K NE    L+   Y+L  EF+  +P      LP  +EE A   L
Sbjct: 259 KSTSEICHLHIIEPL-KYNET-FELKPFQYSLPDEFLQYIPKS-KWCLPDVSEEAALSRL 315

Query: 336 DDFIKKGDAKQYNEKKDIIPLDSTSHLSCYITSGLISTRAVVNRGFHENGDSLMRKDIRQ 395
            DF+    +K YN +KD++ L  TS LS YIT+G ISTR +VN+ F      +M K ++ 
Sbjct: 316 KDFLGTKSSK-YNNEKDMLYLGGTSGLSVYITTGRISTRLIVNQAFQSCNGQIMSKALKD 374

Query: 396 NNSMENFIKEVAWRDFYKHVACNWPYMSMEIAIKFETMDIKWVNDEEMFRKWCMGETGLP 455
           N+S +NFIKEVAWRDFY+H  CNWPY SM +  + +T+DIKW N+   F KWC G TG+P
Sbjct: 375 NSSTQNFIKEVAWRDFYRHCMCNWPYTSMGMPYRLDTLDIKWENNPVAFEKWCTGNTGIP 434

Query: 456 IVDAIMRKLLYTGYINNRSRMIVASFLSKNLLVDWRWGERWFRKHLMDADLTSNSGGWGF 515
           IVDAIMRKLLYTGYINNRSRMI ASFLSKNLL+DWRWGERWF KHL+D D +SN GGWGF
Sbjct: 435 IVDAIMRKLLYTGYINNRSRMITASFLSKNLLIDWRWGERWFMKHLIDGDSSSNVGGWGF 494

Query: 516 CSSTGIDAQPYFRIFNMKLQSEKYDPKGAFVKEWIPELRNINDVKILREGLANQPSVNGY 575
           CSSTGIDAQPYFR+FNM +Q++KYDP+  FVK+W+PEL +           +       Y
Sbjct: 495 CSSTGIDAQPYFRVFNMDIQAKKYDPQMIFVKQWVPELIS-----------SENKRPENY 543

Query: 576 PKPIVDLKESREKA 589
           PKP+VDLK SRE+A
Sbjct: 544 PKPLVDLKHSRERA 557

>KLLA0D00462g 41415..43202 similar to sp|P05066 Saccharomyces
           cerevisiae YOR386w PHR1 deoxyribodipyrimidine
           photo-lyase singleton, hypothetical start
          Length = 595

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/588 (48%), Positives = 365/588 (62%), Gaps = 74/588 (12%)

Query: 53  YYPKPITWKQAHEFNNGKRTKPITLLDDYI------KKQALPAGFKVSTVIHWFRTDLRV 106
           YY  PIT+K+A+EFNNGKR +P+ LL D I       +Q L        VIHWFR DLRV
Sbjct: 23  YYRNPITFKKANEFNNGKRERPLALLGDSIHADSKNSRQQLDDTVDNRLVIHWFRGDLRV 82

Query: 107 HDNVGLYNAVQQVKKAKKSNPQAQLIALYTINEHDWRAHLDSGWKLTFALNAVESLRKKL 166
            DN GL  A+ Q K          + ALY INEHDW AH++SGWKL F L+A+ SL ++L
Sbjct: 83  RDNTGLAYALNQSK-------SGSVEALYVINEHDWIAHMESGWKLKFQLDALRSLSREL 135

Query: 167 ESMNVSLILRVFQSEEPLLSCSAKYADWFKEQCLSISQG--------------------- 205
             + V L ++ F  E P LS S +YA WF      I+                       
Sbjct: 136 AKLGVRLHVKYFIPESPCLSNSREYAQWFSHIIEEIAASKNYDGNSKDDTKDDTDADEPA 195

Query: 206 -----------------SVLVAANAQYESDELYRDWKLCKRQDN-----RFQFQVYHDQC 243
                            ++LV AN QYE DELYRD K+C+ Q        F  +++HD C
Sbjct: 196 LKKRKKDNDENQKGGSPNILVTANLQYEVDELYRDLKICRLQTQSSNSANFTLKLFHDMC 255

Query: 244 TVQPGSLTTGKGSQYTVFTPWYKKWVEYLTTHQKGKDVVKMQ--IIDSDDKINEKPSTLQ 301
            ++PG L TGKGSQYT+FTPWYKKWV +L  +QK K  + ++  I  S ++    P  ++
Sbjct: 256 IIEPGILKTGKGSQYTIFTPWYKKWVSFLEANQKDKHTICIEASIPQSSNREKVNPEEIK 315

Query: 302 SDDYTLAKEFVANLPAEISELLPPATEENAHQILDDFIKKGDAKQYNEKKDIIPLDSTSH 361
              Y L  +F++ +P +   + P A EE A + L +FI K  A +YN  KD++ L  TS 
Sbjct: 316 ---YQLPDKFMSEMPEQTLNI-PKADEETALKKLTEFISK-RASKYNNDKDLLDLTGTSL 370

Query: 362 LSCYITSGLISTRAVVNRGFHENGDSLMRKDIRQNNSMENFIKEVAWRDFYKHVACNWPY 421
           LSCY+TSG+IS R ++N+ +  N   LM KDI++NNS+E FIKEVAWRDFYKH    WP+
Sbjct: 371 LSCYVTSGVISARTILNQSYQANNSRLMNKDIKKNNSLETFIKEVAWRDFYKHAISYWPF 430

Query: 422 MSMEIAIKFETMDIKWVNDEEMFRKWCMGETGLPIVDAIMRKLLYTGYINNRSRMIVASF 481
           +SM++  KFET++IKW ND  +F KWC GETG+PIVDAIM K+L TGYINNRSRMI ASF
Sbjct: 431 LSMDLPFKFETLNIKWENDVFLFEKWCYGETGIPIVDAIMLKMLKTGYINNRSRMITASF 490

Query: 482 LSKNLLVDWRWGERWFRKHLMDADLTSNSGGWGFCSSTGIDAQPYFRIFNMKLQSEKYDP 541
           L+KNLL+DWRWGERWFRKHL+D D  SN GGWGFC+STGID QPYFR+FNMKLQSEKYDP
Sbjct: 491 LAKNLLIDWRWGERWFRKHLIDYDTASNVGGWGFCASTGIDCQPYFRVFNMKLQSEKYDP 550

Query: 542 KGAFVKEWIPELRNINDVKILREGLANQPSVNGYPKPIVDLKESREKA 589
           +G F++ W+    N +D         ++P     P  IVDL++SRE+ 
Sbjct: 551 EGKFIRHWLENDENDSDN-------VHEPK----PNAIVDLRDSRERV 587

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
           cation-translocating P-type ATPase superfamily of
           membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 62/146 (42%), Gaps = 17/146 (11%)

Query: 298 STLQSDDYTLAKEFVANLPAEISELLP----PATEENAHQILDDFIKKGDAKQYNEKKDI 353
           + L  D   L+ + + N      E +P    PATEE  +Q+ DDF +      +  K  +
Sbjct: 583 TILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDF-QSTQISSFVSKSFL 641

Query: 354 IPLDSTSHLSCYITSGLISTRAVVNR-GFHENGDSLMRKDIRQNNSMENFIKEVAWRDFY 412
              + T+ +   I  G  +  A+V R GF     SL+R  +    +   F     +RD +
Sbjct: 642 --YNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKF-----YRDSF 694

Query: 413 KHVACNWPYMSMEIAIKFETMDIKWV 438
           K++     +MS+     F    ++++
Sbjct: 695 KYIG----FMSLIAIFGFCVSCVQFI 716

>YGL206C (CHC1) [1790] chr7 complement(102545..107506) Clathrin
           heavy chain, required for the internalization step of
           endocytosis [4962 bp, 1653 aa]
          Length = 1653

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 318 EISELLPPATEENAHQILDDFIKKGDAKQYNEKKDII-PLDSTSHLSCYITSG 369
           E  EL  P  +++  Q+ + ++K+   +   E  DI+ P D+T  L+CY+ +G
Sbjct: 435 ETIELARPVLQQDRKQLFEKWLKEDKLECSEELGDIVKPFDTTLALACYLRAG 487

>Scas_575.7
          Length = 872

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 36/70 (51%)

Query: 83  KKQALPAGFKVSTVIHWFRTDLRVHDNVGLYNAVQQVKKAKKSNPQAQLIALYTINEHDW 142
           KK++L A F  +   +   + +++H N+ LY+ ++ + K   +N   Q I++  +N   +
Sbjct: 504 KKRSLYALFIFANTTNLLESLIKLHGNIALYHLIKFISKISATNLTLQKISIKLLNHLFF 563

Query: 143 RAHLDSGWKL 152
               DS  +L
Sbjct: 564 HIGSDSVKQL 573

>ADL022C [1720] [Homologous to ScYLL021W - SH; ScYLR313C - SH]
            (660330..670508) [10179 bp, 3392 aa]
          Length = 3392

 Score = 31.2 bits (69), Expect = 3.1,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 273  TTHQKGKDVVKMQI-IDSDDKINEKPSTLQSDDYTLAKEFVANLPAEISELLPPATEENA 331
            TTH+  +D+  +++  D +   N   +T+ S D+T +   + N+PA  +  L P T  N 
Sbjct: 2868 TTHEVCEDLPTVRVSTDREHDFNPPSTTIASPDFTPSNVAMENVPAMTANSL-PGTTSNT 2926

Query: 332  HQILDDFIKKGDAKQYNEKKDI 353
            + I  D +   D+  +  K ++
Sbjct: 2927 NDIAKDSM--ADSADFQRKVEV 2946

>KLLA0A10835g 938712..941738 highly similar to sp|Q08162
           Saccharomyces cerevisiae YOL021c DIS3 3 -5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA, start by similarity
          Length = 1008

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 60/126 (47%), Gaps = 8/126 (6%)

Query: 226 LCK-RQDNRFQFQVYHDQCTVQPGSLTTGKGSQYTVFTPWYKKWVEYLTTHQKGKDVVKM 284
           LC+  +D+  +F V+H++ +       TG  S         +K VE+ T H KGK +  +
Sbjct: 133 LCRDSEDDVKRFVVFHNEFSEYTFIDRTGNESINDRNDRAIRKTVEWYTNHLKGKGINIV 192

Query: 285 QIIDSDDKINEKPSTLQSDDYTLAKEFVANLP--AEISELLP---PATEENAHQILDDFI 339
            +  ++D++N + +   S       E+V  LP   EI +L+P   P +  ++  + DD  
Sbjct: 193 FV--TNDRLNRQAALKDSLVAKSLAEYVDMLPNSEEIKDLIPNLAPISGMSSKMLEDDPE 250

Query: 340 KKGDAK 345
             G AK
Sbjct: 251 GHGAAK 256

>AER359W [2860] [Homologous to ScYGL206C (CHC1) - SH]
           complement(1298989..1303944) [4956 bp, 1651 aa]
          Length = 1651

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 318 EISELLPPATEENAHQILDDFIKKGDAKQYNEKKDII-PLDSTSHLSCYITSG 369
           E  EL  P  +++   + + ++K+   +   E  D++ P D+T  L+CY+ SG
Sbjct: 434 ETIELAKPVLQQDRKPLFEKWLKEDKLECSEELGDVVHPFDTTLALACYVRSG 486

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 29.3 bits (64), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 21/128 (16%)

Query: 460 IMRKLLYTGYINNRSRMIVASFLSKNLLVDWRWGE-----RWFRKHLMDADLTSNSGGWG 514
           +++K+     I    + ++++ + +   V W WG      RWFR++   ++   N    G
Sbjct: 166 VIKKIYSAQGIRGLYKGLISTLIFRTHFVYW-WGSYELLTRWFRENTKMSEAAINFWAGG 224

Query: 515 FCSSTGI--DAQPYFRIFNMKLQSEKYDPKGAFVKEWIPELRNINDVKILREGLANQPSV 572
           F +S G    A P   +  + L ++KYD  G+F K W   +++I   K           +
Sbjct: 225 FSASFGFWTTAYPSDVVKQVVLCNDKYD--GSF-KSWRTAVKDIYQSK----------GI 271

Query: 573 NGYPKPIV 580
           NG+ K  V
Sbjct: 272 NGFFKGFV 279

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,706,717
Number of extensions: 946511
Number of successful extensions: 2532
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2588
Number of HSP's successfully gapped: 24
Length of query: 589
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 482
Effective length of database: 12,891,983
Effective search space: 6213935806
Effective search space used: 6213935806
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)