Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.24103731376644e-84
CAGL0G07667g2581354929e-60
KLLA0D02442g3681334965e-59
YKR013W (PRY2)3291344892e-58
Scas_675.272901364617e-55
Sklu_956.13191224612e-54
YJL079C (PRY1)2991294462e-52
Scas_711.372671364251e-49
YJL078C (PRY3)8811334503e-49
AAL179W3601344102e-46
KLLA0D02420g2121363563e-40
CAGL0F05137g2271383461e-38
Kwal_14.24092381333296e-36
AAL178W2051363135e-34
KLLA0C01496g4561352263e-20
AFR700W4341432263e-20
Kwal_33.131927991442001e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2410
         (368 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2410                                                          260   4e-84
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   194   9e-60
KLLA0D02442g complement(207613..208719) some similarities with s...   195   5e-59
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   192   2e-58
Scas_675.27                                                           182   7e-55
Sklu_956.1 YJL079C, Contig c956 998-1957                              182   2e-54
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   176   2e-52
Scas_711.37                                                           168   1e-49
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   177   3e-49
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   162   2e-46
KLLA0D02420g complement(206544..207182) some similarities with s...   141   3e-40
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   137   1e-38
Kwal_14.2409                                                          131   6e-36
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   125   5e-34
KLLA0C01496g complement(113533..114903) some similarities with s...    92   3e-20
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...    92   3e-20
Kwal_33.13192                                                          82   1e-16

>Kwal_14.2410
          Length = 373

 Score =  260 bits (664), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 125/137 (91%)

Query: 232 GNSDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENL 291
           GNSDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENL
Sbjct: 232 GNSDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENL 291

Query: 292 AVGYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYV 351
           AVGYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSAL            DYV
Sbjct: 292 AVGYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDYV 351

Query: 352 ICSYKTAGNFLGEFAEN 368
           ICSYKTAGNFLGEFAEN
Sbjct: 352 ICSYKTAGNFLGEFAEN 368

 Score = 75.5 bits (184), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 38/61 (62%)

Query: 1  MKLSQFXXXXXXXXXXXXXXXXXXXXXXXKHVHQQHTAIVRADVYVENGTTRTSLSTELQ 60
          MKLSQF                       KHVHQQHTAIVRADVYVENGTTRTSLSTELQ
Sbjct: 1  MKLSQFVLLSATAVGAALAAPAAQTTVVTKHVHQQHTAIVRADVYVENGTTRTSLSTELQ 60

Query: 61 P 61
          P
Sbjct: 61 P 61

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  194 bits (492), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 89/135 (65%), Positives = 106/135 (78%)

Query: 234 SDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAV 293
           SDFA ++L  HN KR+LH+DT+ L+WSDELA YAQ+YA+ YDCSG+L HSGGPYGENLA+
Sbjct: 119 SDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAI 178

Query: 294 GYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYVIC 353
           GYS  GSVDAWY EIKDY+++NP +S STGHFTQVVWK S+ +            DYVIC
Sbjct: 179 GYSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVIC 238

Query: 354 SYKTAGNFLGEFAEN 368
           SY  AGNFLGEFA+N
Sbjct: 239 SYDPAGNFLGEFAQN 253

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  195 bits (496), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 105/133 (78%)

Query: 236 FASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVGY 295
           FAS++L  HN KR+LHKDT  LSWSDELASYAQ+YAD YDCSGSL+HSGGPYGENLA+GY
Sbjct: 231 FASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGY 290

Query: 296 STTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYVICSY 355
            TTG+VDAWY EIKDY +SNP+YSSSTGHFTQVVWK ++ +            DY+ICSY
Sbjct: 291 GTTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSY 350

Query: 356 KTAGNFLGEFAEN 368
             AGN LG FA N
Sbjct: 351 DPAGNMLGTFASN 363

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  192 bits (489), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 104/134 (77%)

Query: 235 DFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVG 294
           DF+++++  HN KR+LHKDT  L+WSD LA+YAQ+YAD YDCSG+L HSGGPYGENLA+G
Sbjct: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALG 250

Query: 295 YSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYVICS 354
           Y TTGSVDAWY EI  YD+SNP +S S GHFTQVVWKG+S +            DY+ICS
Sbjct: 251 YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310

Query: 355 YKTAGNFLGEFAEN 368
           YK AGN +GEFA+N
Sbjct: 311 YKAAGNVIGEFADN 324

 Score = 31.6 bits (70), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 30 KHVHQQHTAIVRADVYVENGTTRTSLSTE 58
          +HVHQ  T +V+  V VENG T T+  T+
Sbjct: 27 QHVHQAATVVVQGIVRVENGQTLTTFITK 55

>Scas_675.27
          Length = 290

 Score =  182 bits (461), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 102/136 (75%), Gaps = 1/136 (0%)

Query: 234 SDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAV 293
           S+FAS++L  HN KR+LH++T  LSWSD+LASYAQ+YAD YDCSG+L HSGGPYGENLA+
Sbjct: 150 SEFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLAL 209

Query: 294 GYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXX-XDYVI 352
           GY   GSVDAWY EI  YD+SNP +S + GHFTQVVWK S+ +              YVI
Sbjct: 210 GYDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVI 269

Query: 353 CSYKTAGNFLGEFAEN 368
           CSY  AGNF+GEFAEN
Sbjct: 270 CSYNPAGNFIGEFAEN 285

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  182 bits (461), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 95/122 (77%)

Query: 234 SDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAV 293
           SDFAS+IL  HN KR+LHKDTS L+WS+ LA YAQ YAD YDCSGSL+HSGGPYGENLA+
Sbjct: 170 SDFASSILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSGGPYGENLAL 229

Query: 294 GYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYVIC 353
           GYS TG+VDAWYGEI  YDWSNP YSSSTGHFTQVVWK +S +             YVIC
Sbjct: 230 GYSATGAVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWGSYVIC 289

Query: 354 SY 355
           SY
Sbjct: 290 SY 291

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  176 bits (446), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 82/129 (63%), Positives = 98/129 (75%)

Query: 240 ILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVGYSTTG 299
           +L  HN KR+LHKDT  LSWSD LASYAQDYAD YDCSG+L+HSGGPYGENLA+GY    
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225

Query: 300 SVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYVICSYKTAG 359
           +VDAWY EI +YD+SNP +SS+TGHFTQVVWK ++ +            DYVICSY  AG
Sbjct: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285

Query: 360 NFLGEFAEN 368
           N+ GE+A+N
Sbjct: 286 NYEGEYADN 294

>Scas_711.37
          Length = 267

 Score =  168 bits (425), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 1/136 (0%)

Query: 234 SDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADK-YDCSGSLSHSGGPYGENLA 292
           SDF S++L+ HN KR+LH++T  L+WS+ELA YAQ YAD  Y+C G L HSGGPYGENLA
Sbjct: 126 SDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLA 185

Query: 293 VGYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYVI 352
            GY+  GSVDAWY EI +YD+SNP +S STGHFTQ+VWK +S +             Y+I
Sbjct: 186 AGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLI 245

Query: 353 CSYKTAGNFLGEFAEN 368
           CSY +AGNF GE+  N
Sbjct: 246 CSYNSAGNFDGEYEAN 261

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  177 bits (450), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 78/133 (58%), Positives = 100/133 (75%)

Query: 235 DFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVG 294
           +F S +L  HN  R+LH DT+ L+WSD LA+YAQ+YAD+YDCSG L+HS GPYGENLA+G
Sbjct: 24  NFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALG 83

Query: 295 YSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYVICS 354
           Y+ TG+VDAWYGEI  Y++SNP +S STGHFTQVVWK ++ +            +Y++CS
Sbjct: 84  YTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCS 143

Query: 355 YKTAGNFLGEFAE 367
           Y   GN+LGEFAE
Sbjct: 144 YNPPGNYLGEFAE 156

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  162 bits (410), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/134 (55%), Positives = 94/134 (70%), Gaps = 1/134 (0%)

Query: 236 FASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVGY 295
           F   IL+AHN++R LHKDT  L+WS+ELA +A+D+A++YDCSG L HS  PYGENLAVGY
Sbjct: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY 281

Query: 296 STT-GSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYVICS 354
            T   +V AWY EI DY +S+P++S STGHF+Q+VWK +  L            DY+ICS
Sbjct: 282 PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICS 341

Query: 355 YKTAGNFLGEFAEN 368
           Y  AGNFL  F EN
Sbjct: 342 YDPAGNFLRRFGEN 355

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  141 bits (356), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 65/136 (47%), Positives = 90/136 (66%), Gaps = 1/136 (0%)

Query: 233 NSDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLA 292
           + DF + IL  HN+ R  H+  S L W+ ELAS AQ++A+ Y C+G L HS  PYGENLA
Sbjct: 73  DPDFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLA 131

Query: 293 VGYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYVI 352
           +GY+TT +V AWY E+K YD++NP ++++TGHFTQ+VWK +S L             Y +
Sbjct: 132 LGYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTV 191

Query: 353 CSYKTAGNFLGEFAEN 368
           C Y   GN +G+F+EN
Sbjct: 192 CEYDPPGNVIGKFSEN 207

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  137 bits (346), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 66/138 (47%), Positives = 87/138 (63%), Gaps = 3/138 (2%)

Query: 234 SDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGG---PYGEN 290
           S++   +L  HN KR LHKDT  L W+D LA  AQ YAD+YDCSG+L+H+       GEN
Sbjct: 85  SEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGEN 144

Query: 291 LAVGYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDY 350
           LAVGY    ++DAWY EI+ YD+SNP +   T HFTQ+VWK +  +            +Y
Sbjct: 145 LAVGYDDIDAIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNY 204

Query: 351 VICSYKTAGNFLGEFAEN 368
           ++C Y  AGN+ GEFA+N
Sbjct: 205 IVCEYDPAGNWAGEFADN 222

>Kwal_14.2409
          Length = 238

 Score =  131 bits (329), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 62/133 (46%), Positives = 82/133 (61%), Gaps = 1/133 (0%)

Query: 236 FASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVGY 295
           F S +L+ HN  R LH D   L WS +L  +AQ YA+ Y+C+G+L HSG PYGENLA+G+
Sbjct: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161

Query: 296 STTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYVICSY 355
           +TT +  AWY E+K Y++  P +S  TGHFTQ+VWK S  L             Y ICSY
Sbjct: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSY 221

Query: 356 KTAGNFLGEFAEN 368
              GN  G++ +N
Sbjct: 222 DPPGNVAGQYQDN 234

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  125 bits (313), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 58/136 (42%), Positives = 83/136 (61%), Gaps = 1/136 (0%)

Query: 233 NSDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLA 292
           N+ FAS +L  HN+ R  H     L W+  L ++AQ YA++  C+GSL HSG P+GENLA
Sbjct: 68  NNTFASAVLDLHNDYRRRHHAV-PLRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLA 126

Query: 293 VGYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALXXXXXXXXXXXXDYVI 352
           +GYS   +V AWY EI +YD+S P +S +TGHFTQ+VW+ ++++             Y+I
Sbjct: 127 LGYSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYII 186

Query: 353 CSYKTAGNFLGEFAEN 368
           C Y   GN   ++  N
Sbjct: 187 CQYDPPGNVADQYVAN 202

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score = 91.7 bits (226), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 74/135 (54%), Gaps = 13/135 (9%)

Query: 239 TILKAHNNKRSLHKDTSDLSWSDELASYAQDY------ADKYDCSGSLSHSGGPYGENLA 292
           ++L AHN  R+ H+ T+ L W++ELA+YA DY      +D   C+  L HSGGPYGENLA
Sbjct: 300 SVLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSGGPYGENLA 359

Query: 293 VGYSTTGS--VDAWYGEIKDYDWSNPNYSS----STGHFTQVVWKGSSALXXXXXXXXXX 346
            G ++  +  V  WY EI  YD++N    S      GHFTQ+VW  S+ +          
Sbjct: 360 AGTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCSVTKCSSG 419

Query: 347 XXDYVICSYKTAGNF 361
              Y+IC Y  AGN 
Sbjct: 420 SV-YLICEYSPAGNV 433

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score = 91.7 bits (226), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 77/143 (53%), Gaps = 16/143 (11%)

Query: 235 DFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKY------DCSGSLSHSGGPYG 288
           + AS ++KAHN KR LH+DT  L W+++L+ +A  Y  +        C+  L HS GPYG
Sbjct: 269 NVASELVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHSNGPYG 328

Query: 289 ENLAVGYST-----TGSVDAWYGEIKDYDWSNPN----YSSSTGHFTQVVWKGSSALXXX 339
           EN+A G S+     T  V++WY EI+DYD+++ +       + GHFTQ+VW  S  +   
Sbjct: 329 ENIASGLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEVGCA 388

Query: 340 XXXXXXXXXD-YVICSYKTAGNF 361
                      Y++C Y   GN 
Sbjct: 389 VVYCSNNGKGIYILCEYHPVGNI 411

>Kwal_33.13192
          Length = 799

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 73/144 (50%), Gaps = 19/144 (13%)

Query: 237 ASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYD------CSGSLSHSGGP--YG 288
           AS IL+ HN KRSLH +T DL W D L+++A +YA+         CSG L HS      G
Sbjct: 632 ASAILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTRDNQG 691

Query: 289 ENLAVGYSTTGS--VDAWYGEIKDYDWSNPN----YSSSTGHFTQVVWK-----GSSALX 337
           EN+A G ++  +  VD WY EI DYD+ +           GHFTQ+VW      G + + 
Sbjct: 692 ENIAFGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGCAVVQ 751

Query: 338 XXXXXXXXXXXDYVICSYKTAGNF 361
                       Y++C YK AGN 
Sbjct: 752 CDTMAKYGQNSIYLLCEYKDAGNV 775

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.127    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,868,982
Number of extensions: 204821
Number of successful extensions: 424
Number of sequences better than 10.0: 19
Number of HSP's gapped: 406
Number of HSP's successfully gapped: 24
Length of query: 368
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 265
Effective length of database: 13,030,455
Effective search space: 3453070575
Effective search space used: 3453070575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 62 (28.5 bits)