Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.24092382368701e-119
KLLA0D02420g2121344515e-56
AAL178W2051344375e-54
CAGL0G07667g2581344303e-52
YJL079C (PRY1)2991304212e-50
YKR013W (PRY2)3291354101e-48
KLLA0D02442g3681344113e-48
Scas_711.372671364025e-48
Scas_675.272901354036e-48
YJL078C (PRY3)8811344111e-45
AAL179W3601353843e-44
Kwal_14.24103731343818e-44
Sklu_956.13191213725e-43
CAGL0F05137g2271373265e-37
KLLA0C01496g4561372316e-22
AFR700W4341402131e-19
Kwal_33.131927991611823e-15
AER164C64545625.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2409
         (236 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2409                                                          339   e-119
KLLA0D02420g complement(206544..207182) some similarities with s...   178   5e-56
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   172   5e-54
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   170   3e-52
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   166   2e-50
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   162   1e-48
KLLA0D02442g complement(207613..208719) some similarities with s...   162   3e-48
Scas_711.37                                                           159   5e-48
Scas_675.27                                                           159   6e-48
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   162   1e-45
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   152   3e-44
Kwal_14.2410                                                          151   8e-44
Sklu_956.1 YJL079C, Contig c956 998-1957                              147   5e-43
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   130   5e-37
KLLA0C01496g complement(113533..114903) some similarities with s...    94   6e-22
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...    87   1e-19
Kwal_33.13192                                                          75   3e-15
AER164C [2667] [Homologous to ScYJR130C (STR2) - SH; ScYML082W -...    28   5.7  

>Kwal_14.2409
          Length = 238

 Score =  339 bits (870), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 171/236 (72%), Positives = 171/236 (72%)

Query: 1   MTHFLIFWTVIFLIQHSNCIEISLIGDPVAITQNTIQXXXXXXXXXXXXXXXXXXXXXXX 60
           MTHFLIFWTVIFLIQHSNCIEISLIGDPVAITQNTIQ                       
Sbjct: 1   MTHFLIFWTVIFLIQHSNCIEISLIGDPVAITQNTIQSWVTTRVSVFRTRTVLSSSSKSS 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQSQMLETHNRFRDLHDA 120
                                                     FQSQMLETHNRFRDLHDA
Sbjct: 61  TSLSSGLSSRSSKSSAPSTVTCSPSTSYSSSSSSPTPSSSTSFQSQMLETHNRFRDLHDA 120

Query: 121 PALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGFNTTAAASAWYDEVKFYNYQ 180
           PALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGFNTTAAASAWYDEVKFYNYQ
Sbjct: 121 PALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGFNTTAAASAWYDEVKFYNYQ 180

Query: 181 KPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSYDPPGNVAGQYQDNVL 236
           KPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSYDPPGNVAGQYQDNVL
Sbjct: 181 KPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSYDPPGNVAGQYQDNVL 236

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  178 bits (451), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 99/134 (73%)

Query: 103 FQSQMLETHNRFRDLHDAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGFN 162
           F++++L+ HN  R  H   +L W+ +L   AQ +AN+Y CNG L HS  PYGENLALG+N
Sbjct: 76  FKTEILDVHNSLRKKHQVSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALGYN 135

Query: 163 TTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSYD 222
           TT+A  AWY+EVK Y++  P F+  TGHFTQLVWK++  LGCA I CG YYGQYT+C YD
Sbjct: 136 TTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCEYD 195

Query: 223 PPGNVAGQYQDNVL 236
           PPGNV G++ +NVL
Sbjct: 196 PPGNVIGKFSENVL 209

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  172 bits (437), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 95/134 (70%)

Query: 103 FQSQMLETHNRFRDLHDAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGFN 162
           F S +L+ HN +R  H A  LRW+S L   AQ YAN   CNG+L+HSG P+GENLALG++
Sbjct: 71  FASAVLDLHNDYRRRHHAVPLRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGYS 130

Query: 163 TTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSYD 222
             AA +AWYDE+  Y++  PGFS  TGHFTQLVW+S+  +GCA + CG  YG Y IC YD
Sbjct: 131 PAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQYD 190

Query: 223 PPGNVAGQYQDNVL 236
           PPGNVA QY  NVL
Sbjct: 191 PPGNVADQYVANVL 204

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  170 bits (430), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 92/134 (68%), Gaps = 1/134 (0%)

Query: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161
           F   ML  HN  R LH D   L WS +L  +AQ YANNY+C+G L+HSG PYGENLA+G+
Sbjct: 121 FAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIGY 180

Query: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSY 221
           +   +  AWYDE+K YNY  PGFSE TGHFTQ+VWKSS  +GCA   CG  +G Y ICSY
Sbjct: 181 SPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICSY 240

Query: 222 DPPGNVAGQYQDNV 235
           DP GN  G++  NV
Sbjct: 241 DPAGNFLGEFAQNV 254

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  166 bits (421), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 75/130 (57%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 107 MLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGFNTTA 165
           +L  HN+ R LH D PAL WS  L  +AQ YA+NY+C+GTL HSG PYGENLALG++  A
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225

Query: 166 AASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSYDPPG 225
           A  AWY+E+  Y++  PGFS  TGHFTQ+VWKS+  +GC    CG  +G Y ICSYDP G
Sbjct: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285

Query: 226 NVAGQYQDNV 235
           N  G+Y DNV
Sbjct: 286 NYEGEYADNV 295

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  162 bits (410), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 70/135 (51%), Positives = 91/135 (67%), Gaps = 1/135 (0%)

Query: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161
           F + M+  HN  R LH D  +L WS  L  +AQ YA++Y+C+G L+HSG PYGENLALG+
Sbjct: 192 FSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGY 251

Query: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSY 221
            TT +  AWY+E+  Y+Y  PGFSE  GHFTQ+VWK +  +GC    CG  +G Y ICSY
Sbjct: 252 GTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSY 311

Query: 222 DPPGNVAGQYQDNVL 236
              GNV G++ DNV+
Sbjct: 312 KAAGNVIGEFADNVM 326

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  162 bits (411), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 72/134 (53%), Positives = 92/134 (68%), Gaps = 1/134 (0%)

Query: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161
           F S ML+ HN  R LH D P L WS +L  +AQ YA++Y+C+G+L HSG PYGENLA+G+
Sbjct: 231 FASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGY 290

Query: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSY 221
            TT A  AWY E+K Y++  P +S  TGHFTQ+VWKS+  +GC    CG  +G Y ICSY
Sbjct: 291 GTTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSY 350

Query: 222 DPPGNVAGQYQDNV 235
           DP GN+ G +  NV
Sbjct: 351 DPAGNMLGTFASNV 364

>Scas_711.37
          Length = 267

 Score =  159 bits (402), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 93/136 (68%), Gaps = 2/136 (1%)

Query: 103 FQSQMLETHNRFRDLHDAPA-LRWSSDLQDFAQKYANN-YNCNGTLIHSGSPYGENLALG 160
           FQS +LE HN+ R LH+    L WS +L  +AQ YA+N YNC+G LIHSG PYGENLA G
Sbjct: 128 FQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAAG 187

Query: 161 FNTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICS 220
           +    +  AWY+E+  Y+Y  PGFSE TGHFTQLVWK +  +GCA   C + +G Y ICS
Sbjct: 188 YTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLICS 247

Query: 221 YDPPGNVAGQYQDNVL 236
           Y+  GN  G+Y+ NVL
Sbjct: 248 YNSAGNFDGEYEANVL 263

>Scas_675.27
          Length = 290

 Score =  159 bits (403), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 92/135 (68%), Gaps = 2/135 (1%)

Query: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161
           F S +L  HN  R LH + PAL WS DL  +AQ YA+ Y+C+G L+HSG PYGENLALG+
Sbjct: 152 FASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALGY 211

Query: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDC-GDYYGQYTICS 220
           +   +  AWY+E+  Y+Y  PGFSE  GHFTQ+VWKSS  +GC   DC    +G Y ICS
Sbjct: 212 DAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVICS 271

Query: 221 YDPPGNVAGQYQDNV 235
           Y+P GN  G++ +NV
Sbjct: 272 YNPAGNFIGEFAENV 286

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  162 bits (411), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 89/134 (66%), Gaps = 1/134 (0%)

Query: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161
           F+S +L  HN+FR LH D   L WS  L  +AQ YA+ Y+C+G L HS  PYGENLALG+
Sbjct: 25  FESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALGY 84

Query: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSY 221
             T A  AWY E+  YNY  PGFSE TGHFTQ+VWKS+  +GC    CG  +  Y +CSY
Sbjct: 85  TDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSY 144

Query: 222 DPPGNVAGQYQDNV 235
           +PPGN  G++ + V
Sbjct: 145 NPPGNYLGEFAEEV 158

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  152 bits (384), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 71/135 (52%), Positives = 89/135 (65%), Gaps = 2/135 (1%)

Query: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161
           F+ ++L  HN  R LH D   L WS +L  FA+ +AN Y+C+G L+HS SPYGENLA+G+
Sbjct: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY 281

Query: 162 NTT-AAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICS 220
            T   A  AWYDE+  Y+Y  P FS  TGHF+QLVWK + HLGCA   CG   G Y ICS
Sbjct: 282 PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICS 341

Query: 221 YDPPGNVAGQYQDNV 235
           YDP GN   ++ +NV
Sbjct: 342 YDPAGNFLRRFGENV 356

>Kwal_14.2410
          Length = 373

 Score =  151 bits (381), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 88/134 (65%), Gaps = 1/134 (0%)

Query: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161
           F S +L+ HN  R LH D   L WS +L  +AQ YA+ Y+C+G+L HSG PYGENLA+G+
Sbjct: 236 FASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVGY 295

Query: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSY 221
           +TT +  AWY E+K Y++  P +S  TGHFTQ+VWK S  LGC    CG   G Y ICSY
Sbjct: 296 STTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDYVICSY 355

Query: 222 DPPGNVAGQYQDNV 235
              GN  G++ +NV
Sbjct: 356 KTAGNFLGEFAENV 369

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  147 bits (372), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 85/121 (70%), Gaps = 1/121 (0%)

Query: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161
           F S +L+ HN+ R LH D  AL WS  L D+AQKYA++Y+C+G+L HSG PYGENLALG+
Sbjct: 172 FASSILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSGGPYGENLALGY 231

Query: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSY 221
           + T A  AWY E+  Y++  P +S  TGHFTQ+VWKS+  +GC    C + +G Y ICSY
Sbjct: 232 SATGAVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWGSYVICSY 291

Query: 222 D 222
           +
Sbjct: 292 N 292

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  130 bits (326), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 87/137 (63%), Gaps = 4/137 (2%)

Query: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGS---PYGENLA 158
           +Q +ML+ HN+ R+LH D  +L W+ +L   AQ YA+ Y+C+G L H+       GENLA
Sbjct: 87  WQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENLA 146

Query: 159 LGFNTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTI 218
           +G++   A  AWYDE++ Y+Y  P    +T HFTQLVWK + ++GCA   CG     Y +
Sbjct: 147 VGYDDIDAIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNYIV 206

Query: 219 CSYDPPGNVAGQYQDNV 235
           C YDP GN AG++ DNV
Sbjct: 207 CEYDPAGNWAGEFADNV 223

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score = 93.6 bits (231), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 72/137 (52%), Gaps = 14/137 (10%)

Query: 104 QSQMLETHNRFRDLHDAP-ALRWSSDLQDFAQKY------ANNYNCNGTLIHSGSPYGEN 156
           +  +L  HN +R  H +   L W+ +L  +A  Y      ++N  CN  L HSG PYGEN
Sbjct: 298 RESVLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSGGPYGEN 357

Query: 157 LALGFNTTAAA--SAWYDEVKFYNYQK-PGFSEK---TGHFTQLVWKSSIHLGCARIDCG 210
           LA G N+  AA    WYDE+ +Y+Y    G S      GHFTQLVW +S  +GC+   C 
Sbjct: 358 LAAGTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCSVTKCS 417

Query: 211 DYYGQYTICSYDPPGNV 227
                Y IC Y P GNV
Sbjct: 418 S-GSVYLICEYSPAGNV 433

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score = 86.7 bits (213), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 74/140 (52%), Gaps = 17/140 (12%)

Query: 105 SQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNY------NCNGTLIHSGSPYGENL 157
           S++++ HN  R LH D   L+W++ L DFA  Y +         C   L HS  PYGEN+
Sbjct: 272 SELVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHSNGPYGENI 331

Query: 158 ALGF-----NTTAAASAWYDEVKFYNYQK-PGF---SEKTGHFTQLVWKSSIHLGCARID 208
           A G      N T   ++WY+E++ Y+Y    G     +  GHFTQLVW  S  +GCA + 
Sbjct: 332 ASGLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEVGCAVVY 391

Query: 209 CGDY-YGQYTICSYDPPGNV 227
           C +   G Y +C Y P GN+
Sbjct: 392 CSNNGKGIYILCEYHPVGNI 411

>Kwal_33.13192
          Length = 799

 Score = 74.7 bits (182), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 79/161 (49%), Gaps = 29/161 (18%)

Query: 105 SQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYN------CNGTLIHSGSP--YGE 155
           S +L+ HN  R LH + P L W   L  +A  YAN+ +      C+G L HS +    GE
Sbjct: 633 SAILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTRDNQGE 692

Query: 156 NLALGF--NTTAAASAWYDEVKFYNYQK-PGF---SEKTGHFTQLVWKSSIHLGCARIDC 209
           N+A G   N       WYDE+  Y+Y    G     +  GHFTQ+VW S+  +GCA + C
Sbjct: 693 NIAFGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGCAVVQC 752

Query: 210 GDY--YGQ---YTICSYDPPGNV----AGQ-----YQDNVL 236
                YGQ   Y +C Y   GNV     GQ     +++NVL
Sbjct: 753 DTMAKYGQNSIYLLCEYKDAGNVYNGTPGQDEMSFFKENVL 793

>AER164C [2667] [Homologous to ScYJR130C (STR2) - SH; ScYML082W -
           SH] (944867..946804) [1938 bp, 645 aa]
          Length = 645

 Score = 28.5 bits (62), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 122 ALRWSSDLQDFAQK--YANNYNCNGTLIHSGSPYGENLALGFNTT 164
           A+R +   QD A    YA+ ++ NG L+  G PY + +  GF  T
Sbjct: 308 AVRVNRTRQDDASPSGYASPHSPNGALVGYGPPYKKTVMFGFPYT 352

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,291,904
Number of extensions: 234979
Number of successful extensions: 505
Number of sequences better than 10.0: 19
Number of HSP's gapped: 484
Number of HSP's successfully gapped: 20
Length of query: 236
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 138
Effective length of database: 13,203,545
Effective search space: 1822089210
Effective search space used: 1822089210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)