Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.241429328914620.0
Scas_675.263193203043e-32
AAL180C2972862981e-31
YKR011C3533172441e-23
KLLA0C09372g2942892272e-21
CAGL0B03201g3183001894e-16
CAGL0M03223g120943635.9
Scas_706.3754416627.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2414
         (289 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2414                                                          567   0.0  
Scas_675.26                                                           121   3e-32
AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)...   119   1e-31
YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protei...    99   1e-23
KLLA0C09372g 816494..817378 weakly similar to sp|Q02209 Saccharo...    92   2e-21
CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02...    77   4e-16
CAGL0M03223g complement(366828..370457) similar to sp|P06105 Sac...    29   5.9  
Scas_706.37                                                            28   7.0  

>Kwal_14.2414
          Length = 293

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/289 (95%), Positives = 276/289 (95%)

Query: 1   MTSSDTHAAQEIYVPIGDDQSVKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITDN 60
           MTSSDTHAAQEIYVPIGDDQSVKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITDN
Sbjct: 1   MTSSDTHAAQEIYVPIGDDQSVKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITDN 60

Query: 61  LKIQCVSHRACNSCPLYILEFDDVSQGYALWKSPGDWALGIMLTSLYATKNGARRVHPTL 120
           LKIQCVSHRACNSCPLYILEFDDVSQGYALWKSPGDWALGIMLTSLYATKNGARRVHPTL
Sbjct: 61  LKIQCVSHRACNSCPLYILEFDDVSQGYALWKSPGDWALGIMLTSLYATKNGARRVHPTL 120

Query: 121 KALVAEQVSSKHDAPFLMETLQKLNVDWDNIDTRFDFTXXXXXXXXXXXXXIGTRDYSSY 180
           KALVAEQVSSKHDAPFLMETLQKLNVDWDNIDTRFDFT             IGTRDYSSY
Sbjct: 121 KALVAEQVSSKHDAPFLMETLQKLNVDWDNIDTRFDFTLFLKLLEEALELEIGTRDYSSY 180

Query: 181 LDIVTRLQYKSLMTMAVLRTKVAVSKRLLEKSLCDYDSRMRAADDACKEASREASVLSDS 240
           LDIVTRLQYKSLMTMAVLRTKVAVSKRLLEKSLCDYDSRMRAADDACKEASREASVLSDS
Sbjct: 181 LDIVTRLQYKSLMTMAVLRTKVAVSKRLLEKSLCDYDSRMRAADDACKEASREASVLSDS 240

Query: 241 IVHSRSPSTSAPVPDDEYLLSSKQLVTNFQNHFRNMAETFETFDVKSSI 289
           IVHSRSPSTSAPVPDDEYLLSSKQLVTNFQNHFRNMAETFETFDVKSSI
Sbjct: 241 IVHSRSPSTSAPVPDDEYLLSSKQLVTNFQNHFRNMAETFETFDVKSSI 289

>Scas_675.26
          Length = 319

 Score =  121 bits (304), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 91/320 (28%), Positives = 153/320 (47%), Gaps = 61/320 (19%)

Query: 1   MTSSDTHAAQEIYVPIGDDQ-SVKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITD 59
           MT+S+T     IY+  GD+Q  VKLT V  F + S + ++ HS+QDT+ +E   C TIT+
Sbjct: 1   MTTSET-----IYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITE 55

Query: 60  NLKIQCVSHRACNSCPLYILEFDDVSQGYALWKSPGDWALGIMLTSLYATKNGAR-RVHP 118
           NLK+   S  A  + P +I+E++++   + +WKS G W +  ++T +Y T++  + +   
Sbjct: 56  NLKLTSTSSLA--TSPTFIIEYNEIYDSFYVWKSEGKWEMTDIVTQIYNTQSQPKAKTKT 113

Query: 119 TLKALVAEQVSSKHDAPF--------LMETLQKLNVDWDNIDTRFDFTXXXXXXXXXXXX 170
              A  + +V  K+D           L   L  LNVDW  +D                  
Sbjct: 114 PNGATKSWEVQFKNDPRLKSHRKKDILKLALNNLNVDWSMVD------------------ 155

Query: 171 XIGTRDYSSYLDIVTRLQY--------KSLMTMAVLRTKVAVSKRLLEKSLCDYDSRMRA 222
                ++ + LD + ++          KS + MA+ RT+++ +K+LL+K + +Y  R R 
Sbjct: 156 ---INEFWNQLDNICQIDSHMGNESSCKSFIVMALFRTRISRNKKLLQKLISEYGERCRN 212

Query: 223 ------ADDACKEASREASVLSDSIVHSRSPSTSA---------PVPDDEYLLSSKQLVT 267
                   D   E + E S L+D  +      TS+         P   D   + +KQ+ +
Sbjct: 213 NSTEAITSDNSAELAIEDSPLADLPIEEEGLKTSSSNQHYSYHQPSTRDSKDIVAKQVFS 272

Query: 268 NFQNHFRNMAETFETFDVKS 287
           NF  HF+  AE +E FD+K+
Sbjct: 273 NFNRHFKVTAEDYELFDLKT 292

>AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)
           [894 bp, 297 aa]
          Length = 297

 Score =  119 bits (298), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 142/286 (49%), Gaps = 19/286 (6%)

Query: 1   MTSSDTHAAQEIYVPIGDDQS-VKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITD 59
           M S      +E+YV  G++   V+L L+  +  + +V  ++  VQD +++ L    TIT 
Sbjct: 1   MGSLQAREMEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITG 60

Query: 60  NLKIQCVSHRACNSCPLYILEFDDVSQGYALWKSP-GDWALGIMLTSLYATKNGARRVHP 118
           NLKI C +H  C +CP YILE+++V+  Y+LWK+   DW L  ++ ++Y    G  R   
Sbjct: 61  NLKIGCDTHADCEACPFYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERG 120

Query: 119 TLKALVAEQVSSKHDAPFLMETLQKLNVDWDNIDTRFDFTXXXXXXXXXXXXXIGTRDYS 178
            L   + + +    D  ++ + L++LN+  + ID   +F                     
Sbjct: 121 GLPREL-QGLREGLDMEYVWDCLRRLNLPLEQIDW-AEFRELLESMLAAKRVADD----- 173

Query: 179 SYLDIVTRLQYKSLMTMAVLRTKVAVSKRLLEKSLCDYDSRMRAADDACKEASREASVLS 238
              D VT    + ++ +A L+  V  SKR +   L  YD R+RAA  +   ++R +S   
Sbjct: 174 ---DCVT---LRGVVALAALQATVQTSKRAVRSQLRAYDRRVRAA--STPASTRTSS--P 223

Query: 239 DSIVHSRSPSTSAPVPDDEYLLSSKQLVTNFQNHFRNMAETFETFD 284
           +S++ + S  +S       Y L + QL  NF+ +FR+MAE FE F+
Sbjct: 224 ESLLPADSRESSVSSVHYTYGLPATQLDANFKTYFRSMAENFELFE 269

>YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protein
           of unknown function [1062 bp, 353 aa]
          Length = 353

 Score = 98.6 bits (244), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 85/317 (26%), Positives = 157/317 (49%), Gaps = 46/317 (14%)

Query: 12  IYVPIGDDQS-VKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITDNLKIQCV-SHR 69
           +Y+  G++Q  VKLT +     ++QV +F+HS+Q+ + +EL    TIT+NLKI C  ++ 
Sbjct: 7   VYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKIDCAPAYL 66

Query: 70  ACNSCP-LYILEFDDVSQGYALWKSPGDWALGIMLTSLYATKNGARRVHPT--LKALVAE 126
             N  P  YILE++++S  + +WKS G W L   L++L    N A  V  T   +    +
Sbjct: 67  KPNCIPHFYILEYEEISDTFFIWKSDGRWQLN-KLSALLYVDNDANVVKNTSWKEVFQND 125

Query: 127 QVSSKHDA-PFLMETLQKLNVDWDNIDTRFDFTXXXXXXXXXXXXXIGTRDYSSYLDIVT 185
           Q    +D   +L   L+K+N D   ++    ++                  ++  +++  
Sbjct: 126 QRFKNYDKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKKQEQFN--MEVFD 183

Query: 186 RLQYKSLMTMAVLRTKVAVSKRLLEKSLCDYDSRMRAADD------------ACKEASRE 233
              +K+++++A+++TKV  +KRLL  +L +Y + M+   +            +C      
Sbjct: 184 --NFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQEQNLKENSLASCSNNEPS 241

Query: 234 ASVLSD----SIVHSRSPST--------------SAP--VPDDEYLLSSKQ---LVTNFQ 270
           AS+ S+    S V+S SPS+                P   P+  ++ SS     + +NF+
Sbjct: 242 ASLESESRHFSPVNSLSPSSLSTDDEAVSTDYIYKGPESKPNVNFMHSSATNDLIKSNFE 301

Query: 271 NHFRNMAETFETFDVKS 287
           ++F+ MAE +ETFD+++
Sbjct: 302 SYFKLMAEDYETFDLRA 318

>KLLA0C09372g 816494..817378 weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5 hypothetical
           protein singleton, start by similarity
          Length = 294

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 133/289 (46%), Gaps = 47/289 (16%)

Query: 11  EIYVPIGDDQ-SVKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITDNLKIQC---V 66
           +IYV  G+++  V+LT +     I ++ R+LH +QD F ++L    TIT NLKI+     
Sbjct: 3   KIYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNSHS 62

Query: 67  SHRACNSCPLYILEFDDVSQGYALWKSPGDWALGIMLTSLYATKNGARRVHPTLKALVAE 126
                +  P YILE+      Y+LWKS  +W L   + +LY +         TL  L   
Sbjct: 63  DDTDDHDKPFYILEYCVAEDTYSLWKSRSEWKLSSAIATLYGSN--------TLTDLPDR 114

Query: 127 QVSSKHDAP--FLMETLQK-------LNVDWDNIDTRFDFTXXXXXXXXXXXXXIGTRDY 177
            V +  D+   F++  L K       + +DWD+I T                     R+ 
Sbjct: 115 LVEALKDSQHIFMVRNLLKEFNIRDTMKIDWDSIATDL-------------MIFFEAREL 161

Query: 178 SSYLDIVTRLQYKSLMTMAVLRTKVAVSKRLLEKSLCDYDSRMRAADDACKEASREASVL 237
              +D     + K+ M +++LR+ V ++KR L  +L  YD ++   D++   +   AS  
Sbjct: 162 KKPID---PYELKTSMALSLLRSMVDLNKRELGSTLLSYDVKVH-QDNSPVSSPPSASTK 217

Query: 238 SDSIVHSRSPSTSAPVPDDEYLLSSKQLVTNFQNHFRNMAETFETFDVK 286
           ++  +  +S  T  P         S QL +NF   F++MAE FET+D +
Sbjct: 218 ANKNITFQSDYTHMP---------STQLQSNFNTFFQSMAENFETYDTE 257

>CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5, hypothetical
           start
          Length = 318

 Score = 77.4 bits (189), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 140/300 (46%), Gaps = 36/300 (12%)

Query: 8   AAQEIYVPIGDDQSVKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITDNLKIQCV- 66
           + + +YV   + + V+L+ V   ++  ++  +   +QD+  V+  C  TI DNLK++   
Sbjct: 2   SGETVYVRGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEVFL 61

Query: 67  -SHRACNSCPLYILEFDDVSQGYALWKSPGDW-ALGIMLTSLYATKNGARRVHPTLKA-- 122
            +    +  P YI+EF+D  + +++W+S G W A   ++   Y T +G  R     K+  
Sbjct: 62  GNTHIKSGMPFYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWYDTLHGNHRSAKKTKSDD 121

Query: 123 ---LVAEQVSSKHDAPFLME-TLQKLNVDWDNIDTRFDFTXXXXXXXXXXXXXIGTRDYS 178
               V  +   +H     +E +L+KLNVDW N +    +              +  +  S
Sbjct: 122 WREFVGTKRMQEHPNKIELENSLKKLNVDWSNCNASVFWK------EIDNHCRVDAKQAS 175

Query: 179 SYLDIVTRLQYKSLMTMAVLRTKVAVSKRLLEKSLCDYDSRM-------RAADDACKEAS 231
            +    T   +  ++ +A+++ +++ +K +++  +  + +RM       ++  D+  E+ 
Sbjct: 176 KHATASTE-GFHHIVLLALIKAELSKNKHVIKNQIDAFHARMSRKHRFRKSRKDSIMESI 234

Query: 232 REASVLSDSIVHSRSPS------TSAPVP----DDEYLLSSKQLVTNFQNHFRNMAETFE 281
            E S   + ++  RS S      T +P      D+E   +SKQ+++NF   F+ + E FE
Sbjct: 235 SEDSCEDEEMIRVRSLSPNYTTATHSPRAVEDIDNE---TSKQIMSNFNMLFKPIVENFE 291

>CAGL0M03223g complement(366828..370457) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy, hypothetical start
          Length = 1209

 Score = 28.9 bits (63), Expect = 5.9,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 11   EIYVPIGDDQSVKLTLVSLFQNISQVRR--FLHSVQDTFSVEL 51
            ++YVP  D++  +++L  L +NI +  +  F   ++D F +E+
Sbjct: 964  QLYVPKRDEEETRVSLTGLPENIEKAEKKIFTEIIRDNFDLEI 1006

>Scas_706.37
          Length = 544

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 12/16 (75%)

Query: 87  GYALWKSPGDWALGIM 102
           G+  WK+PG W +GI+
Sbjct: 210 GFRYWKNPGPWGMGII 225

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.130    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,295,033
Number of extensions: 306539
Number of successful extensions: 996
Number of sequences better than 10.0: 14
Number of HSP's gapped: 983
Number of HSP's successfully gapped: 16
Length of query: 289
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 188
Effective length of database: 13,099,691
Effective search space: 2462741908
Effective search space used: 2462741908
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)