Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.23971206118958150.0
YJL080C (SCP160)1222121430030.0
AAL177W1198119928630.0
Scas_711.361219120028100.0
CAGL0M03223g1209117626960.0
KLLA0D02398g1205118625570.0
Kwal_27.124862991091025e-04
AER186C316105820.12
Sklu_2250.3320117810.18
Scas_515.634269741.2
Scas_706.381946179705.9
KLLA0E12309g383111686.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2397
         (1189 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2397                                                         2244   0.0  
YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein...  1161   0.0  
AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH] complement(...  1107   0.0  
Scas_711.36                                                          1087   0.0  
CAGL0M03223g complement(366828..370457) similar to sp|P06105 Sac...  1043   0.0  
KLLA0D02398g complement(202446..206063) similar to sp|P06105 Sac...   989   0.0  
Kwal_27.12486                                                          44   5e-04
AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH] (982057..98...    36   0.12 
Sklu_2250.3 YBL032W, Contig c2250 5501-6463 reverse complement         36   0.18 
Scas_515.6                                                             33   1.2  
Scas_706.38                                                            32   5.9  
KLLA0E12309g 1088810..1089961 some similarities with sp|P38199 S...    31   6.7  

>Kwal_14.2397
          Length = 1206

 Score = 2244 bits (5815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1118/1189 (94%), Positives = 1118/1189 (94%)

Query: 1    MSYPETESSASVVEQDSAIETPPTSVDATTEGNEVEAPVPEQAPKPLPSKKDFPTLGSGA 60
            MSYPETESSASVVEQDSAIETPPTSVDATTEGNEVEAPVPEQAPKPLPSKKDFPTLGSGA
Sbjct: 1    MSYPETESSASVVEQDSAIETPPTSVDATTEGNEVEAPVPEQAPKPLPSKKDFPTLGSGA 60

Query: 61   FLAAASKVSWGPNMKXXXXXXXXXXXXXXXXXXXXXXXTPALSAKPARSKTIQEAFSLDL 120
            FLAAASKVSWGPNMK                       TPALSAKPARSKTIQEAFSLDL
Sbjct: 61   FLAAASKVSWGPNMKTQTASSASGASSTSNSAVQSRSTTPALSAKPARSKTIQEAFSLDL 120

Query: 121  QSQISMSKPDFSRIIQGIKTTHXXXXXXXXXXXXRTFLIFGKPQDVKAARREIVKKLTKP 180
            QSQISMSKPDFSRIIQGIKTTH            RTFLIFGKPQDVKAARREIVKKLTKP
Sbjct: 121  QSQISMSKPDFSRIIQGIKTTHSVSVESTLSKSSRTFLIFGKPQDVKAARREIVKKLTKP 180

Query: 181  VTVTIEVPSKTRSAIIGAGGKKIREISEPLEVRIDIGKEIKEDTYDEDLDDSMVDVSIHG 240
            VTVTIEVPSKTRSAIIGAGGKKIREISEPLEVRIDIGKEIKEDTYDEDLDDSMVDVSIHG
Sbjct: 181  VTVTIEVPSKTRSAIIGAGGKKIREISEPLEVRIDIGKEIKEDTYDEDLDDSMVDVSIHG 240

Query: 241  DLESVRIAQQKISAIVKEDTKNASIQVNVEDKNLVPFINLEGLKLPVDAKFNTASGQIQL 300
            DLESVRIAQQKISAIVKEDTKNASIQVNVEDKNLVPFINLEGLKLPVDAKFNTASGQIQL
Sbjct: 241  DLESVRIAQQKISAIVKEDTKNASIQVNVEDKNLVPFINLEGLKLPVDAKFNTASGQIQL 300

Query: 301  SGLRDEVQAAKANILQYLRELSSQIKTLKVKIPVKFQFLIDESEIKEKFNVTVHLPTAGG 360
            SGLRDEVQAAKANILQYLRELSSQIKTLKVKIPVKFQFLIDESEIKEKFNVTVHLPTAGG
Sbjct: 301  SGLRDEVQAAKANILQYLRELSSQIKTLKVKIPVKFQFLIDESEIKEKFNVTVHLPTAGG 360

Query: 361  EEVSFVGPAVHLDEAVSFARENSKKYIVESLEISKAHGKNVAHAKNIAIYFEIYNVLEPI 420
            EEVSFVGPAVHLDEAVSFARENSKKYIVESLEISKAHGKNVAHAKNIAIYFEIYNVLEPI
Sbjct: 361  EEVSFVGPAVHLDEAVSFARENSKKYIVESLEISKAHGKNVAHAKNIAIYFEIYNVLEPI 420

Query: 421  KKAFPNVRFAIPSPQELQDADAVAIRISTTSENADDLKTVRKDIINLVNELPTSQVLVVE 480
            KKAFPNVRFAIPSPQELQDADAVAIRISTTSENADDLKTVRKDIINLVNELPTSQVLVVE
Sbjct: 421  KKAFPNVRFAIPSPQELQDADAVAIRISTTSENADDLKTVRKDIINLVNELPTSQVLVVE 480

Query: 481  DLDYELYSKDIKHLLLQQQQNADFVQLGDFFPGNDKILLFARLSDEDFRPSDDELKQTLA 540
            DLDYELYSKDIKHLLLQQQQNADFVQLGDFFPGNDKILLFARLSDEDFRPSDDELKQTLA
Sbjct: 481  DLDYELYSKDIKHLLLQQQQNADFVQLGDFFPGNDKILLFARLSDEDFRPSDDELKQTLA 540

Query: 541  DVNSALEPLRAKQSNLSLKIFEIPSEKQDAFFKPSTFTRELIEQDIATEGGHAQFKLHAP 600
            DVNSALEPLRAKQSNLSLKIFEIPSEKQDAFFKPSTFTRELIEQDIATEGGHAQFKLHAP
Sbjct: 541  DVNSALEPLRAKQSNLSLKIFEIPSEKQDAFFKPSTFTRELIEQDIATEGGHAQFKLHAP 600

Query: 601  TADQLTIRGDTKAVKVATAAIESIVANSGEKFETKFAVSSNSVPRLIGSKGANLNAIREK 660
            TADQLTIRGDTKAVKVATAAIESIVANSGEKFETKFAVSSNSVPRLIGSKGANLNAIREK
Sbjct: 601  TADQLTIRGDTKAVKVATAAIESIVANSGEKFETKFAVSSNSVPRLIGSKGANLNAIREK 660

Query: 661  YQCNIDVAQESSGNQTEVTVTGLKYSVEHAKAYLLSESKKWADVITKELNVLPKYRGRLI 720
            YQCNIDVAQESSGNQTEVTVTGLKYSVEHAKAYLLSESKKWADVITKELNVLPKYRGRLI
Sbjct: 661  YQCNIDVAQESSGNQTEVTVTGLKYSVEHAKAYLLSESKKWADVITKELNVLPKYRGRLI 720

Query: 721  GSQGTYRNRLQTKYSVHIHFPMEGENEGVTIRGPSRGVAKAYDELKALLDFEIENGHTSI 780
            GSQGTYRNRLQTKYSVHIHFPMEGENEGVTIRGPSRGVAKAYDELKALLDFEIENGHTSI
Sbjct: 721  GSQGTYRNRLQTKYSVHIHFPMEGENEGVTIRGPSRGVAKAYDELKALLDFEIENGHTSI 780

Query: 781  ITVPTEHVPRXXXXXXXXXXXXRADCGVELDFLQKTTDPKAVETGKVELEITGSRQAIKE 840
            ITVPTEHVPR            RADCGVELDFLQKTTDPKAVETGKVELEITGSRQAIKE
Sbjct: 781  ITVPTEHVPRIIGKNGDNINDIRADCGVELDFLQKTTDPKAVETGKVELEITGSRQAIKE 840

Query: 841  ATQKVEAIVKEASDVETESFEVNPKYIRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDA 900
            ATQKVEAIVKEASDVETESFEVNPKYIRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDA
Sbjct: 841  ATQKVEAIVKEASDVETESFEVNPKYIRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDA 900

Query: 901  NSQDKKITIQGPHAFVQTMVKEIKLIIKEREDSVEKELDVPADRVGALIGPGGMVRRQLE 960
            NSQDKKITIQGPHAFVQTMVKEIKLIIKEREDSVEKELDVPADRVGALIGPGGMVRRQLE
Sbjct: 901  NSQDKKITIQGPHAFVQTMVKEIKLIIKEREDSVEKELDVPADRVGALIGPGGMVRRQLE 960

Query: 961  SEFNIKLSLPDIGDKSSKVKILGLPDNIAACEKKIFTQLIRDSCDAEVQVPASLHEFVSE 1020
            SEFNIKLSLPDIGDKSSKVKILGLPDNIAACEKKIFTQLIRDSCDAEVQVPASLHEFVSE
Sbjct: 961  SEFNIKLSLPDIGDKSSKVKILGLPDNIAACEKKIFTQLIRDSCDAEVQVPASLHEFVSE 1020

Query: 1021 KGALIQRLRSDYFVNVRFGNSNGKANKLARSNLNIPVEKATGTAEESIKFTTEEIPLAIE 1080
            KGALIQRLRSDYFVNVRFGNSNGKANKLARSNLNIPVEKATGTAEESIKFTTEEIPLAIE
Sbjct: 1021 KGALIQRLRSDYFVNVRFGNSNGKANKLARSNLNIPVEKATGTAEESIKFTTEEIPLAIE 1080

Query: 1081 ESQGFIPWRLSYEPVDLSDILTXXXXXXXXXXXXXXXXXXXXXXXXDRIELATKASTVGY 1140
            ESQGFIPWRLSYEPVDLSDILT                        DRIELATKASTVGY
Sbjct: 1081 ESQGFIPWRLSYEPVDLSDILTEEEKANEKEPKKEEVLETVEKLIKDRIELATKASTVGY 1140

Query: 1141 LWSSKSSEFRKVVGSMGSNIKKIREATGTLINVPKKNDKVSDIIYIRGT 1189
            LWSSKSSEFRKVVGSMGSNIKKIREATGTLINVPKKNDKVSDIIYIRGT
Sbjct: 1141 LWSSKSSEFRKVVGSMGSNIKKIREATGTLINVPKKNDKVSDIIYIRGT 1189

>YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein
            involved in control of mitotic chromosome transmission,
            contains 14 KH domains which are found in RNA-binding
            proteins such as Mer1p and mouse hnRNP X [3669 bp, 1222
            aa]
          Length = 1222

 Score = 1161 bits (3003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/1214 (49%), Positives = 816/1214 (67%), Gaps = 49/1214 (4%)

Query: 14   EQDSAIETPPTSVDATTE----------------GNEVEAPVPEQAPKPLPSKKDFPTLG 57
            E+ +AI++PP++V+ + E                    E P  E+ P PLPS KD P+LG
Sbjct: 3    EEQTAIDSPPSTVEGSVETVTTIDSPSTTASTIAATAEEHPQLEKKPTPLPSLKDLPSLG 62

Query: 58   SGAFLAAASKVSWGPNMKXXXXXXXXXXXXXXXXXXXXXXXTPALSAKPARSKTIQEAFS 117
            S A  A   KVSWGPNMK                       T  L AK  RSK IQEAF+
Sbjct: 63   SNAAFANV-KVSWGPNMKPAVSNSPSPSPSAPSL-------TTGLGAKRMRSKNIQEAFT 114

Query: 118  LDLQSQISMSKPDFSRIIQGIKTTHXXXXXXXXXXXXRTFLIFGKPQDVKAARREIVKKL 177
            LDLQSQ+S++KP+ SRI+Q +K  H            RTFL+ G   +V  A+RE+VKKL
Sbjct: 115  LDLQSQLSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLVSGVAANVHEAKRELVKKL 174

Query: 178  TKPVTVTIEVPSKTRSAIIGAGGKKIREISEPLEVRIDIGKEIKEDTYDEDLDDSMVDVS 237
            TKP+   IEVPSK +++IIG+GG+ IREIS+  EV+I++ KE+ E++YDED+DD+  +VS
Sbjct: 175  TKPINAVIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNENSYDEDMDDTTSNVS 234

Query: 238  IHGDLESVRIAQQKISAIVKEDTKNASIQVNVEDKNLVPFINL------EGLKLPVDAKF 291
            + GD ESV +A+ KI AIVKE+TKNA+I++ VED+  +P+I++      EG +  V  +F
Sbjct: 235  LFGDFESVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEFASDEGDE-EVKVQF 293

Query: 292  NTASGQIQLSGLRDEVQAAKANILQYLRELSSQIKTLKVKIPVKFQFLIDESEIKEKFNV 351
               SG I + G R++ +A K +I  YL++L+S +   KVKIP KFQFLID  E+KEK+NV
Sbjct: 294  YKKSGDIVILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKFQFLIDAEELKEKYNV 353

Query: 352  TVHLPTAGGEE-VSFVGPAVHLDEAVSFARENSKKYIVESLEISKAHGKNVAHAKNIAIY 410
             V  P+   +E VSFVG    + EA+++AR +SK Y+VESL+ISKAH KN+ HAKN+ +Y
Sbjct: 354  IVTFPSTPDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISKAHSKNLTHAKNLIMY 413

Query: 411  FEIYNVLEPIKKAFPNVRFAIPSPQELQDADAVAIRISTTSENADDLKTVRKDIINLVNE 470
            F  Y+VL+ ++++ PNV+ ++PS Q L  A+ V I IS  S+ A+D+K VRK++I+ VN 
Sbjct: 414  FTKYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEANDIKAVRKELISFVNN 473

Query: 471  LPTSQVLVVEDLDYELYSKDIKHLLLQQQQNADFVQLGDFFPGNDKILLFARLSDEDFRP 530
            +P S+ LV+ DLDYEL+   IKH LL  + +  FVQ GD++P ++ ILL A   DEDF+P
Sbjct: 474  IPPSETLVITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDNSILLVALTEDEDFKP 533

Query: 531  SDDELKQTLADVNSALEPLRAKQSNLSLKIFEIPSEKQDAFFKPSTFTRELIEQDIATEG 590
            S +E++ +L   N +L  LR KQ+N+  K +E   E QD+ FKPS+ T +LI +DI+ + 
Sbjct: 534  SIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIMEDISEQE 593

Query: 591  GHAQFKLHAPTADQLTIRGDTKAVKVATAAIESIVANSGEKFETKFAVSSNSVPRLIGSK 650
            GH Q KLH P  +QLT+RGD KA K A    ESI+ +   K +    + +NSV RLIG+K
Sbjct: 594  GHLQIKLHTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVARLIGNK 653

Query: 651  GANLNAIREKYQCNIDVAQESSGNQT-----EVTVTGLKYSVEHAKAYLLSESKKWADVI 705
            G+NL  IREK+ C ID+  E + N +     EVT+TGL+Y++ HAK YL +E+KKWAD+I
Sbjct: 654  GSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWADII 713

Query: 706  TKELNVLPKYRGRLIGSQGTYRNRLQTKYSVHIHFPMEGENEGVTIRGPSRGVAKAYDEL 765
            TKEL V  K+ G LIG  GTYRNRLQ KY+V I+FP +  NE VTIRGPSRGV KA++EL
Sbjct: 714  TKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRD--NEIVTIRGPSRGVNKAHEEL 771

Query: 766  KALLDFEIENGHTSIITVPTEHVPRXXXXXXXXXXXXRADCGVELDFLQKTTDPKAVETG 825
            KALLDFE+ENGH  +I VP EHVPR            RA+ GVE+DFLQK+TDPKA ETG
Sbjct: 772  KALLDFEMENGHKMVINVPAEHVPRIIGKNGDNINDIRAEYGVEMDFLQKSTDPKAQETG 831

Query: 826  KVELEITGSRQAIKEATQKVEAIVKEASDVETESFEVNPKYIRDIVGAGGRVLKSLISKA 885
            +VELEITGSRQ IK+A ++VE+IV EASD  TE  +++ KY + IVG+GG +L+ +ISKA
Sbjct: 832  EVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREIISKA 891

Query: 886  GGDEIRNKSVDIPDANSQDKKITIQGPHAFVQTMVKEIKLIIKEREDSVEKELDVPADRV 945
            GG+EIRNKSVDIP+A+S++K IT+QGP  FV+ +V+EI  I+K+ E+SV K +D+PA+R 
Sbjct: 892  GGEEIRNKSVDIPNADSENKDITVQGPQKFVKKVVEEINKIVKDAENSVTKTIDIPAERK 951

Query: 946  GALIGPGGMVRRQLESEFNIKLSLPDIGDKSSKVKILGLPDNIAACEKKIFTQLIRDSCD 1005
            GALIGPGG+VRRQLESEFNI L +P+  D S K+ I G P+N+   EKKI  ++IR++ D
Sbjct: 952  GALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAEKKILNEIIRENFD 1011

Query: 1006 AEVQVPASLHEFVSEKGALIQRLRSDYFVNVRFGNSNGKANKLARSNLNIPVEKATGTAE 1065
             EV VPAS++E+VSE+GA IQ+LR D  VNVRFGN++ KANKLAR+ + IP+EK  G+ E
Sbjct: 1012 REVDVPASIYEYVSERGAFIQKLRMDLSVNVRFGNTSKKANKLARAPIEIPLEKVCGSTE 1071

Query: 1066 ----ESIKFTTEEIPLAIEESQGFIPWRLSYEPVDLSDILT------XXXXXXXXXXXXX 1115
                E  KFT EE+       +G I  RL+YEP+DLS IL+                   
Sbjct: 1072 GENAEKTKFTIEEVGAPTSSEEGDITMRLTYEPIDLSSILSDGEEKEVTKDTSNDSAKKE 1131

Query: 1116 XXXXXXXXXXXDRIELATKASTVGYLWSSKSSEFRKVVGSMGSNIKKIREATGTLINVPK 1175
                       +RI  A  A+  GY+W + +  F  +VG  GSNIKKIREA   +INVP+
Sbjct: 1132 EALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIKKIREAADVIINVPR 1191

Query: 1176 KNDKVSDIIYIRGT 1189
            K+DKV+D++YIRGT
Sbjct: 1192 KSDKVNDVVYIRGT 1205

>AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH]
            complement(27774..31370) [3597 bp, 1198 aa]
          Length = 1198

 Score = 1107 bits (2863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/1199 (50%), Positives = 791/1199 (65%), Gaps = 35/1199 (2%)

Query: 7    ESSASVVE--QDSAIETPPTSVDA-------TTEGNEVEAP--VPEQAPKPLPSKKDFPT 55
            ES A+V E      IETPPT+ ++       T  G E E        APK +P++ DFP 
Sbjct: 2    ESQAAVEEPQHSVVIETPPTTAESSETPVADTATGAEPEGAGGAAVVAPKRMPTRADFPP 61

Query: 56   LGSGAFLAAASKVSWGPNMKXXXXXXXXXXXXXXXXXXXXXXXTPALSAKPARSKTIQEA 115
            L S  F     KV WGPNMK                            AKP RSKT+QEA
Sbjct: 62   LSSVIF--ETQKVQWGPNMKKPESQSASPSPSPGPV---------GSGAKPMRSKTMQEA 110

Query: 116  FSLDLQSQISMSKPDFSRIIQGIKTTHXXXXXXXXXXXXRTFLIFGKPQDVKAARREIVK 175
            FSLDLQ+Q+++SK +FS+ +  +K +H            RTFLI G P +V  A+RE+VK
Sbjct: 111  FSLDLQTQVTISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAKRELVK 170

Query: 176  KLTKPVTVTIEVPSKTRSAIIGAGGKKIREISEPLE-VRIDIGKEIKEDTYDEDLDDSMV 234
            KLT+PVTV I+VPSKT S+IIG GG+ IREI+     ++IDI K  + D YD DLDD ++
Sbjct: 171  KLTRPVTVVIQVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTAEADAYDADLDDQLI 230

Query: 235  DVSIHGDLESVRIAQQKISAIVKEDTKNASIQVNVEDKNLVPFINLEGLKLPVDAK---F 291
            ++S+HGD+ SV  A+ KI +IVKE+TKNA+I V VE+K L+PFI+L  +++  D     F
Sbjct: 231  NISLHGDVASVNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADVEISEDVTVKAF 290

Query: 292  NTASGQIQLSGLRDEVQAAKANILQYLRELSSQIKTLKVKIPVKFQFLIDESEIKEKFNV 351
               S +I L G RDE + AK N+  YL  L+S++   K+ IP KFQ LID  +++EK+ V
Sbjct: 291  PNGSEKIVLMGPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLIDAEDVREKYKV 350

Query: 352  TVHLPTAGGEE-VSFVGPAVHLDEAVSFARENSKKYIVESLEISKAHGKNVAHAKNIAIY 410
            +V  PTA G++ VSF G + +LD+A+++AR++SK+YIVESLE+SKAHGKNVAHAKN+  Y
Sbjct: 351  SVIFPTALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAHAKNLMFY 410

Query: 411  FEIYNVLEPIKKAFPNVRFAIPSPQELQDADAVAIRISTTSENADDLKTVRKDIINLVNE 470
            F  Y++L+ IK++F  V+  +P+P+EL   D V+I I + ++ A+  KTVRK IIN+VN 
Sbjct: 411  FAKYDILKDIKESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQIINIVNR 470

Query: 471  LPTSQVLVVEDLDYELYSKDIKHLLLQQQQNADFVQLGDFFPGNDKILLFARLSDEDFRP 530
            L  S VL V+DLDYEL+ KDIK  L + +    FVQLGD + G++ +LLFA++ +EDF+P
Sbjct: 471  LTPSHVLAVDDLDYELFHKDIKQALSKAE--IPFVQLGDHYEGDNTVLLFAKVDEEDFQP 528

Query: 531  SDDELKQTLADVNSALEPLRAKQSNLSLKIFEIPSEKQDAFFKPSTFTRELIEQDIATEG 590
            S +E+K+ L  V + L+ +R KQS L  KI    +E Q   F   + T  L+ ++I + G
Sbjct: 529  SPEEVKEHLEKVAAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWNLVLENITSAG 588

Query: 591  GHAQFKLHAPTADQLTIRGDTKAVKVATAAIESIVANSGEKFETKFAVSSNSVPRLIGSK 650
            GHAQ KLH P+ D++TIRGD KAVK A  A ESI  N  +K +   +V +N+V RLIG K
Sbjct: 589  GHAQIKLHTPSEDEITIRGDEKAVKAAVKAFESIAENPSKKSKLTVSVPANTVSRLIGPK 648

Query: 651  GANLNAIREKYQCNIDVAQESSGNQTEVTVTGLKYSVEHAKAYLLSESKKWADVITKELN 710
            G NL  IR+K+   IDV  ES+   TE+T+TGL+Y+++HAK ++ SE+KKWAD+ TKEL 
Sbjct: 649  GTNLAQIRQKFDVQIDVPSESNDTNTEITLTGLEYNLQHAKTHIASEAKKWADITTKELI 708

Query: 711  VLPKYRGRLIGSQGTYRNRLQTKYSVHIHFPMEGENEGVTIRGPSRGVAKAYDELKALLD 770
            V  KY G LIGSQGTYR RL+ KYSV I FP EGE   VTI+GPSRGV KA+ ELKALLD
Sbjct: 709  VPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGE--VVTIKGPSRGVNKAHAELKALLD 766

Query: 771  FEIENGHTSIITVPTEHVPRXXXXXXXXXXXXRADCGVELDFLQKTTDPKAVETGKVELE 830
            FEIENGH S+I VP EHVPR            RA+ GVEL  LQ T   K      V+LE
Sbjct: 767  FEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLDTVQLE 826

Query: 831  ITGSRQAIKEATQKVEAIVKEASDVETESFEVNPKYIRDIVGAGGRVLKSLISKAGGDEI 890
            ITGSRQAIKEA++ V+AI+ EASD  T+  E++ KY + IVG GG  LK  ISKAGGD+I
Sbjct: 827  ITGSRQAIKEASKAVDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFISKAGGDDI 886

Query: 891  RNKSVDIPDANSQDKKITIQGPHAFVQTMVKEIKLIIKEREDSVEKELDVPADRVGALIG 950
            RNK+VD+P+A S +K ITI GP  FV+ M K +  I+++ + SV KEL++PADR GALIG
Sbjct: 887  RNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIKASVAKELNIPADRQGALIG 946

Query: 951  PGGMVRRQLESEFNIKLSLPDIGDKSSKVKILGLPDNIAACEKKIFTQLIRDSCDAEVQV 1010
            PGG VRRQLES+FN+++ +PD G K  KV I G P+ +  CEK+IF+ +IRDS D E+ V
Sbjct: 947  PGGSVRRQLESQFNVRIEVPDKG-KEGKVTIHGRPEAVEKCEKEIFSTIIRDSYDQEIMV 1005

Query: 1011 PASLHEFVSEKGALIQRLRSDYFVNVRFGNSNGKANKLARSNLNIPVEKATGTAEESIKF 1070
            PA  H FVSE+G LI +LR  YF+NV+ GNS+ KANKL+RS   IP+E+  G+  E  K 
Sbjct: 1006 PAVYHAFVSERGQLINKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERVRGSEGEGTKL 1065

Query: 1071 TTEEIPLAIEESQGFIPWRLSYEPVDLSDILTXXXXXXXXXXXXXXXXXXXXXXXXDRIE 1130
            T EE+      +   IPWRL+YE VDLSDIL                         +RIE
Sbjct: 1066 TIEEVSAPEASANDNIPWRLTYEHVDLSDIL---GEEGKHAMTKEQALEAAADQIKERIE 1122

Query: 1131 LATKASTVGYLWSSKSSEFRKVVGSMGSNIKKIREATGTLINVPKKNDKVSDIIYIRGT 1189
            LA KA+ +GYLW     +F KVVG  GSNIK+IRE T TLINVPKK+DKVSDIIY+RGT
Sbjct: 1123 LAPKANCIGYLWCENVKKFNKVVGPGGSNIKQIRETTNTLINVPKKSDKVSDIIYVRGT 1181

>Scas_711.36
          Length = 1219

 Score = 1087 bits (2810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/1200 (47%), Positives = 790/1200 (65%), Gaps = 40/1200 (3%)

Query: 11   SVVEQDSAIETPPTSVDATTEGNEVEAPVPEQAPKPLPSKKDFPTLGSGAFLAAASKVSW 70
            SV E D+ +ET  T+ +  +E    E P P   P PLPS KD P+LGS +  A  SKV+W
Sbjct: 22   SVSETDNGVETAVTTEETASE----EKPAP--VPVPLPSLKDLPSLGSNSIFAN-SKVTW 74

Query: 71   GPNMKXXXXXXXXXXXXXXXXXXXXXXXTPALSAKPARSKTIQEAFSLDLQSQISMSKPD 130
            GPNM+                            AK  RSK IQE+F+LDLQSQ+S++KP+
Sbjct: 75   GPNMQPSPPISCSPSLSSSLSPSP------VSGAKRMRSKNIQESFTLDLQSQLSITKPE 128

Query: 131  FSRIIQGIKTTHXXXXXXXXXXXXRTFLIFGKPQDVKAARREIVKKLTKPVTVTIEVPSK 190
             SRI+Q +K  +            RTFLI G    V+ A+R++VK+LT+P+   + VP++
Sbjct: 129  LSRIVQSVKQAYNVSVESTLSKNSRTFLISGVATKVQDAKRDLVKQLTRPIDDVMTVPAR 188

Query: 191  TRSAIIGAGGKKIREISEPLEVRIDIGKEIKEDTYDEDLDDSMVDVSIHGDLESVRIAQQ 250
             R+AIIG+GGK IR ISE  +V I++ +E   D+YDEDL+D   +V+ HGD ESV +A++
Sbjct: 189  CRAAIIGSGGKTIRGISEQYDVTINLARENNPDSYDEDLNDFTANVNFHGDFESVNMAKR 248

Query: 251  KISAIVKEDTKNASIQVNVEDKNLVPFINLEGLKLP--VDAKFNTASGQIQLSGLRDEVQ 308
            +I  IVKE+TK  S++V V+D+ ++PFI+L  + +P  V   F   + ++ +SG RD+V+
Sbjct: 249  RIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAITVPEGVKCNFYRDTAEVNISGPRDDVK 308

Query: 309  AAKANILQYLRELSSQIKTLKVKIPVKFQFLIDESEIKEKFNVTVHLPTAGGEE-VSFVG 367
            A K  +  YL +LSS +   K+KIP KFQFLID   +K++FNV V  P+   +E VSFVG
Sbjct: 309  ATKTGVQDYLNQLSSTLTEEKIKIPTKFQFLIDTKALKKEFNVIVTFPSDPTDELVSFVG 368

Query: 368  PAVHLDEAVSFARENSKKYIVESLEISKAHGKNVAHAKNIAIYFEIYNVLEPIKKAFPNV 427
                + EA++FAR NSK + V+SL+ISK+H KN+AHAKN+A+YF  Y  L+ IK+A+P V
Sbjct: 369  QKDKVTEAIAFARANSKTFTVDSLDISKSHSKNLAHAKNLALYFTKYPALKDIKEAYPEV 428

Query: 428  RFAIPSPQELQDADAVAIRISTTSENADDLKTVRKDIINLVNELPTSQVLVVEDLDYELY 487
            +  +P+P  L+DA +V I IS  SE+A+++K  RK++IN VN +     L + DLDYEL+
Sbjct: 429  KIVLPAPSLLKDAASVVINISAKSESANEIKFARKELINFVNTITPLDTLTITDLDYELF 488

Query: 488  SKDIKHLLLQQQQNADFVQLGDFFPGNDKILLFARLSDEDFRPSDDELKQTLADVNSALE 547
             K IK  LL  +    F+QLGD+FPGND I+LF    +EDF+PS +E+   L  VN++LE
Sbjct: 489  HKSIKSTLLATEDKVPFIQLGDYFPGNDSIVLFYSSPEEDFKPSAEEINAELEKVNASLE 548

Query: 548  PLRAKQSNLSLKIFEIPSEKQDAFFKPSTFTRELIEQDIATEGGHAQFKLHAPTADQLTI 607
            PLRAK + ++ K++ + ++ QD    PS+ T  LI +D++ E G+ Q KLH P A+++TI
Sbjct: 549  PLRAKLNKMTNKVYTLDAKIQDDLLSPSSATLHLILEDVSKEEGNLQIKLHTPEANKVTI 608

Query: 608  RGDTKAVKVATAAIESIVANSGEKFETKFAVSSNSVPRLIGSKGANLNAIREKYQCNIDV 667
            RGD KAVK A  A+ SIV N  +K +    V+SNS+ RL+G+KG+NLN IREK+ C IDV
Sbjct: 609  RGDDKAVKTANKALTSIVENPTKKSKITVEVASNSIARLVGTKGSNLNEIREKFDCQIDV 668

Query: 668  AQ--ESSGNQTEVTVTGLKYSVEHAKAYLLSESKKWADVITKELNVLPKYRGRLIGSQGT 725
                E      E+ +TG +Y++E AK ++ +E+KKWAD++TKEL V  KY G LIG+ G 
Sbjct: 669  PNHDEIKDKTAEIVLTGQEYNLEQAKKFIAAEAKKWADIVTKELVVPQKYHGSLIGANGV 728

Query: 726  YRNRLQTKYSVHIHFPMEGENEGVTIRGPSRGVAKAYDELKALLDFEIENGHTSIITVPT 785
            YRNRLQ KYSV I+FP   +++ VTIRGPSRGV +A+ EL ALLDFE ENG+  I+ VP 
Sbjct: 729  YRNRLQDKYSVFINFPR--DSDIVTIRGPSRGVKQAFTELSALLDFERENGYKKIVVVPA 786

Query: 786  EHVPRXXXXXXXXXXXXRADCGVELDFLQKTTDPKAVETGKVELEITGSRQAIKEATQKV 845
            EHVPR            RAD GVE+DFLQK+TDPK  ETG+VELEITG+R AI EA  KV
Sbjct: 787  EHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKVQETGEVELEITGTRAAINEAANKV 846

Query: 846  EAIVKEASDVETESFEVNPKYIRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDANSQDK 905
            + I+ EA+D ++E+  V  KY R IVG+GG  L+ +ISKAGGD+IRNK++DIP+ANS+  
Sbjct: 847  QEIIDEAADFDSETLSVARKYHRIIVGSGGHNLRDIISKAGGDDIRNKNIDIPNANSESD 906

Query: 906  KITIQGPHAFVQTMVKEIKLIIKEREDSVEKELDVPADRVGALIGPGGMVRRQLESEFNI 965
             IT+QGP  FV +++K+I  I+++ E+SV K L++P +R GAL+GPGGM+RRQLE+EFN+
Sbjct: 907  VITVQGPKKFVASVLKQINKIVEDGENSVTKTLEIPEERHGALVGPGGMIRRQLETEFNV 966

Query: 966  KLSLPDIGDKSSKVKILGLPDNIAACEKKIFTQLIRDSCDAEVQVPASLHEFVSEKGALI 1025
             L +P   +++  V+I GLP+N+   EKKI T+++RDS D E+ VPASLHEFVSE+GA  
Sbjct: 967  ILEVPH-KNETGPVRITGLPENVEKAEKKILTEIVRDSFDRELSVPASLHEFVSERGAFT 1025

Query: 1026 QRLRSDYFVNVRFGNSNGKANKLARSNLNIPVEKATGTAEESIKFTTEEIPLAIEE---- 1081
            Q+LR + FVNV+ GN++ +A +L RSN+ IPVEK     E+  K   E+    IEE    
Sbjct: 1026 QKLRIEEFVNVKHGNASRRATRLNRSNVVIPVEKVRPATEDEKK---EQFRAVIEEVGEP 1082

Query: 1082 ----SQGFIPWRLSYEPVDLSDILTXXXXXXXXXX--------XXXXXXXXXXXXXXDRI 1129
                  G IPWRL+YEP+D S++L+                                DR+
Sbjct: 1083 RNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEATPKVEIDEAKKEETLNKVVKMIEDRV 1142

Query: 1130 ELATKASTVGYLWSSKSSEFRKVVGSMGSNIKKIREATGTLINVPKKNDKVSDIIYIRGT 1189
              A  ++  GY+W +   +F KVVG  GSNIKKIR+A   +INVP+++DKV+D+IY+RGT
Sbjct: 1143 AKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIRDAADVIINVPRRSDKVNDVIYVRGT 1202

>CAGL0M03223g complement(366828..370457) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy, hypothetical start
          Length = 1209

 Score = 1043 bits (2696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/1176 (46%), Positives = 776/1176 (65%), Gaps = 23/1176 (1%)

Query: 24   TSVDATTEGNEVE-APVPEQAPKPLPSKKDFPTLGSGAFLAAASKVSWGPNMKXXXXXXX 82
            T+ D+  E   VE AP PE  PKPLPS KD P+L        A+KV WGPNMK       
Sbjct: 28   TTFDSDEESKPVEEAPKPE--PKPLPSLKDLPSLVDSNSFKPATKVEWGPNMKPAAISSS 85

Query: 83   XXXXXXXXXXXXXXXXTPALSAKPARSKTIQEAFSLDLQSQISMSKPDFSRIIQGIKTTH 142
                              A SA   RS  IQE F+LDLQSQ+S++K + SRI+Q +K  +
Sbjct: 86   VSPSMSRSAS--------ATSAGRMRSNNIQETFTLDLQSQLSVTKLELSRILQTVKQAN 137

Query: 143  XXXXXXXXXXXXRTFLIFGKPQDVKAARREIVKKLTKPVTVTIEVPSKTRSAIIGAGGKK 202
                        RTFLI G    VK A+RE++K LT+P+T  IEVPS+ ++ IIG+GGK 
Sbjct: 138  NVSVESTLSRNSRTFLISGPAPKVKEAKRELIKMLTRPITENIEVPSRCKAVIIGSGGKN 197

Query: 203  IREISEPLEVRIDIGKEIKEDTYDEDLDDSMVDVSIHGDLESVRIAQQKISAIVKEDTKN 262
            IREIS+  +V+I I KE K D+Y+EDLDD + D+SI GD ESV+ A+ KI +IV ED KN
Sbjct: 198  IREISDRYDVKIHISKEPKPDSYNEDLDDDLSDISIFGDFESVKQAKAKILSIVNEDLKN 257

Query: 263  ASIQVNVEDKNLVPFINLEGLKLP-VDAKFNTASGQIQLSGLRDEVQAAKANILQYLREL 321
             + +++VED  L  F+N++ +    V  ++   +G   ++G  D+++ AK  I  YL++L
Sbjct: 258  ITARLSVEDSTLGSFVNVKEVSSDDVKVQYYQDTGSFTITGSLDDIKNAKTKIKDYLQKL 317

Query: 322  SSQIKTLKVKIPVKFQFLIDESEIKEKFNVTVHLPTAGGEE-VSFVGPAVHLDEAVSFAR 380
            S+++    VKIP KFQFLID  E+K++F V V  P +  +E V F G    + EA+SFAR
Sbjct: 318  SNELAEENVKIPSKFQFLIDADEVKDRFGVIVKFPKSSSDETVQFAGLKDKVAEAISFAR 377

Query: 381  ENSKKYIVESLEISKAHGKNVAHAKNIAIYFEIYNVLEPIKKAFPNVRFAIPSPQELQDA 440
             +SK+YIV+SL+ISKAH KN+ HAK + IYF+ YNVL+ + + FP+V++ +PS ++LQ+A
Sbjct: 378  TSSKQYIVDSLDISKAHNKNLDHAKRLVIYFQKYNVLDKVAEEFPDVKYVLPSIEDLQNA 437

Query: 441  DAVAIRISTTSENADDLKTVRKDIINLVNELPTSQVLVVEDLDYELYSKDIKHLLLQQQQ 500
              V I +S  ++   ++K  R++II +VN++  ++ LV++DLDYEL+ ++IKH+LL  + 
Sbjct: 438  KEVFIYLSAKNDKTSEIKAARREIIAIVNDITPAETLVIDDLDYELFHRNIKHILLGHES 497

Query: 501  NADFVQLGDFFPGNDKILLFARLSDEDFRPSDDELKQTLADVNSALEPLRAKQSNLSLKI 560
             A F+Q+GD+F G+D ++LFA  +DEDF+PS DE+K++L  VN+ L  LR KQ++L +  
Sbjct: 498  EAKFIQIGDYFKGDDSVVLFATSTDEDFKPSTDEIKESLEKVNANLNDLRKKQNSLEVAT 557

Query: 561  FEIPSEKQDAFFKPSTFTRELIEQDIATEGGHAQFKLHAPTADQLTIRGDTKAVKVATAA 620
            +++ SEKQD FF   +   +LI +DI+ + GH Q KLH+P  +++T+RGD +AVK A   
Sbjct: 558  YDLESEKQDEFFGKDSVALKLILEDISGDDGHIQIKLHSPEKNKMTLRGDERAVKKANKD 617

Query: 621  IESIVANSGEKFETKFAVSSNSVPRLIGSKGANLNAIREKYQCNIDVAQESSGNQ---TE 677
            I+SIV N     +    V   SV RLIG+KGANL  +R KY C+ID+ Q+   +Q    E
Sbjct: 618  IKSIVENPSTTAKITVEVPVASVSRLIGNKGANLQKLRNKYNCSIDIPQQGESDQDKTVE 677

Query: 678  VTVTGLKYSVEHAKAYLLSESKKWADVITKELNVLPKYRGRLIGSQGTYRNRLQTKYSVH 737
            +T+ GL++ +EHAK  + +E+K+ AD++TKEL    KY   L G QG YR RLQ KY+V 
Sbjct: 678  ITIKGLQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVF 737

Query: 738  IHFPMEGENEGVTIRGPSRGVAKAYDELKALLDFEIENGHTSIITVPTEHVPRXXXXXXX 797
            I+F  E  N  +TI+GPSRGV KAYDELKALLDFE+ENGH +I+ VP EH+ R       
Sbjct: 738  INFLKE--NNTITIKGPSRGVNKAYDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGD 795

Query: 798  XXXXXRADCGVELDFLQKTTDPKAVETGKVELEITGSRQAIKEATQKVEAIVKEASDVET 857
                   + GVELDFLQK+ DPKAVETG VELEITG+R AIKEA+ K+ AIV EA+D  T
Sbjct: 796  TINGLSDEFGVELDFLQKSDDPKAVETGVVELEITGNRNAIKEASTKIAAIVSEAADHVT 855

Query: 858  ESFEVNPKYIRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDANSQDKKITIQGPHAFVQ 917
            E  +++ KY + IVGAGG  L+ +IS AGGDE+R ++VDIP+A+S+   ITIQGP  FV 
Sbjct: 856  EKLDIDRKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIPNADSESSIITIQGPKKFVS 915

Query: 918  TMVKEIKLIIKEREDSVEKELDVPADRVGALIGPGGMVRRQLESEFNIKLSLPDIGDKSS 977
             +VK I  I++E ++S+ K+++VP +R+GALIGPGG+VR+QLESEFNI+L +P   ++ +
Sbjct: 916  NVVKAINKIVEESQNSITKKIEVPGERLGALIGPGGIVRKQLESEFNIQLYVPKRDEEET 975

Query: 978  KVKILGLPDNIAACEKKIFTQLIRDSCDAEVQVPASLHEFVSEKGALIQRLRSDYFVNVR 1037
            +V + GLP+NI   EKKIFT++IRD+ D E+ VPA++  +VS++G L QRLR + FVNVR
Sbjct: 976  RVSLTGLPENIEKAEKKIFTEIIRDNFDLEIMVPANVQNYVSDRGNLPQRLRLEKFVNVR 1035

Query: 1038 FGNSNGKANKLARSNLNIPVEKATGTAEESIKFTTEEI-PLAIEESQGFIPWRLSYEPVD 1096
            +GN+  KAN L R+ ++IP EK  G   E +KFT EE  P  +E   G IPWRL YEP+D
Sbjct: 1036 YGNATKKANNLNRTPVDIPYEKVAGAEGEKVKFTVEETGPSVVENVDGEIPWRLIYEPID 1095

Query: 1097 LSDILTXXXXXXXXXXXXXXXXXXXXXXXX----DRIELATKASTVGYLWSSKSSEFRKV 1152
               IL                             +RI  A  A+  GY+W+S  S+F KV
Sbjct: 1096 FDSILDEENGEKKEASVDENKKQQLLKEAKEIIENRINDAPNATYSGYVWTSDPSKFFKV 1155

Query: 1153 VGSMGSNIKKIREATGTLINVPKKNDKVSDIIYIRG 1188
            VG  GSN+KKIRE+T  ++ VPKK+DK++++I+I+G
Sbjct: 1156 VGMGGSNVKKIRESTNCIVYVPKKSDKINNVIFIKG 1191

>KLLA0D02398g complement(202446..206063) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy singleton, start by
            similarity
          Length = 1205

 Score =  989 bits (2557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/1186 (45%), Positives = 752/1186 (63%), Gaps = 28/1186 (2%)

Query: 19   IETPPTSVDATTE--GNEVEAPVP---EQAPKPLPSKKDFPTLGSGAFLAAASK-VSWGP 72
            ++TPP+S D +++  G  +E       E+A      K  FP LG  A  +A+   VSWG 
Sbjct: 17   VDTPPSSADDSSKLAGQTIEQTEKSNGEEAATAPAVKVLFPRLGGNAAASASGNAVSWGS 76

Query: 73   NMKXXXXXXXXXXXXXXXXXXXXXXXTPALSAKPARSKTIQEAFSLDLQSQISMSKPDFS 132
             +K                       +P  SAKP RS+ IQE FSLDL +Q  ++K +FS
Sbjct: 77   TLKSGSSVNSVSSLSHGKNGRAS---SPG-SAKPLRSRNIQEVFSLDLDAQYQITKTEFS 132

Query: 133  RIIQGIKTTHXXXXXXXXXXXXRTFLIFGKPQDVKAARREIVKKLTKPVTVTIEVPSKTR 192
             I+Q +K  +            RTFLI G    +  A+RE+VKKLTKPV VT EVPSKTR
Sbjct: 133  SIVQSVKQKYDVSVESTLSKTSRTFLISGSSDKIGLAKRELVKKLTKPVNVTFEVPSKTR 192

Query: 193  SAIIGAGGKKIREISEPLEVRIDIGKEIKEDTYDEDLDDSMVDVSIHGDLESVRIAQQKI 252
            SAIIG+GGK IR IS+   V+I + KE+ E TYD DL+D  V +S+HGD ESV +A+ KI
Sbjct: 193  SAIIGSGGKTIRAISDAAGVKIVVPKEVDEGTYDSDLEDYSVTISLHGDAESVLVAKSKI 252

Query: 253  SAIVKEDTKNASIQVNVEDKNLVPFINLEGLKLPVDAK----FNTASGQIQLSGLRDEVQ 308
              +VKE+TKNA I + VED  LVPFI+LE +++P D K     N    +I L+G RD V+
Sbjct: 253  LDVVKEETKNAKIVLPVEDSKLVPFIDLESVEIPADVKAQLFTNNDPAEIALNGPRDNVK 312

Query: 309  AAKANILQYLRELSSQIKTLKVKIPVKFQFLIDESEIKEKFNVTVHLPT-AGGEEVSFVG 367
             AK  ++ YL EL  +I   K K+P KF  L+  SE+ EKF+V V  P+ +G ++  F+G
Sbjct: 313  LAKVKVINYLNELGLKIVVKKEKVPFKFHPLVKPSELNEKFHVEVQAPSISGDDQFVFIG 372

Query: 368  PAVHLDEAVSFARENSKKYIVESLEISKAHGKNVAHAKNIAIYFEIYNVLEPIKKAFPNV 427
             + +++EA+ +A+ +SK + VESLEISKAHGKNV HAKN+ +YF+ YNVL+ I + FP V
Sbjct: 373  SSDNVNEAIVYAKNSSKFHTVESLEISKAHGKNVKHAKNLILYFQKYNVLDQITEDFPQV 432

Query: 428  RFAIPSPQELQDADAVAIRISTTSENADDLKTVRKDIINLVNELPTSQVLVVEDLDYELY 487
            +  +P  + +   ++V+I + + ++ AD +KTVRK I+ LVNEL   Q L + DLDY L+
Sbjct: 433  QVVLPKVESIPALESVSITLISNNDAADAIKTVRKQIVALVNELSPEQTLTISDLDYHLF 492

Query: 488  SKDIKHLLLQQQQNADFVQLGDFFPGNDKILLFARLSDEDFRPSDDELKQTLADVNSALE 547
             KDIK +L+  + +  F+QLGD FPGND ILL  +++++DF+PSDDELK  L  VN  LE
Sbjct: 493  HKDIKQILVSTESDVPFIQLGDCFPGNDDILLITKINEDDFKPSDDELKVKLESVNQQLE 552

Query: 548  PLRAKQSNLSLKIFEIPSEKQDAFFKPSTFTRELIEQDIATEGGHAQFKLHAPTADQLTI 607
            P+R KQS L+  +  +  ++QD     S  T  LI + ++  G HA  KL  P+ +Q+TI
Sbjct: 553  PIRKKQSLLASNVVSLAKKEQDELLGESKVTLNLINEAVSHAGAHALIKLSTPSVNQITI 612

Query: 608  RGDTKAVKVATAAIESIVANSGEKFETKFAVSSNSVPRLIGSKGANLNAIREKYQCNIDV 667
            RGD    K+A+AA++SIV NS  + +  F V +N V RLIG KGANL  IREK+     +
Sbjct: 613  RGDDHGCKIASAAVKSIVENSSTESKITFQVPTNVVSRLIGPKGANLQQIREKFDVQTFI 672

Query: 668  AQESSGNQTEVTVTGLKYSVEHAKAYLLSESKKWADVITKELNVLPKYRGRLIGSQGTYR 727
             Q+S    T+VT+TGL+Y+++ AK Y+L+E+KKW+D+ITKEL V  KY   L G QGTYR
Sbjct: 673  PQDSKDENTDVTLTGLQYNLDQAKTYILAEAKKWSDIITKELIVPMKYHRTLSGPQGTYR 732

Query: 728  NRLQTKYSVHIHFPMEGENEGVTIRGPSRGVAKAYDELKALLDFEIENGHTSIITVPTEH 787
             RL+ KYSV I FP   ++E VTIRGPSRGV  AYDELKALLDFEIENGH  ++ VP ++
Sbjct: 733  IRLENKYSVFIRFPK--DSELVTIRGPSRGVKAAYDELKALLDFEIENGHKELLKVPVDY 790

Query: 788  VPRXXXXXXXXXXXXRADCGVELDFLQKTTDPKAVETGKVELEITGSRQAIKEATQKVEA 847
            V R            +A+ GVEL+FL KT   KA E G+VELEITGSR +IKEA  KV++
Sbjct: 791  VTRVIGKSGETINDIKAEYGVELNFLDKTDSEKAKEAGEVELEITGSRSSIKEAANKVKS 850

Query: 848  IVKEASDVETESFE-VNPKYIRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDANSQDKK 906
            I+ +AS+ ET + E ++ KY  DI+G  G  LK +ISKAGGDEIRNK V+IPDA+S+DK 
Sbjct: 851  IIDQASNFETVTLEDIDSKYYSDIIGRSGSQLKEIISKAGGDEIRNKRVNIPDASSEDKV 910

Query: 907  ITIQGPHAFVQTMVKEIKLIIKEREDSVEKELDVPADRVGALIGPGGMVRRQLESEFNIK 966
            ITI GP  FV+ +VK+IK ++   E+S+ +EL++P ++ GALIGP G VRR+LE+EF ++
Sbjct: 911  ITIFGPSDFVKKVVKQIKGVVSGLENSITEELNIPQEKFGALIGPAGSVRRELETEFKVR 970

Query: 967  LSLPDIGDKSSKVKILGLPDNIAACEKKIFTQLIRDSCDAEVQVPASLHEFVSEKGALIQ 1026
            + +P+      KV + G P NI +C+KKI  ++IRDS D E+ VPA  H +VS  G + Q
Sbjct: 971  IHVPNKNSSDEKVTVSGSPANIESCKKKIEKEIIRDSFDLEIAVPAKYHSYVSNSGLIFQ 1030

Query: 1027 RLRSDYFVNVRFGNSNGKANKLARSNLNIPVEKATGTAEES---IKFTTEEIPLAIEESQ 1083
             LR+++ ++V  GN    A  L+R+N  +P   A G  E S   I+  TE      E   
Sbjct: 1031 TLRNEFSIDVSHGNLTRTAQSLSRANYKVPENVAGGENESSNVLIQSVTE-----TEAKV 1085

Query: 1084 GFIPWRLSYEPVDLSDILTXXXXXXXXXXXXXXXXXXXXXXXXDRIELATKASTVGYLWS 1143
              IPWRL+Y P+DLSD+L                         DRI  A   +T G++WS
Sbjct: 1086 DTIPWRLTYSPIDLSDVL--GEDYKKDEESKDQVLEKASKLIEDRIAEAKLVNTEGFVWS 1143

Query: 1144 SKSSEFRKVVGSMGSNIKKIREATGTLINVPKKNDKVSDIIYIRGT 1189
              + +F  +VG  G NI++IR AT T+I+VP+K+DKV+++IY+ G+
Sbjct: 1144 KDAKKFNSIVGPNGRNIREIRNATKTVIHVPRKSDKVNNVIYVLGS 1189

>Kwal_27.12486
          Length = 299

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 20/109 (18%)

Query: 862 VNPKYIRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDANSQDKKITIQGPHAFVQTMVK 921
           V+   +  I+G  G  +K+LI K G   + +K+  +PD  SQD+ + IQG    + + + 
Sbjct: 120 VSNSQVSSIIGTQGSRIKALIEKHGVKVVASKNF-LPD--SQDRVVEIQGFPGSIASCII 176

Query: 922 EIKLII-----------------KEREDSVEKELDVPADRVGALIGPGG 953
           EI  ++                  + E SV KE+ +P + VGAL+G GG
Sbjct: 177 EISELLATETKPSHEKQYYPHTKSQEEGSVTKEVAIPVEFVGALLGRGG 225

>AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH]
           (982057..983007) [951 bp, 316 aa]
          Length = 316

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (49%), Gaps = 21/105 (20%)

Query: 867 IRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDANSQDKKITIQG-PHAFV-------QT 918
           +  I+G  G  +K LI       + +K+  +PD  SQD+ + IQG P++         QT
Sbjct: 155 VSSIIGTAGSKIKKLIDTHSSKLVVSKTF-LPD--SQDRILEIQGFPNSIANCIKDISQT 211

Query: 919 MVKEIKLIIKER----------EDSVEKELDVPADRVGALIGPGG 953
           ++K+  L  KE+          +  V   + +PA+ VGAL+G GG
Sbjct: 212 LIKDDVLDTKEKRYYPHSKHSKDIHVTATVAIPAEYVGALLGHGG 256

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 9/73 (12%)

Query: 181 VTVTIEVPSKTRSAIIGAGGKKIREISEPLEVRIDIGKEIKEDTYDEDLDDSMVDVSIHG 240
           VT T+ +P++   A++G GG +I  + +    +I + +E  ++   E         +I G
Sbjct: 237 VTATVAIPAEYVGALLGHGGNRIANLRKYTRTKITVAQEPNQNNERE--------FTITG 288

Query: 241 -DLESVRIAQQKI 252
            D +SV++AQ  I
Sbjct: 289 NDQKSVKLAQNMI 301

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 938  LDVPADRVGALIGPGGMVRRQLESEFNIKLS-----LPDIGDKSSKVKILGLPDNIAACE 992
            L V   +V ++IG  G   ++L    + KL      LPD  D+   ++I G P++IA C 
Sbjct: 148  LIVTNSQVSSIIGTAGSKIKKLIDTHSSKLVVSKTFLPDSQDRI--LEIQGFPNSIANCI 205

Query: 993  KKIFTQLIRD 1002
            K I   LI+D
Sbjct: 206  KDISQTLIKD 215

>Sklu_2250.3 YBL032W, Contig c2250 5501-6463 reverse complement
          Length = 320

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 33/117 (28%)

Query: 867 IRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDANSQDKKITIQG-PHAFVQTMVKEIKL 925
           +  I+G  G+ +KSLI K G   + +K+  +PD+N  D+ + IQG P +    +V+  ++
Sbjct: 144 VSSIIGVQGKKIKSLIDKHGVKIVASKNF-LPDSN--DRVLEIQGFPGSITNCLVEISEI 200

Query: 926 IIKEREDSVEKE-----------------------------LDVPADRVGALIGPGG 953
           ++ E +  V+ E                             + +P+D VGAL+G GG
Sbjct: 201 LLNEIDIKVQPEKRYYPHASSTPASAEDPSSTSTNVPAVQVVAIPSDFVGALLGHGG 257

>Scas_515.6
          Length = 342

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 696 SESKKWADVITKELNVLPKYRGRLIGSQGTYRNRLQ--TKYSVHIHFPMEGENEG-VTIR 752
           S+S      ITK +    KY  ++IG +GTY N L+  T  S+ +  P + E+   ++IR
Sbjct: 257 SKSGNLLSNITKVVTYPDKYSSKVIGREGTYINMLRESTSCSIRLKSPDDKEDLAIISIR 316

Query: 753 GPSRGVAKA 761
           GP   V  A
Sbjct: 317 GPPLCVDAA 325

>Scas_706.38
          Length = 1946

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 76/179 (42%), Gaps = 50/179 (27%)

Query: 253  SAIVKE-DTKNASIQVNVEDKNLVPFINLEGLKLPVD-AKFNTASGQIQ----------- 299
            +A++K+ +T++ SI  + E KN  PF+N   L  P D ++ + +S  IQ           
Sbjct: 1774 TALLKDIETEDDSIIYSPEGKN--PFVNPVDLDTPHDESEMDVSSSPIQRSLSPSRNSTL 1831

Query: 300  LSGLRDEVQAAKANILQYLRELSSQIKTLKVKIPVKFQFLIDESEIK-----EKFNVTVH 354
            LS  +DEV      +L  LR  ++         P K   L+DE + K      K N  +H
Sbjct: 1832 LSDDQDEVTDRAKALLMELRGSNT---------PSKRNSLLDEHKEKLRARRRKTNSDLH 1882

Query: 355  LPTAGGEEVSFVGPAV-----------------HLDEAVSFARENSKKYIVESLEISKA 396
                 G  + FVG  V                  L+E  + + EN +K  VES+E  KA
Sbjct: 1883 ----SGTRLQFVGETVPEKEVEPITGEPDGTSTELEETSNLSSENQQKVDVESIEDEKA 1937

>KLLA0E12309g 1088810..1089961 some similarities with sp|P38199
           Saccharomyces cerevisiae YBL032w singleton, hypothetical
           start
          Length = 383

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 24/111 (21%)

Query: 863 NPKYIRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDANSQDKKITIQGPHAFVQTMVKE 922
           NP+ I  ++G  G  +K LI       + +K   +PD  S+D+ + IQG    V   + E
Sbjct: 170 NPQ-ISSVIGQQGAKIKKLIETHTVKLVASKHF-LPD--SKDRVLEIQGFPTSVANCINE 225

Query: 923 I-KLIIKE-------------------REDSVEKELDVPADRVGALIGPGG 953
           I +L I++                   +E  V + L +P + VGAL+G GG
Sbjct: 226 IAELFIQDDVHVPPRTLPRYYPHSKHTKEIQVSQTLAIPKEFVGALLGVGG 276

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.131    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 34,899,067
Number of extensions: 1502673
Number of successful extensions: 5012
Number of sequences better than 10.0: 52
Number of HSP's gapped: 4994
Number of HSP's successfully gapped: 61
Length of query: 1189
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1076
Effective length of database: 12,684,275
Effective search space: 13648279900
Effective search space used: 13648279900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)