Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.239420720510901e-154
Sklu_2238.22072058551e-118
AAL176C2052057901e-108
Scas_675.282162147671e-104
CAGL0G07689g2152137651e-104
KLLA0D02376g2072067341e-99
YKR014C (YPT52)2342337231e-97
YOR089C (VPS21)2102025111e-65
KLLA0C13728g2082044953e-63
Kwal_23.29782111724851e-61
CAGL0J08635g2082094744e-60
YNL093W (YPT53)2201734755e-60
Scas_662.262121724591e-57
ACL084C2072034562e-57
Sklu_2366.32181863852e-46
YLR262C (YPT6)2151733746e-45
Kwal_56.225552122083711e-44
AEL187C2082043676e-44
Sklu_2293.32141953677e-44
Scas_574.22221733642e-43
KLLA0F01232g2101943624e-43
CAGL0K06017g2191733616e-43
AGR257C2201673617e-43
Kwal_14.24842031783581e-42
CAGL0K09394g2211983531e-41
YER031C (YPT31)2231743513e-41
CAGL0I09306g2061693468e-41
Scas_203.22511933472e-40
YBR264C (YPT10)1991583423e-40
Scas_712.412192093409e-40
KLLA0F20471g2121753381e-39
AER434C2191713331e-38
CAGL0C02453g2181723312e-38
YGL210W (YPT32)2222163313e-38
Kwal_56.224402082082954e-33
Scas_656.22182032922e-32
YML001W (YPT7)2082072902e-32
KLLA0D05313g2041952892e-32
Scas_713.52112102877e-32
CAGL0E02607g2082072869e-32
Sklu_2373.32082022842e-31
Scas_707.262102022842e-31
ACR003C2081832832e-31
Kwal_14.11162042012815e-31
CAGL0F02123g2152012816e-31
KLLA0E12111g2141922791e-30
CAGL0K12672g2062062772e-30
YFL038C (YPT1)2062062721e-29
Sklu_2144.32042032711e-29
Scas_674.52081772711e-29
ABR220W2041992683e-29
Kwal_23.50582131722676e-29
KLLA0D01265g2072042676e-29
Sklu_1815.22131722677e-29
Sklu_1136.11821792631e-28
Kwal_47.190551791422622e-28
YFL005W (SEC4)2151722616e-28
AGL021W2122022591e-27
Kwal_33.140152711662096e-20
Scas_610.42111752004e-19
CAGL0J05632g1881681994e-19
YOR185C (GSP2)2201912005e-19
YLR293C (GSP1)2191912006e-19
CAGL0I00594g2141921971e-18
Scas_578.71871641951e-18
YPR165W (RHO1)2091751952e-18
ABR182W2091871943e-18
AGR294C2141911944e-18
KLLA0C05126g2141911944e-18
KLLA0A04499g2141911944e-18
Sklu_2285.42141911944e-18
CAGL0I08459g2101751935e-18
Scas_586.62191911935e-18
Kwal_56.233612141911935e-18
Sklu_2151.42071721926e-18
KLLA0C13816g1871641907e-18
Sklu_1816.11881711891e-17
Kwal_55.219372081721891e-17
ACR257C2591651903e-17
Sklu_1655.12871651895e-17
YNL090W (RHO2)1921691839e-17
Scas_691.362121721849e-17
ACL087C1871681821e-16
KLLA0B10626g2081751831e-16
ABR183W2071721822e-16
Kwal_55.219412091751812e-16
Sklu_2345.52191531813e-16
Sklu_2151.32091751813e-16
Scas_444.4*2891671825e-16
YKR055W (RHO4)2911951816e-16
KLLA0D08327g2541911744e-15
Scas_677.202832261755e-15
KLLA0A05643g2181651716e-15
CAGL0K08316g3231651748e-15
AER132W2321681682e-14
KLLA0F03443g2231891663e-14
Kwal_33.144522601881674e-14
Scas_417.32911991685e-14
Sklu_2007.22611961622e-13
ADL252W2242131612e-13
Scas_703.412251191612e-13
YOR101W (RAS1)3091941623e-13
YIL118W (RHO3)2311401587e-13
ABL139C2941901581e-12
Scas_671.352341241561e-12
Scas_547.32231261551e-12
KLLA0B05038g2232081551e-12
CAGL0G08558g2271921552e-12
Kwal_47.169832231211542e-12
YGR152C (RSR1)2722081553e-12
Sklu_1653.32561231533e-12
CAGL0E03113g3231721545e-12
Kwal_14.22442442021525e-12
CAGL0L11242g2541401525e-12
AFR464W2641691509e-12
YNL180C (RHO5)3312141511e-11
YNL098C (RAS2)3221641511e-11
Scas_575.102711891491e-11
Kwal_23.48752301291472e-11
KLLA0C12001g2591921482e-11
CAGL0G05764g2901951422e-10
YNL304W (YPT11)3551201422e-10
Kwal_34.161421921571382e-10
Kwal_55.21971421941423e-10
Scas_697.463241661403e-10
Kwal_26.83872921641394e-10
YML064C (TEM1)2451211385e-10
CAGL0B04521g3391641395e-10
KLLA0A11330g1901661356e-10
CAGL0J11242g3841321352e-09
AGL093W1911781278e-09
KLLA0A04213g1911921261e-08
YCR027C (RHB1)2091471252e-08
ADL262W2701641262e-08
Kwal_23.31351911921242e-08
YLR229C (CDC42)1911921242e-08
Scas_721.961911921242e-08
Kwal_23.29441841251232e-08
ACL078W1811251223e-08
Scas_628.212081761215e-08
CAGL0F05269g1911921216e-08
YOR094W (ARF3)1831251206e-08
Scas_697.54*1811251181e-07
Sklu_2320.21641241161e-07
KLLA0C12881g3731121183e-07
KLLA0C13563g1821251153e-07
CAGL0M03817g4751021165e-07
Sklu_2354.104221221141e-06
Scas_624.4*1811221101e-06
CAGL0I03916g1811221101e-06
YDL137W (ARF2)1811221101e-06
Scas_701.42*1811221101e-06
CAGL0J09064g1811221102e-06
ADL162W4041271112e-06
KLLA0F05225g1811221065e-06
YDL192W (ARF1)1811221057e-06
ADR094W1811221057e-06
Scas_503.25271861071e-05
Kwal_56.244531811221031e-05
Sklu_1681.21621211021e-05
Sklu_2365.21971761022e-05
Kwal_56.244621811221003e-05
CAGL0I00858g197190971e-04
Kwal_47.18241230124971e-04
YMR138W (CIN4)191181924e-04
KLLA0F17072g190138916e-04
Kwal_27.11872197124908e-04
Sklu_1358.1218131870.002
KLLA0C13387g21196850.003
KLLA0E07634g501179860.004
Sklu_2202.6183121830.006
YPL218W (SAR1)190119820.008
CAGL0E05896g189119820.009
AGR221W183121790.018
KLLA0E24805g183121790.019
KLLA0F02662g253137780.031
YBR164C (ARL1)183121770.036
CAGL0I10835g183121760.044
Scas_700.11183121750.064
Scas_706.2*190122740.082
Kwal_47.17857198178740.086
YMR023C (MSS1)526191760.086
CAGL0D05544g91176760.091
CAGL0E06292g408159730.16
Scas_567.919993720.18
KLLA0E12837g19975710.19
Kwal_56.2414914969700.25
Kwal_26.681066470720.29
Scas_698.27701102710.30
CAGL0G09977g152891710.34
YPL051W (ARL3)198129690.35
Kwal_23.53831514105710.37
AFL114W190119690.41
CAGL0L12826g199127680.61
Sklu_2411.4496134680.68
Scas_721.9039749680.77
Sklu_1689.135798680.79
KLLA0B02046g190119660.93
Kwal_33.1511375860670.99
CAGL0K03267g48796671.0
AGL261W198128661.1
KLLA0A03465g65926651.8
YLL013C (PUF3)87937651.9
ADR402W66126652.1
AER445C41172632.7
KLLA0B08129g54870633.0
YPR184W (GDB1)1536100633.6
Kwal_56.24532468134624.4
Kwal_14.80369368624.6
Scas_678.24161057624.8
YAL048C662183625.1
Scas_631.9152159617.0
Kwal_27.11684335133607.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2394
         (205 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2394                                                          424   e-154
Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement        333   e-118
AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..3220...   308   e-108
Scas_675.28                                                           300   e-104
CAGL0G07689g complement(729919..730566) highly similar to sp|P36...   299   e-104
KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces c...   287   1e-99
YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-bind...   283   1e-97
YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-bind...   201   1e-65
KLLA0C13728g 1173329..1173955 highly similar to sp|P36017 Saccha...   195   3e-63
Kwal_23.2978                                                          191   1e-61
CAGL0J08635g complement(853978..854604) highly similar to sp|P36...   187   4e-60
YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protei...   187   5e-60
Scas_662.26                                                           181   1e-57
ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W (...   180   2e-57
Sklu_2366.3 , Contig c2366 5288-5944 reverse complement               152   2e-46
YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-bindi...   148   6e-45
Kwal_56.22555                                                         147   1e-44
AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH] (284984..2...   145   6e-44
Sklu_2293.3 YLR262C, Contig c2293 4975-5619                           145   7e-44
Scas_574.2                                                            144   2e-43
KLLA0F01232g complement(114430..115062) similar to sp|P36019 Sac...   144   4e-43
CAGL0K06017g complement(586093..586752) highly similar to sp|Q99...   143   6e-43
AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH] (1225886..1...   143   7e-43
Kwal_14.2484                                                          142   1e-42
CAGL0K09394g complement(929234..929899) highly similar to sp|P51...   140   1e-41
YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-bindi...   139   3e-41
CAGL0I09306g complement(897087..897707) similar to sp|P38146 Sac...   137   8e-41
Scas_203.2                                                            138   2e-40
YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of ...   136   3e-40
Scas_712.41                                                           135   9e-40
KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260 Saccha...   134   1e-39
AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C ...   132   1e-38
CAGL0C02453g 247493..248149 highly similar to sp|P38555 Saccharo...   132   2e-38
YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein r...   132   3e-38
Kwal_56.22440                                                         118   4e-33
Scas_656.2                                                            117   2e-32
YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein...   116   2e-32
KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1 Kluyverom...   115   2e-32
Scas_713.5                                                            115   7e-32
CAGL0E02607g complement(248761..249387) highly similar to sp|P32...   114   9e-32
Sklu_2373.3 YML001W, Contig c2373 10977-11603                         114   2e-31
Scas_707.26                                                           114   2e-31
ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH] (359762..36...   113   2e-31
Kwal_14.1116                                                          112   5e-31
CAGL0F02123g 212117..212764 highly similar to sp|P07560 Saccharo...   112   6e-31
KLLA0E12111g 1075299..1075943 highly similar to sp|P07560 Saccha...   112   1e-30
CAGL0K12672g 1255541..1256161 highly similar to sp|P01123 Saccha...   111   2e-30
YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding ...   109   1e-29
Sklu_2144.3 YFL038C, Contig c2144 4079-4693                           108   1e-29
Scas_674.5                                                            108   1e-29
ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH] complement(8...   107   3e-29
Kwal_23.5058                                                          107   6e-29
KLLA0D01265g 110784..111407 highly similar to sp|P32939 Saccharo...   107   6e-29
Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement        107   7e-29
Sklu_1136.1 YGL210W, Contig c1136 1284-1832                           105   1e-28
Kwal_47.19055                                                         105   2e-28
YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein ...   105   6e-28
AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH] complement(...   104   1e-27
Kwal_33.14015                                                          85   6e-20
Scas_610.4                                                             82   4e-19
CAGL0J05632g complement(537342..537908) highly similar to sp|P06...    81   4e-19
YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a GT...    82   5e-19
YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a GT...    82   6e-19
CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomy...    80   1e-18
Scas_578.7                                                             80   1e-18
YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein...    80   2e-18
ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    79   3e-18
AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C (...    79   4e-18
KLLA0C05126g complement(463657..464301) highly similar to sp|P32...    79   4e-18
KLLA0A04499g complement(404732..405376) highly similar to sp|P32...    79   4e-18
Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement         79   4e-18
CAGL0I08459g 829292..829924 highly similar to sp|P06780 Saccharo...    79   5e-18
Scas_586.6                                                             79   5e-18
Kwal_56.23361                                                          79   5e-18
Sklu_2151.4 , Contig c2151 3640-4263 reverse complement                79   6e-18
KLLA0C13816g 1183412..1183975 highly similar to sp|P06781 Saccha...    78   7e-18
Sklu_1816.1 YNL090W, Contig c1816 115-681                              77   1e-17
Kwal_55.21937                                                          77   1e-17
ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH] (808667..80...    78   3e-17
Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement          77   5e-17
YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein...    75   9e-17
Scas_691.36                                                            75   9e-17
ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH] (191573..192...    75   1e-16
KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromy...    75   1e-16
ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    75   2e-16
Kwal_55.21941                                                          74   2e-16
Sklu_2345.5 YCR027C, Contig c2345 9936-10595                           74   3e-16
Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement         74   3e-16
Scas_444.4*                                                            75   5e-16
YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein...    74   6e-16
KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces c...    72   4e-15
Scas_677.20                                                            72   5e-15
KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces c...    70   6e-15
CAGL0K08316g 838393..839364 some similarities with sp|Q00246 Sac...    72   8e-15
AER132W [2636] [Homologous to ScYML064C (TEM1) - SH] complement(...    69   2e-14
KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya g...    69   3e-14
Kwal_33.14452                                                          69   4e-14
Scas_417.3                                                             69   5e-14
Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement          67   2e-13
ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH] complement(...    67   2e-13
Scas_703.41                                                            67   2e-13
YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein...    67   3e-13
YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein ...    65   7e-13
ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH] (134875..135...    65   1e-12
Scas_671.35                                                            65   1e-12
Scas_547.3                                                             64   1e-12
KLLA0B05038g complement(457608..458279) similar to sp|P38987 Sac...    64   1e-12
CAGL0G08558g complement(804969..805652) highly similar to sp|Q00...    64   2e-12
Kwal_47.16983                                                          64   2e-12
YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-bindin...    64   3e-12
Sklu_1653.3 YML064C, Contig c1653 2277-3047                            64   3e-12
CAGL0E03113g complement(289164..290135) some similarities with s...    64   5e-12
Kwal_14.2244                                                           63   5e-12
CAGL0L11242g 1197075..1197839 highly similar to sp|P38987 Saccha...    63   5e-12
AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH] complement(...    62   9e-12
YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of...    63   1e-11
YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-bindi...    63   1e-11
Scas_575.10                                                            62   1e-11
Kwal_23.4875                                                           61   2e-11
KLLA0C12001g complement(1029092..1029871) similar to sp|P13856 S...    62   2e-11
CAGL0G05764g complement(552809..553681) similar to sp|P53879 Sac...    59   2e-10
YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase pos...    59   2e-10
Kwal_34.16142                                                          58   2e-10
Kwal_55.21971                                                          59   3e-10
Scas_697.46                                                            59   3e-10
Kwal_26.8387                                                           58   4e-10
YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-bindi...    58   5e-10
CAGL0B04521g complement(439732..440751) similar to sp|P01120 Sac...    58   5e-10
KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida...    57   6e-10
CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces...    57   2e-09
AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH] complement...    54   8e-09
KLLA0A04213g complement(382243..382818) highly similar to sp|P19...    53   1e-08
YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein inv...    53   2e-08
ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C (...    53   2e-08
Kwal_23.3135                                                           52   2e-08
YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type...    52   2e-08
Scas_721.96                                                            52   2e-08
Kwal_23.2944                                                           52   2e-08
ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH] complement(2...    52   3e-08
Scas_628.21                                                            51   5e-08
CAGL0F05269g complement(533759..534334) highly similar to sp|P19...    51   6e-08
YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with simila...    51   6e-08
Scas_697.54*                                                           50   1e-07
Sklu_2320.2 YOR094W, Contig c2320 3571-4065                            49   1e-07
KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559 Saccha...    50   3e-07
KLLA0C13563g complement(1157278..1157826) highly similar to sp|P...    49   3e-07
CAGL0M03817g complement(431237..432664) weakly similar to sp|P48...    49   5e-07
Sklu_2354.10 YNL304W, Contig c2354 13851-15119                         49   1e-06
Scas_624.4*                                                            47   1e-06
CAGL0I03916g 343014..343559 highly similar to sp|P11076 Saccharo...    47   1e-06
YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein o...    47   1e-06
Scas_701.42*                                                           47   1e-06
CAGL0J09064g 892556..893101 highly similar to sp|P11076 Saccharo...    47   2e-06
ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH] complement...    47   2e-06
KLLA0F05225g 515391..515936 highly similar to sp|P19146 Saccharo...    45   5e-06
YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein i...    45   7e-06
ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W (...    45   7e-06
Scas_503.2                                                             46   1e-05
Kwal_56.24453                                                          44   1e-05
Sklu_1681.2 YDL137W, Contig c1681 2279-2767                            44   1e-05
Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement          44   2e-05
Kwal_56.24462                                                          43   3e-05
CAGL0I00858g complement(63365..63958) similar to sp|P39110 Sacch...    42   1e-04
Kwal_47.18241                                                          42   1e-04
YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein...    40   4e-04
KLLA0F17072g complement(1566668..1567240) similar to sp|P39110 S...    40   6e-04
Kwal_27.11872                                                          39   8e-04
Sklu_1358.1 YMR138W, Contig c1358 536-1192                             38   0.002
KLLA0C13387g complement(1142002..1142637) similar to sp|P01119 S...    37   0.003
KLLA0E07634g 688734..690239 similar to sp|P32559 Saccharomyces c...    38   0.004
Sklu_2202.6 YBR164C, Contig c2202 5407-5958                            37   0.006
YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408) Comp...    36   0.008
CAGL0E05896g join(complement(585178..585202),complement(584348.....    36   0.009
AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH] complement(...    35   0.018
KLLA0E24805g 2194554..2195105 highly similar to sp|P38116 Saccha...    35   0.019
KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus...    35   0.031
YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding...    34   0.036
CAGL0I10835g 1060258..1060809 highly similar to sp|P38116 Saccha...    34   0.044
Scas_700.11                                                            33   0.064
Scas_706.2*                                                            33   0.082
Kwal_47.17857                                                          33   0.086
YMR023C (MSS1) [3987] chr13 complement(319436..321016) Mitochond...    34   0.086
CAGL0D05544g complement(527482..530217) similar to tr|Q07807 Sac...    34   0.091
CAGL0E06292g 633135..634361 some similarities with sp|P01119 Sac...    33   0.16 
Scas_567.9                                                             32   0.18 
KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomy...    32   0.19 
Kwal_56.24149                                                          32   0.25 
Kwal_26.6810                                                           32   0.29 
Scas_698.27                                                            32   0.30 
CAGL0G09977g 951295..955881 similar to sp|Q06625 Saccharomyces c...    32   0.34 
YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation fa...    31   0.35 
Kwal_23.5383                                                           32   0.37 
AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH] complement(...    31   0.41 
CAGL0L12826g complement(1370767..1371366) highly similar to tr|Q...    31   0.61 
Sklu_2411.4 YMR023C, Contig c2411 8898-10388                           31   0.68 
Scas_721.90                                                            31   0.77 
Sklu_1689.1 YHR022C, Contig c1689 285-1358 reverse complement          31   0.79 
KLLA0B02046g 178646..179218 highly similar to sp|P20606 Saccharo...    30   0.93 
Kwal_33.15113                                                          30   0.99 
CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces...    30   1.0  
AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH] complement(...    30   1.1  
KLLA0A03465g complement(314573..316552) similar to sp|P39722 Sac...    30   1.8  
YLL013C (PUF3) [3406] chr12 complement(122074..124713) Protein i...    30   1.9  
ADR402W [2142] [Homologous to ScYAL048C - SH] complement(1426900...    30   2.1  
AER445C [2945] [Homologous to ScYJR076C (CDC11) - SH] (1492208.....    29   2.7  
KLLA0B08129g complement(718086..719732) some similarities with s...    29   3.0  
YPR184W (GDB1) [5598] chr16 (902038..906648) Glycogen debranchin...    29   3.6  
Kwal_56.24532                                                          28   4.4  
Kwal_14.803                                                            28   4.6  
Scas_678.24                                                            28   4.8  
YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein inv...    28   5.1  
Scas_631.9                                                             28   7.0  
Kwal_27.11684                                                          28   7.4  

>Kwal_14.2394
          Length = 207

 Score =  424 bits (1090), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN
Sbjct: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAAT 180
           KLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAAT
Sbjct: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAAT 180

Query: 181 AASPQARKTPNVKLQRPSTNDSTSC 205
           AASPQARKTPNVKLQRPSTNDSTSC
Sbjct: 181 AASPQARKTPNVKLQRPSTNDSTSC 205

>Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement
          Length = 207

 Score =  333 bits (855), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 179/205 (87%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKL+ + D  +KFEIW
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAGQERYKSLAPMYYRNAN ALVVYDVTQ  SLVKAQ+WV+ELK+KVGD+DLVICLVGN
Sbjct: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAAT 180
           KLDLC EE   RGV+K+DAQ YA ++GLLFHEVSAKTG GV+ IFQEIGE +Y +K  + 
Sbjct: 121 KLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSL 180

Query: 181 AASPQARKTPNVKLQRPSTNDSTSC 205
            A+ Q R   NV+LQRP+TND+TSC
Sbjct: 181 EAASQTRHVVNVELQRPTTNDATSC 205

>AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..32205)
           [618 bp, 205 aa]
          Length = 205

 Score =  308 bits (790), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 149/205 (72%), Positives = 173/205 (84%), Gaps = 2/205 (0%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLS+TIKL  H+D  IKFEIW
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAGQERYKSLAPMYYRNANAALVVYDVTQ  SL KAQSWV ELK+KVGD+DLVI LVGN
Sbjct: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAAT 180
           KLDL  E+   R ++ E+AQ YA+  GL+FHEVSAKTG+G+  +FQ IG  +Y+++  + 
Sbjct: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESL 180

Query: 181 AASPQARKTPNVKLQRPSTNDSTSC 205
           AA PQ   + +++LQRP+TND+TSC
Sbjct: 181 AAQPQ--HSSSIQLQRPTTNDATSC 203

>Scas_675.28
          Length = 216

 Score =  300 bits (767), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 151/214 (70%), Positives = 169/214 (78%), Gaps = 9/214 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKL---EKHEDVTIKF 57
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE RESTIGAAFLSQTIK+   E+ EDV IKF
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60

Query: 58  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICL 117
           EIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ  SLVKA+SWVEELKNKVGD+DLVI L
Sbjct: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120

Query: 118 VGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKG 177
           VGNKLDLC  EE  R V+  +A+ YA+EQ LLF EVSAKTG GV  +F+ IGE +Y  K 
Sbjct: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180

Query: 178 AATAASP------QARKTPNVKLQRPSTNDSTSC 205
               A        +   + ++  QRPSTND+T+C
Sbjct: 181 DEILAKKNRELGNRVNNSVDINAQRPSTNDTTTC 214

>CAGL0G07689g complement(729919..730566) highly similar to sp|P36018
           Saccharomyces cerevisiae YKR014c YPT52 GTP-binding
           protein, start by similarity
          Length = 215

 Score =  299 bits (765), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 149/213 (69%), Positives = 172/213 (80%), Gaps = 8/213 (3%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEK-HEDVTIKFEI 59
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQT+K++  +EDV IKFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60

Query: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVG 119
           WDTAGQERYKSLAPMYYRNANAALVVYDVTQ  SL KAQSWV+EL+NKVGD++LVI LVG
Sbjct: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120

Query: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAA 179
           NK+D+   +E  R +E E+   YAQ Q LLF EVSAKTG+GV  IFQEIGE +Y  K A+
Sbjct: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180

Query: 180 TAASPQARKTPNV-------KLQRPSTNDSTSC 205
                Q+R+T +V       + QRPSTND++SC
Sbjct: 181 LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSSC 213

>KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein of the rab
           family, start by similarity
          Length = 207

 Score =  287 bits (734), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 142/206 (68%), Positives = 164/206 (79%), Gaps = 2/206 (0%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKL-EKHEDVTIKFEI 59
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE+RESTIGAAFLSQTIKL E++++  +KFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60

Query: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVG 119
           WDTAGQERYKSLAPMYYRNANAALVVYDVT+  SL KA+ WV+ELK KV D  L+ICLVG
Sbjct: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120

Query: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAA 179
           NKLDL +E E    V++ DA+ +AQE  LLFH+VSAKTG  V  +FQ+IGE +Y +    
Sbjct: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDK 180

Query: 180 TAASPQARKTPNVKLQRPSTNDSTSC 205
              S +     N+ LQRPSTNDS SC
Sbjct: 181 IQESKKPNNN-NISLQRPSTNDSQSC 205

>YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-binding
           protein of the rab family (ras superfamily) involved in
           endocytosis and transport of proteins to the vacuole
           [705 bp, 234 aa]
          Length = 234

 Score =  283 bits (723), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 151/233 (64%), Positives = 170/233 (72%), Gaps = 29/233 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHE-----DVTI 55
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQ+I +  ++     DV I
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVI 115
           KFEIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ  SL KA++WV+ELKNKVGD DLVI
Sbjct: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120

Query: 116 CLVGNKLDLCTE----------EEGG------RGVEKEDAQMYAQEQGLLFHEVSAKTGS 159
            L+GNK+DLC E           EGG      R +  E+A+ YAQEQGLLF EVSAKTG 
Sbjct: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180

Query: 160 GVAAIFQEIGENVYQKKGAATAASPQARKTP-------NVKLQRPSTNDSTSC 205
           GV  IFQ+IGE +Y  K      S Q R+         ++ LQRPSTND TSC
Sbjct: 181 GVKEIFQDIGEKLYDLK-KDEILSKQNRQIGGGNNGQVDINLQRPSTNDPTSC 232

>YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-binding
           protein required for sorting of vacuolar proteins and
           involved in late stage of endocytosis, member of the rab
           family in the ras superfamily [633 bp, 210 aa]
          Length = 210

 Score =  201 bits (511), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 140/202 (69%), Gaps = 5/202 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + + +H   T+KFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEH---TVKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER+ SLAPMYYRNA AALVVYDVT+  S +KA+ WV+EL  +   +D++I LVGNK+D
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQ-ASKDIIIALVGNKID 123

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           +  +E G R V +E+ +  A+E+GLLF E SAKTG  V  +F  IGE +  K      ++
Sbjct: 124 ML-QEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNSA 182

Query: 184 PQARKTPNVKLQRPSTNDSTSC 205
              R++ N ++   + ND TS 
Sbjct: 183 SNERESNNQRVDLNAANDGTSA 204

>KLLA0C13728g 1173329..1173955 highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  195 bits (495), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 137/204 (67%), Gaps = 7/204 (3%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +  H   TIKFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMADH---TIKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER+ SLAPMYYRNA AALVVYDVT+  S +KA+ WV+EL  +   + +VI LVGNK+D
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAS-KGIVIALVGNKMD 123

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKG-AATAA 182
           L   EE  R V KE+A+  +QE+ LLF E SAKTG  V  +F  IGE +  KK   +   
Sbjct: 124 LLESEE-DRKVAKEEAEKLSQEENLLFFETSAKTGDNVNEVFLAIGEKIPLKKSDGSNTD 182

Query: 183 SPQARKTPNVKLQRP-STNDSTSC 205
             +  +   + L +P  T++  SC
Sbjct: 183 GLRGTEDGRIDLNKPDDTSNPNSC 206

>Kwal_23.2978
          Length = 211

 Score =  191 bits (485), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 126/172 (73%), Gaps = 5/172 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +  H   TIKFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDH---TIKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER+ SLAPMYYRNA AALVVYDVT+  S +KA+ WV+EL+ +   +D+VI LVGNKLD
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQ-ASKDIVIALVGNKLD 123

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQK 175
           +  E  G R V +E+A+  A ++ LLF E SAKTGS V  +F  IG+ +  K
Sbjct: 124 I-VESGGERKVAREEAENLAAQEQLLFFETSAKTGSNVNEVFLGIGQKIPLK 174

>CAGL0J08635g complement(853978..854604) highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  187 bits (474), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 104/209 (49%), Positives = 137/209 (65%), Gaps = 9/209 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           +   KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + + +H   T+KFEIW
Sbjct: 5   ITSLKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTINEH---TVKFEIW 61

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAGQER+ SLAPMYYRNA AALVVYDVT+  S +KA+ WV+EL+ +   +D++I LVGN
Sbjct: 62  DTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQ-ASKDIIIALVGN 120

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAAT 180
           K+D+  E    R V +E+A+  A+E+ LLF E SAK+G  +  +F  IGE V  K     
Sbjct: 121 KIDVL-ENGTERSVSREEAEKLAEEENLLFFETSAKSGENITDVFLAIGEKVPLKTANQA 179

Query: 181 AASPQARKTPNVKL----QRPSTNDSTSC 205
                A +   V L      P+ N S SC
Sbjct: 180 NVPNNANENQRVDLTSVVNNPAANSSCSC 208

>YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protein
           involved in endocytosis and transport of proteins to the
           vacuole, member of the rab family in the ras superfamily
           [663 bp, 220 aa]
          Length = 220

 Score =  187 bits (475), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 119/173 (68%), Gaps = 6/173 (3%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           L  K+VLLG+S+VGKSSIV RFV D F E +E TIGAAFL++ I     +   IKFEIWD
Sbjct: 11  LTIKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRIT---RDGKVIKFEIWD 67

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNK 121
           TAGQER+  LAPMYYRNA AALVV+DVT  GS  KAQ+WVEEL  KVG  D+VI LVGNK
Sbjct: 68  TAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVG-HDIVIALVGNK 126

Query: 122 LDLCT--EEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENV 172
           +DL    +E   R ++    Q   + + LL+ E SAKTG  +  IFQ +GE V
Sbjct: 127 MDLLNNDDENENRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKV 179

>Scas_662.26
          Length = 212

 Score =  181 bits (459), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 124/172 (72%), Gaps = 4/172 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +    D T+KFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIN---DNTVKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER+ SLAPMYYRNA AAL+VYDVT+  S +KA+ W++EL  +  ++D++I LVGNK+D
Sbjct: 65  GQERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQ-ANKDMIIALVGNKVD 123

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQK 175
           +    E  R V +E+ +  A+E+GLLF E SAKTG  V   F  IGE +  K
Sbjct: 124 VLENNEDERKVAREEGEKLAEEEGLLFFETSAKTGLNVTETFVAIGEKIPLK 175

>ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W
           (YPT53) - SH] (199020..199643) [624 bp, 207 aa]
          Length = 207

 Score =  180 bits (456), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 105/203 (51%), Positives = 135/203 (66%), Gaps = 6/203 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + ++     TIKFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNMDSK---TIKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER+ SLAPMYYRNA AALVVYD+T+  S +KA+ WV+EL  +   + +VI LVGNKLD
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQ-ASKGIVIALVGNKLD 123

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           L    E  R V +E+A+  A+E+GLLF E SAKTG  +  +F  IGE +   K     AS
Sbjct: 124 LLENGE-ARKVSREEAEKLAEEEGLLFFETSAKTGDKINEVFLAIGEKIPLAKVGEQPAS 182

Query: 184 PQARKTPNVKLQRPSTND-STSC 205
             +     + L   S+N  + SC
Sbjct: 183 GPSVDNARLDLNAVSSNQHANSC 205

>Sklu_2366.3 , Contig c2366 5288-5944 reverse complement
          Length = 218

 Score =  152 bits (385), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/186 (45%), Positives = 117/186 (62%), Gaps = 19/186 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLE-------KHEDVTI 55
           + KLVLLG+SSVGKSSIV RF   +F     +TIGAAF ++T+ LE       +  D  I
Sbjct: 8   ELKLVLLGESSVGKSSIVTRFTTGNFHR-SNATIGAAFTTKTLSLESIVPETGETIDKKI 66

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVG-----D 110
           K EIWDTAGQERY+SLAPMYYRN + AL+V+DVT   S+ +AQSW++EL   +      +
Sbjct: 67  KLEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYINEGEHEE 126

Query: 111 QDLVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGE 170
           + ++I +VGNK+DL  E    + +       Y Q+QG  +  VSAKTG G+  +F  I +
Sbjct: 127 RGILIKIVGNKIDLNPEARETQNLP------YIQDQGYNWFPVSAKTGDGIDELFDTIVK 180

Query: 171 NVYQKK 176
            +  +K
Sbjct: 181 EIPWEK 186

>YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-binding
           protein involved in the secretory pathway, member of the
           rab family in the ras superfamily [648 bp, 215 aa]
          Length = 215

 Score =  148 bits (374), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 118/173 (68%), Gaps = 8/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L+   D TI+ ++W
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLD---DKTIRLQLW 64

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAGQER++SL P Y R++  A++VYD+T+  S      W+E++KN+ GD+++++C+VGN
Sbjct: 65  DTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGN 124

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGL-LFHEVSAKTGSGVAAIFQEIGENV 172
           K DL  E    R +  E+ +  A+  G  +F E S K G  V A+F++I +++
Sbjct: 125 KSDLSDE----RQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSL 173

>Kwal_56.22555
          Length = 212

 Score =  147 bits (371), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 130/208 (62%), Gaps = 10/208 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L+   D TI+ ++W
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLD---DKTIRLQLW 66

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAGQER++SL P Y R+++ A+VVYDVT   S      WVE++K++ G++++V+C+VGN
Sbjct: 67  DTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDVKSERGEENVVLCIVGN 126

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQE-QGLLFHEVSAKTGSGVAAIFQEIGENVYQ-KKGA 178
           K DL  E    R V  E+ +  AQ     +F E S K G  V  +F++I + + + +K  
Sbjct: 127 KNDLSDE----RQVSTEEGERKAQVLNAKIFIETSTKAGFNVKNLFRKIAKTLPEFQKAD 182

Query: 179 ATAASPQARKTPNV-KLQRPSTNDSTSC 205
                 QA+  P+V  +   S  + +SC
Sbjct: 183 EDPLGEQAKNKPDVIDITTASEQEQSSC 210

>AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH]
           (284984..285610) [627 bp, 208 aa]
          Length = 208

 Score =  145 bits (367), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 125/204 (61%), Gaps = 29/204 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEK--------HEDVT 54
           Q KLVLLG+SSVGKSSIV RF    F +  ++TIGAAF +++++ E+         E  +
Sbjct: 8   QVKLVLLGESSVGKSSIVTRFTTGEFRK-NQATIGAAFTTRSVQWEEDAGDGSDAKEVRS 66

Query: 55  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGD---Q 111
           + FEIWDTAGQERY+SLAPMYYRN + ALVVYDVT+  S   A+SW++EL   +G+    
Sbjct: 67  VTFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDELNTYIGEAQRN 126

Query: 112 DLVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGEN 171
           D+V+ +VGNK+DL     GG+  +   +  +          VSAKTG G+  +F +I ++
Sbjct: 127 DVVVRIVGNKIDL---HAGGQLEQPLPSATF----------VSAKTGEGIEELFMDIAKH 173

Query: 172 VYQKK---GAATAASPQARKTPNV 192
           V  ++    A    SPQ R   NV
Sbjct: 174 VKPERFVLQAEPQESPQ-RSILNV 196

>Sklu_2293.3 YLR262C, Contig c2293 4975-5619
          Length = 214

 Score =  145 bits (367), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 124/195 (63%), Gaps = 10/195 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L+   D TI+ ++W
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLD---DKTIRLQLW 66

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAGQER++SL P Y R+++ A+VVYDVT   S      W+E++K++ G++++++C+VGN
Sbjct: 67  DTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDVKSERGEENVILCIVGN 126

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQE-QGLLFHEVSAKTGSGVAAIFQEIGENV--YQKKG 177
           K DL  E    R V  E+ +  AQ     +F E S K G  V  +F++I +++  +Q   
Sbjct: 127 KNDLVDE----RQVSTEEGERKAQVLNAKIFMETSTKAGFNVKNLFKKIAKSLPEFQNSS 182

Query: 178 AATAASPQARKTPNV 192
            +   + Q+   P V
Sbjct: 183 YSPLDNEQSENKPGV 197

>Scas_574.2
          Length = 222

 Score =  144 bits (364), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 116/173 (67%), Gaps = 8/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L+   D TI+ ++W
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLD---DKTIRLQLW 64

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAGQER++SL P Y R++  A+VVYD+T+  S      W+E++KN+ GD ++++C+VGN
Sbjct: 65  DTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKNERGDDNVILCIVGN 124

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGL-LFHEVSAKTGSGVAAIFQEIGENV 172
           K DL  E    R V  E+ +  A+  G  +F E S K G  V  +F++I +++
Sbjct: 125 KSDLSDE----RQVTIEEGENKAKILGADIFMETSTKAGYNVKNLFKKIAKSL 173

>KLLA0F01232g complement(114430..115062) similar to sp|P36019
           Saccharomyces cerevisiae YNL093w YPT53 GTP-binding
           protein of the RAB family (RAS superfamily), start by
           similarity
          Length = 210

 Score =  144 bits (362), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 117/194 (60%), Gaps = 22/194 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHED---VTIKFEIWD 61
           KLVLLG+SSVGKS+IV RF    F      TIGAAF ++ ++    ED     + FEIWD
Sbjct: 11  KLVLLGESSVGKSTIVTRFTTGEF-HINSPTIGAAFSTKAMEWVDSEDGIKRRVNFEIWD 69

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGD--QDLV-ICLV 118
           TAGQERY+SLAPMYYRN + AL+V+DVTQ  S  KAQSW++EL N + D  +D V + +V
Sbjct: 70  TAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDELNNYLEDYKKDTVQLRVV 129

Query: 119 GNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGA 178
           GNK+DL  EE         DA++           VSAKTG G+  +F +IG+++   K  
Sbjct: 130 GNKIDLVDEETLQNW---NDAEL-----------VSAKTGEGIDELFLKIGKDIPIDKFT 175

Query: 179 ATAAS-PQARKTPN 191
                 PQ+  T N
Sbjct: 176 LLQEDVPQSTSTSN 189

>CAGL0K06017g complement(586093..586752) highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c GTP-binding protein,
           start by similarity
          Length = 219

 Score =  143 bits (361), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 117/173 (67%), Gaps = 8/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L+   D TI+ ++W
Sbjct: 9   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLD---DKTIRLQLW 65

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAGQER++SL P Y R++  A+VVYD+T+  S      W+E++KN+ G +++++C+VGN
Sbjct: 66  DTAGQERFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDVKNERGAENVILCVVGN 125

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGL-LFHEVSAKTGSGVAAIFQEIGENV 172
           K DL  E    R V  E+ +  AQ+ G  +F + S K G  V  +F++I +++
Sbjct: 126 KSDLADE----RQVTAEEGEKKAQDLGAKIFMQTSTKVGYNVKNLFKKIAKSL 174

>AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH]
           (1225886..1226548) [663 bp, 220 aa]
          Length = 220

 Score =  143 bits (361), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 112/167 (67%), Gaps = 8/167 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L+   D TI+ ++WDT
Sbjct: 12  KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYLD---DRTIRLQLWDT 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
           AGQER++SL P Y R+++ A+VVYD+T   S      WVE+++N+ G+++L++C+VGNK 
Sbjct: 69  AGQERFRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDVRNERGEENLILCIVGNKS 128

Query: 123 DLCTEEEGGRGVEKEDAQMYAQ-EQGLLFHEVSAKTGSGVAAIFQEI 168
           DL  E    R V  E+ +  A+     +F E S K G  V A+F+ I
Sbjct: 129 DLVDE----RKVTVEEGENKAKLLNAKIFVETSTKAGFNVGALFKRI 171

>Kwal_14.2484
          Length = 203

 Score =  142 bits (358), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 81/178 (45%), Positives = 112/178 (62%), Gaps = 20/178 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVT-IKFEIWD 61
           + KLVLLG+SSVGKS++V RF   SF +   +TIGAAF ++ I  E       +KFEIWD
Sbjct: 9   ELKLVLLGESSVGKSALVTRFTTGSFHK-SNATIGAAFTTKVISWETETARKEVKFEIWD 67

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKV-GDQ--DLVICLV 118
           TAGQERY++L PMYYRN + A VV+DVT+  + +KA SWV+ELK+ + G++  ++VI L+
Sbjct: 68  TAGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIVIKLI 127

Query: 119 GNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKK 176
           GNK+DL  E                  + + +  VSAKTG GVA +F+ +   V   K
Sbjct: 128 GNKIDLLDE---------------VPPRKVGWTPVSAKTGEGVADLFESVAREVPSSK 170

>CAGL0K09394g complement(929234..929899) highly similar to sp|P51996
           Saccharomyces cerevisiae YGL210w YPT32 or sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 221

 Score =  140 bits (353), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 114/198 (57%), Gaps = 15/198 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TIK+E   D  IK +IWDTA
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKVE---DKKIKAQIWDTA 71

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQERY+++   YYR A  AL+VYD++++G+      W+ ELK    D ++ I L+GNK D
Sbjct: 72  GQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENA-DDNVAIGLIGNKSD 130

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQ-------KK 176
           L    E  R V  E+A+ +A E  L F E SA     V   F+E+ E +Y+         
Sbjct: 131 L----EHLRAVPTEEARGFASENQLFFTETSALNSENVDLAFRELIEQIYKMVNKHQVDL 186

Query: 177 GAATAASPQARKTPNVKL 194
           G     S  A K P + L
Sbjct: 187 GENAKGSSGAPKGPTISL 204

>YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-binding
           protein required in the secretory pathway at the stage
           of formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily of small GTP-binding
           proteins [672 bp, 223 aa]
          Length = 223

 Score =  139 bits (351), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 108/174 (62%), Gaps = 8/174 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           L FK+VL+GDS VGKS+++ RF K+ F+   +STIG  F ++T++++      IK +IWD
Sbjct: 12  LLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKR---IKAQIWD 68

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNK 121
           TAGQERY+++   YYR A  AL+VYD++++ S      W+ EL+    D ++ + L+GNK
Sbjct: 69  TAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENA-DDNVAVGLIGNK 127

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQK 175
            DL       R V  E+++ +AQE  LLF E SA     V   F+E+   +YQK
Sbjct: 128 SDLAHL----RAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQK 177

>CAGL0I09306g complement(897087..897707) similar to sp|P38146
           Saccharomyces cerevisiae YBR264c GTP-binding protein,
           hypothetical start
          Length = 206

 Score =  137 bits (346), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 107/169 (63%), Gaps = 14/169 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDV-TIKFEIWDT 62
            K+VLLG+S+VGKS+IV RF    +     +TIGAA++++ ++  +  DV  ++ EIWDT
Sbjct: 11  LKVVLLGESAVGKSAIVTRFSTGKYLR-NNATIGAAYVTKDLEYIRDGDVYQVRLEIWDT 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKV---GDQDLVICLVG 119
           AGQERY+SL PMYYRN + A+VV+DV+   SL  A  W++EL   V   G + + I LVG
Sbjct: 70  AGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERINIVLVG 129

Query: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEI 168
           NK+DLC++EE     ++ + Q         F  VSAK+G G+  +F  I
Sbjct: 130 NKMDLCSDEERSTLPQRVEEQ---------FQAVSAKSGEGIEELFDHI 169

>Scas_203.2
          Length = 251

 Score =  138 bits (347), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 113/193 (58%), Gaps = 14/193 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDV-TIKFEIWD 61
           + K VLLG+SSVG++SIV RF      + R   IGAAFL++ I+    +++  +  EIWD
Sbjct: 47  RLKFVLLGESSVGRTSIVTRFTTGKIPKKRMLPIGAAFLNKNIRWVDEDNIYEVDLEIWD 106

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQ---DLVICLV 118
           TAGQERY+SLAP+YYRN + AL+V+DVT + +  KA+SWV+EL++ + ++   ++ + L+
Sbjct: 107 TAGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEIQLYLI 166

Query: 119 GNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGA 178
           GNK DL          E E     A      F EVSAK   G+  +F+EI   +   K  
Sbjct: 167 GNKCDL----------EHESIAKTAILDMCTFKEVSAKRDEGIQELFEEIARGIPTDKFI 216

Query: 179 ATAASPQARKTPN 191
             + S Q   T N
Sbjct: 217 LQSPSNQLDVTDN 229

>YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of the
           rab family in the ras superfamily of small GTP-binding
           proteins [600 bp, 199 aa]
          Length = 199

 Score =  136 bits (342), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 103/158 (65%), Gaps = 11/158 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVT---IKFEIW 60
            K+VLLGDSSVGK+SIV R     F     +TIGAAF+++TI++  ++  T   I  EIW
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIW 64

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAGQERYKSL PMYYR+AN AL+V+++    SL  A++W ++L+++     ++I  VGN
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQVII--VGN 122

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTG 158
           K DL  EE  G      +  + A+ QGL +  VSAKTG
Sbjct: 123 KYDLVCEEHSG------EVTIPAELQGLPYVAVSAKTG 154

>Scas_712.41
          Length = 219

 Score =  135 bits (340), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 121/209 (57%), Gaps = 22/209 (10%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TI++E  +   IK +IWDTA
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKK---IKAQIWDTA 70

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQERY+++   YYR A  AL+VYD++++G+      W++EL++   D ++ + L+GNK D
Sbjct: 71  GQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKELRDN-ADDNVAVGLIGNKSD 129

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQ--------- 174
           L       R V   +A+ +A E  LLF E SA     V   F+E+   +YQ         
Sbjct: 130 LAHL----RAVPTAEAKNFASENELLFTETSALNSENVDQAFRELITAIYQMVSKHQVDL 185

Query: 175 -KKGAATAASPQARKTPNVKLQRPSTNDS 202
              G   AA+P   K P + L  P+ N++
Sbjct: 186 GDSGNNAAAAP---KGPTISLT-PTPNEN 210

>KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c YPT6 GTP-binding
           protein of the rab family, start by similarity
          Length = 212

 Score =  134 bits (338), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 112/175 (64%), Gaps = 16/175 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L+   D TI+ ++W
Sbjct: 9   LRKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLD---DKTIRLQLW 65

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAGQER++SL P Y R+++ A+VVYDVT   S      W+E++K + G++++++ +VGN
Sbjct: 66  DTAGQERFRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKMERGEENVILVIVGN 125

Query: 121 KLDLCTE-----EEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGE 170
           K DL  E     EEG R     +A+        LF E S K G  V  +F++I +
Sbjct: 126 KSDLVEERQVSTEEGERKSTVLNAK--------LFIETSTKAGFNVKTLFKKIAK 172

>AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C
           (YPT31) - SH] (1466442..1467052,1467106..1467154) [660
           bp, 219 aa]
          Length = 219

 Score =  132 bits (333), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 106/171 (61%), Gaps = 8/171 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F ++TI++E  +   +K +IWDTA
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKK---VKAQIWDTA 71

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQERY+++   YYR A  AL+VYD++++ S      W+ EL+    D+++ + L+GNK D
Sbjct: 72  GQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELREN-ADENVAVGLIGNKSD 130

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQ 174
           L       R V  ++A+ +AQ   +LF E SA     V   F+E+   +YQ
Sbjct: 131 LAHL----RAVPTDEAKNFAQGNQMLFTETSALNAENVDLAFRELITAIYQ 177

>CAGL0C02453g 247493..248149 highly similar to sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 218

 Score =  132 bits (331), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 105/172 (61%), Gaps = 8/172 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TI ++  +   IK +IWDTA
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTIDVDGKK---IKAQIWDTA 70

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQERY+++   YYR A  AL+VYD++++ S      W+ EL+    D ++ + L+GNK D
Sbjct: 71  GQERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELREN-ADDNVAVGLIGNKSD 129

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQK 175
           L       R V  E+A+ +A E  LLF E SA     V   F+E+   ++QK
Sbjct: 130 LAHL----RAVPTEEAKQFASENQLLFTETSALNSDNVDLAFKELITAIHQK 177

>YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein
           required in the secretory pathway at the stage of
           formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily [669 bp, 222 aa]
          Length = 222

 Score =  132 bits (331), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 117/216 (54%), Gaps = 22/216 (10%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F ++TI++E  +   IK +IWDTA
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKK---IKAQIWDTA 70

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQERY+++   YYR A  AL+VYD++++ S      W+ EL+    D ++ + L+GNK D
Sbjct: 71  GQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELREN-ADDNVAVGLIGNKSD 129

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQK-------- 175
           L       R V  ++A+ +A E  +LF E SA     V   F+E+   ++Q         
Sbjct: 130 LAHL----RAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDL 185

Query: 176 --KGAATAASPQARKTPNVKLQRPSTND----STSC 205
              G     S  A K P + L      D    S++C
Sbjct: 186 SGSGTNNMGSNGAPKGPTISLTPAPKEDKKKKSSNC 221

>Kwal_56.22440
          Length = 208

 Score =  118 bits (295), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 114/208 (54%), Gaps = 14/208 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D F +  ++TIGA FL++ + ++  +  T+  ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSMDGDKVATM--QVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT A S    +SW +E     N    +     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQKKGA- 178
           KLD+   EE  + V    AQ  A+  G +     SAK    V   F+EI  N  Q+  A 
Sbjct: 127 KLDV---EESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQSQAD 183

Query: 179 ATAASPQARKTPNVKLQ-RPSTNDSTSC 205
           A A         N++L   PS   S SC
Sbjct: 184 ADAFEDDFNDAINIQLDGEPS---SCSC 208

>Scas_656.2
          Length = 218

 Score =  117 bits (292), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 114/203 (56%), Gaps = 12/203 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV++ F+    +TIG  F  +T+ ++  +   IK ++WDTA
Sbjct: 27  MKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDFKIKTLDIQGRK---IKLQLWDTA 83

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A   ++VYDVT   +    + W   + N+  ++ + + LVGNK D
Sbjct: 84  GQERFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTV-NEHANEQVQLLLVGNKSD 142

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           L     G R V KE  +  A+E GL F E SAK    V  +F ++ + + +K        
Sbjct: 143 L-----GNRQVTKEQGEELARELGLPFMEASAKNDDNVNDLFLQLAKLIQEKIDNDEMGE 197

Query: 184 PQ-ARKTPNVKLQRPSTNDSTSC 205
           P+ A+K  N+K +   T  S+ C
Sbjct: 198 PRTAKKNVNIKSKDGKT--SSCC 218

>YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein
           with a role in protein transport between endosome-like
           compartments, member of the rab family in the ras
           superfamily [627 bp, 208 aa]
          Length = 208

 Score =  116 bits (290), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 115/207 (55%), Gaps = 12/207 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++  +  T+  ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM--QVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT A S    +SW +E     N    +     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGN 126

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQKKGAA 179
           K+D    EE  + V ++ AQ  A+  G +     SAK    V   F+EI  +  Q+  A 
Sbjct: 127 KID---AEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQAD 183

Query: 180 TAA-SPQARKTPNVKLQRPSTNDSTSC 205
           T A         N++L     N+S SC
Sbjct: 184 TEAFEDDYNDAINIRLD--GENNSCSC 208

>KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1
           Kluyveromyces lactis putative GTP-binding protein, start
           by similarity
          Length = 204

 Score =  115 bits (289), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 110/195 (56%), Gaps = 8/195 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L+     T+K +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDGK---TVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A+  ++VYDVT   S    ++W++E+ ++ G   ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRFGTAGVLKLLVGNKND 124

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           L  +    + V+ E A+ +A   G+ F E SA   S V   F  + + + +        +
Sbjct: 125 LTDK----KVVDTEVAKEFADSIGIPFIETSALDSSNVEEAFLIMTKQIKESVAKQQKDN 180

Query: 184 PQARKTPNVKLQRPS 198
            +A    NV L+  S
Sbjct: 181 GRAEDKSNVNLKGQS 195

>Scas_713.5
          Length = 211

 Score =  115 bits (287), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 116/210 (55%), Gaps = 16/210 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L+     T+K +IWDTA
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGK---TVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR ++  ++VYDVT   S    + W++E+ ++     ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEI-DRYATSTVLKLLVGNKCD 124

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIF----QEIGENVYQKK--- 176
           L  +    R VE + A+ +A    + F E SA   + V   F    ++I E++ Q+K   
Sbjct: 125 LTDK----RVVEYDVAKEFADANKMPFLETSALNSTNVEEAFLTMARQIKESMSQQKMED 180

Query: 177 GAATAASPQARKTPNVKLQRPS-TNDSTSC 205
           G A   +       NV L   S TN  +SC
Sbjct: 181 GGANGGNKNPDGGNNVNLAGQSLTNGGSSC 210

>CAGL0E02607g complement(248761..249387) highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 208

 Score =  114 bits (286), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 118/207 (57%), Gaps = 12/207 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + L+  +D  +  ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLD--DDKVVTMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT A S    +SW +E     N    +     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 126

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQK-KGA 178
           K+D+   E+  + V ++  Q  A+  G +     SAK+   V   F+EI ++  Q+ +  
Sbjct: 127 KVDI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 183

Query: 179 ATAASPQARKTPNVKLQRPSTNDSTSC 205
           A A         N++L+  S  +S SC
Sbjct: 184 AHAFEDDFNDAINIQLEGES--NSCSC 208

>Sklu_2373.3 YML001W, Contig c2373 10977-11603
          Length = 208

 Score =  114 bits (284), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 111/202 (54%), Gaps = 11/202 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++  ED     ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD--EDKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT A S    +SW +E     N    +     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFPFVILGN 126

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQKKGA- 178
           K+D+   EE  + V    AQ  A+  G +     SAK    V   F+EI  +  Q+  A 
Sbjct: 127 KIDV---EESKKVVNTRSAQELAKSLGNVPLFLTSAKGSINVETAFEEIARSALQQSQAD 183

Query: 179 ATAASPQARKTPNVKLQ-RPST 199
           A A         N++L   PS+
Sbjct: 184 ADAFEDDFNDAINIQLDGEPSS 205

>Scas_707.26
          Length = 210

 Score =  114 bits (284), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 107/202 (52%), Gaps = 9/202 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +T+ +   +   +K ++WDTA
Sbjct: 17  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKK---VKLQLWDTA 73

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A   ++VYDVT   +    + W + +     D+  ++ LVGNK D
Sbjct: 74  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTVNEHANDEAQLL-LVGNKSD 132

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           + T     R V  E  +  A+E GL F E SAK    V  IF  + + + +K  +   A 
Sbjct: 133 MDT-----RVVTYEQGESLAKELGLPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLAG 187

Query: 184 PQARKTPNVKLQRPSTNDSTSC 205
           P   K  N+ +        ++C
Sbjct: 188 PGNGKDANISINAKDGGSKSNC 209

>ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH]
           (359762..360388) [627 bp, 208 aa]
          Length = 208

 Score =  113 bits (283), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/183 (35%), Positives = 105/183 (57%), Gaps = 9/183 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++  +  T+  ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM--QVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT A S    +SW +E     N    +     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFPFVILGN 126

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQKKGAA 179
           K+D+   EE  + V    +Q  A+  G + F   SAK    V   F+EI  +  Q+  A 
Sbjct: 127 KIDV---EESKKVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQSQAD 183

Query: 180 TAA 182
             A
Sbjct: 184 AGA 186

>Kwal_14.1116
          Length = 204

 Score =  112 bits (281), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 111/201 (55%), Gaps = 8/201 (3%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L+     T+K +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGK---TVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A+  ++VYDVT   S    + W++E+ ++     ++  +VGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEI-DRYATAGVLKLMVGNKSD 124

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           L    +  R VE + A+ +A    + F E SA   S V   F  + + + +        +
Sbjct: 125 L----QDKRMVEYDVAKEFADSLQIPFLETSALDSSNVEEAFLTMAKQIKESMAQQHRDT 180

Query: 184 PQARKTPNVKLQRPSTNDSTS 204
            +     NV L+  S ++S+S
Sbjct: 181 GKKDDKANVNLKGQSLSNSSS 201

>CAGL0F02123g 212117..212764 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4, start by
           similarity
          Length = 215

 Score =  112 bits (281), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 107/201 (53%), Gaps = 9/201 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +T+ +   +   +K ++WDTA
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKK---VKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A   ++VYDVT   +    + W + +     D+  ++ LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTVNEHANDEAQLL-LVGNKSD 136

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           + T     R V  E  +  A+E GL F E SAK    V  IF  +   + +K  +   + 
Sbjct: 137 MDT-----RVVTYEQGEALAKELGLPFIESSAKNDDNVNEIFFTLARLIQEKIDSNKLSG 191

Query: 184 PQARKTPNVKLQRPSTNDSTS 204
           P + K  N+ +     + S S
Sbjct: 192 PNSGKDGNISINANKGDSSKS 212

>KLLA0E12111g 1075299..1075943 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4 GTP-binding
           protein of the ras superfamily, start by similarity
          Length = 214

 Score =  112 bits (279), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 107/192 (55%), Gaps = 10/192 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K++LLGDS VGKS ++ RFV+D F     +TIG  F  +T+ +       +K ++WDTA
Sbjct: 21  MKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDFKIKTVDINGKR---VKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A   +++YDVT   +    + W   + N+   +D+V+ LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIVLIYDVTDERTFENIRQWFSTV-NQHASEDVVMLLVGNKKD 136

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           + T     R V  E  +  A+E G+ F E SAK  + V+ IF  + + + Q+K       
Sbjct: 137 MDT-----RTVSYEQGEALAKELGIPFIEASAKDDTNVSEIFFTLAK-LIQEKIDDGKME 190

Query: 184 PQARKTPNVKLQ 195
            +A K  NV ++
Sbjct: 191 GKAEKEGNVSIR 202

>CAGL0K12672g 1255541..1256161 highly similar to sp|P01123
           Saccharomyces cerevisiae YFL038c YPT1, start by
           similarity
          Length = 206

 Score =  111 bits (277), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 115/206 (55%), Gaps = 12/206 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L+     T+K +IWDTA
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGK---TVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR ++  ++VYDVT   S    + W++E+ ++     ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGNKCD 124

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIF----QEIGENVYQKKGAA 179
           L  +    R VE + A+ +A+   + F E SA   + V   F    ++I E++ Q+    
Sbjct: 125 LADK----RVVEYDVAKEFAEANKMPFLETSALDSTNVEEAFLTMARQIKESMTQQNMNE 180

Query: 180 TAASPQARKTPNVKLQRPSTNDSTSC 205
           +      +   N+K Q  + + S+ C
Sbjct: 181 SQQKKNDKGNVNLKGQSLTQSGSSCC 206

>YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding
           protein required for vesicle transport from ER to Golgi
           and within the Golgi stack, member of the rab family in
           the ras superfamily of GTP-binding proteins [621 bp, 206
           aa]
          Length = 206

 Score =  109 bits (272), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 112/206 (54%), Gaps = 12/206 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L+     T+K +IWDTA
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGK---TVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR ++  ++VYDVT   S    + W++E+ ++     ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGNKCD 124

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIF----QEIGENVYQKKGAA 179
           L    +  R VE + A+ +A    + F E SA   + V   F    ++I E++ Q+    
Sbjct: 125 L----KDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE 180

Query: 180 TAASPQARKTPNVKLQRPSTNDSTSC 205
           T    + +   N+K Q  +      C
Sbjct: 181 TTQKKEDKGNVNLKGQSLTNTGGGCC 206

>Sklu_2144.3 YFL038C, Contig c2144 4079-4693
          Length = 204

 Score =  108 bits (271), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 109/203 (53%), Gaps = 9/203 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T+ L+     T+K +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVDLDGK---TVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A+  ++VYDVT   S    ++W++E+ ++ G   ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRYGTAGVLKLLVGNKND 124

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           L  +    + VE E A+ +A    +   E SA   S V   F  +   + +        +
Sbjct: 125 LTDK----KVVEYEVAKEFADSLQIPVLETSALDSSNVEEAFLTMARQIKESMSQQQRDN 180

Query: 184 PQARKTPNVKLQRPS-TNDSTSC 205
            +  +   V L+  S T  S+ C
Sbjct: 181 GKKEEKAGVNLKGQSLTGTSSGC 203

>Scas_674.5
          Length = 208

 Score =  108 bits (271), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 102/177 (57%), Gaps = 11/177 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++  +D     ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTID--DDKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT A S    +SW +E     N    +     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQG--LLFHEVSAKTGSGVAAIFQEIGENVYQK 175
           K+D+   +E  + V    AQ  A+  G   LF   SAK    +   F+EI  +  Q+
Sbjct: 127 KVDI---DETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSALQQ 179

>ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH]
           complement(817290..817904) [615 bp, 204 aa]
          Length = 204

 Score =  107 bits (268), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 107/199 (53%), Gaps = 8/199 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L+     T+K +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDGK---TVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A+  ++VYDVT   S    ++W++E+ ++ G   +V  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEI-DRYGTAGVVKLLVGNKND 124

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           L    +  + V+ E A+ +A    +   E SA   S V   F  +   + +        S
Sbjct: 125 L----KDKKVVDFEVAREFADSLNIPVLETSALDSSNVEEAFLTMARQIKETMSHQQKES 180

Query: 184 PQARKTPNVKLQRPSTNDS 202
            +      V L+  S  +S
Sbjct: 181 GKKDDKSGVNLKGQSLANS 199

>Kwal_23.5058
          Length = 213

 Score =  107 bits (267), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 97/172 (56%), Gaps = 9/172 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  +T+ +   +   +K ++WDTA
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKK---VKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A   ++VYDVT   +    + W   +     D+  ++ LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTVNQHANDEAQLL-LVGNKSD 136

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQK 175
           + T     R V  +  +  A+E G+ F E SAK  + V  IF ++ + + +K
Sbjct: 137 MDT-----RAVSTDQGESLAKELGIPFVEASAKDDTNVNDIFFQLAKLIQEK 183

>KLLA0D01265g 110784..111407 highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 207

 Score =  107 bits (267), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 111/204 (54%), Gaps = 15/204 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +  ++D     ++WDTA
Sbjct: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV--NDDKVATMQVWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E     N    +     ++ N
Sbjct: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQG---LLFHEVSAKTGSGVAAIFQEIGENVYQK-K 176
           K+D+   EE  + V    AQ  A+  G   L F   SAK    V   F+EI  +  Q+ +
Sbjct: 126 KVDV---EESKKVVSSRSAQEQAKSLGNVPLFF--TSAKDSINVQDAFEEIARSALQQSQ 180

Query: 177 GAATAASPQARKTPNVKLQ-RPST 199
             A A      +  N++L   PS+
Sbjct: 181 SDADAYEDDLSEAINIQLDGEPSS 204

>Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement
          Length = 213

 Score =  107 bits (267), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 96/172 (55%), Gaps = 9/172 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  +T+ +   +   IK ++WDTA
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKK---IKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A   ++VYDVT   +    + W+  +     D+  ++ LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTVNQHANDEAQLL-LVGNKSD 136

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQK 175
           + T     R V  E  +  ++E GL F E SAK    V  IF  + + + +K
Sbjct: 137 MDT-----RAVTYEQGEALSKELGLPFVEASAKNDDNVNEIFFTLAKLIQEK 183

>Sklu_1136.1 YGL210W, Contig c1136 1284-1832
          Length = 182

 Score =  105 bits (263), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 101/179 (56%), Gaps = 18/179 (10%)

Query: 33  ESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAG 92
           +STIG  F ++TI++E  +   IK +IWDTAGQERY+++   YYR A  AL+VYD++++ 
Sbjct: 4   KSTIGVEFATRTIEVEGKK---IKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSN 60

Query: 93  SLVKAQSWVEELKNKVGDQDLVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHE 152
           S      W+ EL+    D+++ + L+GNK DL       R V  ++A+ +AQE  LLF E
Sbjct: 61  SYENCNHWLTELREN-ADENVAVGLIGNKSDLAHL----RAVPTDEAKNFAQENQLLFTE 115

Query: 153 VSAKTGSGVAAIFQEIGENVYQ---------KKGAATAASPQARKTPNVKLQRPSTNDS 202
            SA     V   F+E+   +YQ          +  +++ S  A + P + L  P+ N++
Sbjct: 116 TSALNSENVDLAFRELITAIYQMVSKHQVDLNEYGSSSGSGAAPRGPTISLT-PAPNET 173

>Kwal_47.19055
          Length = 179

 Score =  105 bits (262), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 86/142 (60%), Gaps = 8/142 (5%)

Query: 33  ESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAG 92
           +STIG  F ++TI++E  +   IK +IWDTAGQERY+++   YYR A  AL+VYD++++ 
Sbjct: 4   KSTIGVEFATRTIEVEGKK---IKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSS 60

Query: 93  SLVKAQSWVEELKNKVGDQDLVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHE 152
           S      W+ EL+    D+++ + L+GNK DL       R V  ++A+ +AQE  LLF E
Sbjct: 61  SYENCNHWLTELREN-ADENVAVGLIGNKSDLAHL----RAVPTDEAKNFAQENQLLFTE 115

Query: 153 VSAKTGSGVAAIFQEIGENVYQ 174
            SA     V   F+E+   +YQ
Sbjct: 116 TSALNSENVDQAFRELISAIYQ 137

>YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein
           involved in vesicular transport between Golgi and plasma
           membrane, member of the rab family in the ras
           superfamily [648 bp, 215 aa]
          Length = 215

 Score =  105 bits (261), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 97/172 (56%), Gaps = 9/172 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +T+ +   +   +K ++WDTA
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKK---VKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A   ++VYDVT   +    + W + +     D+  ++ LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLL-LVGNKSD 136

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQK 175
           + T     R V  +  +  A+E G+ F E SAK    V  IF  + + + +K
Sbjct: 137 MET-----RVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEK 183

>AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH]
           complement(681760..682398) [639 bp, 212 aa]
          Length = 212

 Score =  104 bits (259), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 108/202 (53%), Gaps = 10/202 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  + + +   +   IK ++WDTA
Sbjct: 20  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKAVDINGKK---IKLQLWDTA 76

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQER++++   YYR A   ++VYDVT   +    + W   + N+  +++  + LVGNK D
Sbjct: 77  GQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTV-NQHANEEAQLLLVGNKKD 135

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           + T     R V  E  +  A+E G+ F E SAK    V+ IF  + + + +K       +
Sbjct: 136 MDT-----RAVTYEQGESLAKELGVPFIEASAKDDENVSDIFFTLAKLIQEKIDNDKLVN 190

Query: 184 PQARKTPNVKLQRPSTNDSTSC 205
              R+  +V +   S   S++C
Sbjct: 191 NSGRE-GSVNISSGSNMPSSNC 211

>Kwal_33.14015
          Length = 271

 Score = 85.1 bits (209), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 86/166 (51%), Gaps = 7/166 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
             K+V++GD +VGK+ ++  + +     F E  I   F +   K++  ++  ++  +WDT
Sbjct: 65  HLKIVVVGDGAVGKTCLLISYTQG---HFPEEYIPTVFENYVTKMKGPDNTVVELALWDT 121

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGNK 121
           AGQE Y  L P+ Y + +  +V Y V    SL+  Q  W+ E+++   D    I LVG K
Sbjct: 122 AGQEEYNRLRPLSYTDVDLLMVCYSVDSKTSLLNVQELWIPEVRHFCPDTP--ILLVGLK 179

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQEQGLLFH-EVSAKTGSGVAAIFQ 166
            DL   +   + V+  +A ++A E  LL H + S+K+   V  +F 
Sbjct: 180 SDLYALDNLDKLVDPGEADLFATEHNLLGHYQCSSKSRQNVEELFN 225

>Scas_610.4
          Length = 211

 Score = 81.6 bits (200), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 89/175 (50%), Gaps = 16/175 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F E    T+   +++      + +   ++  +WD
Sbjct: 9   IRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWD 64

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQ-SWVEELKNKVGDQDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +    SL   Q  W+ E+ +    Q + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 121 KLDL--------CTEEEGGRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAAIFQ 166
           K+DL           EEG + V   D Q  A + G   ++E SAKTG GV  +F+
Sbjct: 123 KVDLRNDPQTIEALREEGQQPVSSADGQSVADQIGATGYYECSAKTGFGVREVFE 177

>CAGL0J05632g complement(537342..537908) highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2, start by
           similarity
          Length = 188

 Score = 81.3 bits (199), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 90/168 (53%), Gaps = 9/168 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ KLV++GD + GK+S+++ F    F E    T+   +++      + + + +   +WD
Sbjct: 6   IRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDC----RVDGIKVSLALWD 61

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGN 120
           TAGQE Y+ L P  Y  A+  L+ + V    SL  A++ W EE      D  ++  LVG 
Sbjct: 62  TAGQEEYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEEAFRYCPDAPVI--LVGL 119

Query: 121 KLDLC-TEEEGGRGVEKEDAQMYAQEQGL-LFHEVSAKTGSGVAAIFQ 166
           K DL  +++EG   V +EDA+  A+  G   + E SA TG GV  +F+
Sbjct: 120 KEDLRKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGVDDVFE 167

>YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a
           GTP-binding protein member of the ras superfamily
           involved in trafficking through nuclear pores [663 bp,
           220 aa]
          Length = 220

 Score = 81.6 bits (200), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 94/191 (49%), Gaps = 12/191 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKLVL+GD   GK++ V R +   F++   +TIG      +      E   IKF++WDTA
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGE---IKFDVWDTA 70

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQE++  L   YY NA  A++++DVT   +     +W  +L     +  +V+C  GNK+D
Sbjct: 71  GQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKVD 128

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           +   +   + +       + +++ L ++++SAK+       F  +   +         AS
Sbjct: 129 VKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVAS 182

Query: 184 PQARKTPNVKL 194
           P A   P V++
Sbjct: 183 P-ALAPPEVQV 192

>YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a
           GTP-binding protein of the ras superfamily involved in
           trafficking through nuclear pores [660 bp, 219 aa]
          Length = 219

 Score = 81.6 bits (200), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 94/191 (49%), Gaps = 12/191 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKLVL+GD   GK++ V R +   F++   +TIG      +      E   IKF++WDTA
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGE---IKFDVWDTA 69

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQE++  L   YY NA  A++++DVT   +     +W  +L     +  +V+C  GNK+D
Sbjct: 70  GQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKVD 127

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           +   +   + +       + +++ L ++++SAK+       F  +   +         AS
Sbjct: 128 VKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVAS 181

Query: 184 PQARKTPNVKL 194
           P A   P V++
Sbjct: 182 P-ALAPPEVQV 191

>CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomyces
           cerevisiae YLR293c GSP1, start by similarity
          Length = 214

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 95/192 (49%), Gaps = 14/192 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDV-TIKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG     +   L  H +   IKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFHTNFGEIKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     +W  +L     +  +V+C  GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKV 121

Query: 123 DLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAA 182
           D+   +   + +       + +++ L ++++SAK+       F  +   +         A
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVA 175

Query: 183 SPQARKTPNVKL 194
           SP A   P V++
Sbjct: 176 SP-ALAPPEVQV 186

>Scas_578.7
          Length = 187

 Score = 79.7 bits (195), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 87/164 (53%), Gaps = 8/164 (4%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KLV++GD + GK+S+++ F    F +    T+   +++      + + + +   +WDTAG
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPQEYHPTVFENYVTDC----RVDGIKVSLTLWDTAG 64

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGNKLD 123
           QE Y+ L P  Y  A+  L+ + +    SL  A++ W EE      +  ++  LVG K D
Sbjct: 65  QEEYERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYCPEAPII--LVGLKKD 122

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGL-LFHEVSAKTGSGVAAIFQ 166
           L  +++G   V+ EDAQ  A+  G   + E SA TG GV  +F+
Sbjct: 123 LRQKQDGVEMVKPEDAQQVARIIGAKKYVECSALTGEGVDDVFE 166

>YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein
           required to activate the PKC1 pathway and
           beta-1,3-glucan synthase and to coordinate exocyst
           assembly, member of the rho family of the ras
           superfamily [630 bp, 209 aa]
          Length = 209

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 16/175 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F E    T+   +++      + +   ++  +WD
Sbjct: 9   IRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWD 64

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQ-SWVEELKNKVGDQDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +    SL   Q  W+ E+ +    Q + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 121 KLDLCTE--------EEGGRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAAIFQ 166
           K+DL  +        +EG + V  ++ Q  A + G   ++E SAKTG GV  +F+
Sbjct: 123 KVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFE 177

>ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH]
           complement(754517..755146) [630 bp, 209 aa]
          Length = 209

 Score = 79.3 bits (194), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 91/187 (48%), Gaps = 16/187 (8%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++  + ++      ++  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLVVFSKGQFPEIHVPTVFENYVAD-VDIDGRR---VELALWDTAG 67

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQ-SWVEELKNKVGDQDLVICLVGNKLD 123
           QE Y  L P+ Y ++N  L+ + V    SL   Q  WV E+ +    Q + I LVG K+D
Sbjct: 68  QEDYDRLRPLSYPDSNVVLICFSVDLPDSLDNVQEKWVSEVLHFC--QGVPILLVGCKVD 125

Query: 124 LCTEE--------EGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQ 174
           L  +         EG R V   +    A + G + + E SA+TG GV  +F         
Sbjct: 126 LRNDPQVLQQLQAEGQRPVTAAEGSAVAGKIGAVAYLECSARTGQGVKEVFDTATRAALS 185

Query: 175 KKGAATA 181
            K AA+A
Sbjct: 186 GKPAASA 192

>AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C
           (GSP1) - SH] (1287042..1287686) [645 bp, 214 aa]
          Length = 214

 Score = 79.3 bits (194), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 92/191 (48%), Gaps = 12/191 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKLVL+GD   GK++ V R +   F++   +TIG             E   IKF++WDTA
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE---IKFDVWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQE++  L   YY NA   ++++DVT   +     +W  +L     +  +V+C  GNK+D
Sbjct: 65  GQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKVD 122

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           +   +   + +       + +++ L ++++SAK+       F  +   +         AS
Sbjct: 123 VKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDFVAS 176

Query: 184 PQARKTPNVKL 194
           P A   P V++
Sbjct: 177 P-ALAPPEVQV 186

>KLLA0C05126g complement(463657..464301) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 79.3 bits (194), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 92/191 (48%), Gaps = 12/191 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKLVL+GD   GK++ V R +   F++   +TIG             E   IKF++WDTA
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE---IKFDVWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQE++  L   YY NA   ++++DVT   +     +W  +L     +  +V+C  GNK+D
Sbjct: 65  GQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKVD 122

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           +   +   + +       + +++ L ++++SAK+       F  +   +         AS
Sbjct: 123 VKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDFVAS 176

Query: 184 PQARKTPNVKL 194
           P A   P V++
Sbjct: 177 P-ALAPPEVQV 186

>KLLA0A04499g complement(404732..405376) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 79.3 bits (194), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 92/191 (48%), Gaps = 12/191 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKLVL+GD   GK++ V R +   F++   +TIG             E   IKF++WDTA
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE---IKFDVWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQE++  L   YY NA   ++++DVT   +     +W  +L     +  +V+C  GNK+D
Sbjct: 65  GQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKVD 122

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           +   +   + +       + +++ L ++++SAK+       F  +   +         AS
Sbjct: 123 VKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDFVAS 176

Query: 184 PQARKTPNVKL 194
           P A   P V++
Sbjct: 177 P-ALAPPEVQV 186

>Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement
          Length = 214

 Score = 79.3 bits (194), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 92/191 (48%), Gaps = 12/191 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKLVL+GD   GK++ V R +   F++   +TIG             E   IKF++WDTA
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE---IKFDVWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQE++  L   YY NA   ++++DVT   +     +W  +L     +  +V+C  GNK+D
Sbjct: 65  GQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKVD 122

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           +   +   + +       + +++ L ++++SAK+       F  +   +         AS
Sbjct: 123 VKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVAS 176

Query: 184 PQARKTPNVKL 194
           P A   P V++
Sbjct: 177 P-ALAPPEVQV 186

>CAGL0I08459g 829292..829924 highly similar to sp|P06780
           Saccharomyces cerevisiae YPR165w RHO1, start by
           similarity
          Length = 210

 Score = 79.0 bits (193), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 89/175 (50%), Gaps = 16/175 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F E    T+   +++      + +   ++  +WD
Sbjct: 9   IRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWD 64

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQ-SWVEELKNKVGDQDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +    SL   Q  W+ E+ +    Q + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 121 KLDLCTEE--------EGGRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAAIFQ 166
           K+DL  +         EG + V   D Q  A + G   ++E SAKTG GV  +F+
Sbjct: 123 KVDLRNDPQTLEQLRAEGLQPVATADGQNVADQIGATGYYECSAKTGYGVREVFE 177

>Scas_586.6
          Length = 219

 Score = 79.0 bits (193), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 92/191 (48%), Gaps = 12/191 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKLVL+GD   GK++ V R +   F++   +TIG      +      E   IKF+ WDTA
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNYGE---IKFDCWDTA 69

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQE++  L   YY NA   ++++DVT   +     +W  +L     +  +V+C  GNK+D
Sbjct: 70  GQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKVD 127

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           +   +   + +       + +++ L ++++SAK+       F  +   +         AS
Sbjct: 128 VKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVAS 181

Query: 184 PQARKTPNVKL 194
           P A   P V++
Sbjct: 182 P-ALAPPEVQV 191

>Kwal_56.23361
          Length = 214

 Score = 79.0 bits (193), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 93/191 (48%), Gaps = 12/191 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           FKLVL+GD   GK++ V R +   F++   +TIG          +  E   +KF++WDTA
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTDFGE---LKFDVWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQE++  L   YY NA   ++++DVT   +     +W  +L     +  +V+C  GNK+D
Sbjct: 65  GQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKVD 122

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAAS 183
           +   +   + +       + +++ L ++++SAK+       F  +   +         AS
Sbjct: 123 VKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDFVAS 176

Query: 184 PQARKTPNVKL 194
           P A   P V++
Sbjct: 177 P-ALAPPEVQV 186

>Sklu_2151.4 , Contig c2151 3640-4263 reverse complement
          Length = 207

 Score = 78.6 bits (192), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 86/172 (50%), Gaps = 16/172 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++      +H ++T+    WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVTDVEVDGRHVELTL----WDTAG 67

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQ-SWVEELKNKVGDQDLVICLVGNKLD 123
           QE Y  L P  Y ++N  L+ + +    SL   Q  W+ E+      + + I LVG K+D
Sbjct: 68  QEDYDRLRPFSYPDSNVVLICFSIDLPDSLDNVQEKWINEVLYFC--KGVPIILVGCKVD 125

Query: 124 LCTEEE--------GGRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAAIFQ 166
           L  + +        G R V   D Q  A   G + ++E SAK+G GV  +F+
Sbjct: 126 LRDDTQTIETLKAIGQRPVSTTDGQTVADRIGAVGYYECSAKSGLGVREVFE 177

>KLLA0C13816g 1183412..1183975 highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2 GTP-binding
           protein of the RHO subfamily of RAS-like proteins, start
           by similarity
          Length = 187

 Score = 77.8 bits (190), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 87/164 (53%), Gaps = 8/164 (4%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KLV++GD + GK+S+++ F    F E    T+   +++      + + + ++  +WDTAG
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENYVTDC----RVDGIKVQLTLWDTAG 64

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGNKLD 123
           QE Y+ L P  Y  A+  L+ + +    SLV A++ W EE+     +  +V  LVG K D
Sbjct: 65  QEEYERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYCPEAPVV--LVGLKKD 122

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGL-LFHEVSAKTGSGVAAIFQ 166
           L + +   + V +E A+  A+  G   + E SA TG  V  +F+
Sbjct: 123 LRSPDNEHQMVTREQAEQVARAIGAKKYMECSALTGENVDDVFE 166

>Sklu_1816.1 YNL090W, Contig c1816 115-681
          Length = 188

 Score = 77.4 bits (189), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 89/171 (52%), Gaps = 13/171 (7%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           +++ KLV++GD + GK+S+++ F    F E    T+   +++      + + + ++  +W
Sbjct: 5   VVRRKLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVTDC----RVDGIKVQLALW 60

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVG 119
           DTAGQE Y+ L P  Y  AN  L+ + +    SL+ A++ W EE         +V  LVG
Sbjct: 61  DTAGQEEYERLRPFSYSKANIILIGFAIDDPESLMNARTKWTEEALRYCPTAPIV--LVG 118

Query: 120 NKLDLCTEEEGGRG---VEKEDAQMYAQEQGL-LFHEVSAKTGSGVAAIFQ 166
            K DL   +  G G   V +E A+  A+  G   + E SA TG GV  IF+
Sbjct: 119 LKKDL--RKSVGNGEEVVTREAAEQVARAIGAKRYMECSALTGEGVDDIFE 167

>Kwal_55.21937
          Length = 208

 Score = 77.4 bits (189), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 90/172 (52%), Gaps = 16/172 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++  ++++  +   ++  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVAD-VQVDGRQ---VELALWDTAG 67

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQ-SWVEELKNKVGDQDLVICLVGNKLD 123
           QE Y  L P+ Y ++N  L+ + +    SL   Q  W+ E+ +    Q + I LVG K+D
Sbjct: 68  QEDYDRLRPLSYPDSNVVLICFSIDLPDSLDNVQEKWIAEVMHFC--QGVPIILVGCKVD 125

Query: 124 LCTEEE--------GGRGVEKEDAQMYAQEQGL-LFHEVSAKTGSGVAAIFQ 166
           L    +        G + V   +AQ  A + G   ++E SAKTG GV  +F+
Sbjct: 126 LRDNPQTVEALRAIGQQPVTGPEAQSVADKIGASAYYECSAKTGYGVREVFE 177

>ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH]
           (808667..809446) [780 bp, 259 aa]
          Length = 259

 Score = 77.8 bits (190), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 84/165 (50%), Gaps = 7/165 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + K+V++GD + GK+S++  + +  F E    TI   F +    +E      I+  +WDT
Sbjct: 52  RIKIVVVGDGATGKTSLLMSYTQGQFPEDYVPTI---FENYVTNIEGPRGKVIELALWDT 108

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGNK 121
           AGQE Y  L P+ Y + +  +V Y      SL  A+  W  E+++      ++  LVG K
Sbjct: 109 AGQEEYSRLRPLSYGDVDIVMVCYAADNRTSLTNAEELWFPEVRHFCPHAPMM--LVGLK 166

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQEQGLLFH-EVSAKTGSGVAAIF 165
            DL + +   R V+  DA++ A++ G   H + SAKT   +  +F
Sbjct: 167 SDLYSLDALDRLVDPTDAELVARKMGAFVHLQCSAKTRQCLEDVF 211

>Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement
          Length = 287

 Score = 77.4 bits (189), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 83/165 (50%), Gaps = 7/165 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
             K+V++GD +VGK+ ++  + +  F      TI   ++S   K++   +  I+  +WDT
Sbjct: 77  HLKIVVVGDGAVGKTCLLISYTQGRFPTEYVPTIFENYVS---KVQGPRNKVIELALWDT 133

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGNK 121
           AGQE Y  L P+ Y + +  +V Y V    S    Q  W  E+K+   D  ++  LVG K
Sbjct: 134 AGQEEYNRLRPLSYTDVDILMVCYSVDSKTSFYNVQELWFPEVKHFCPDAPVM--LVGLK 191

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQEQGLLFH-EVSAKTGSGVAAIF 165
            DL   +   + V+ +DA   AQ+ G   H + SAK+   V  +F
Sbjct: 192 SDLYALDNLEQLVDPKDADTLAQQLGAFAHVQCSAKSRDNVDEVF 236

>YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein,
           member of the rho family in the ras superfamily [579 bp,
           192 aa]
          Length = 192

 Score = 75.1 bits (183), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 84/169 (49%), Gaps = 13/169 (7%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KLV++GD + GK+S+++ F    F E    T+   +++      + + + +   +WDTAG
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDC----RVDGIKVSLTLWDTAG 64

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGNKLD 123
           QE Y+ L P  Y  A+  L+ + V    SL+ A++ W +E      D  +V  LVG K D
Sbjct: 65  QEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYCPDAPIV--LVGLKKD 122

Query: 124 L-----CTEEEGGRGVEKEDAQMYAQEQGL-LFHEVSAKTGSGVAAIFQ 166
           L       E      V  EDA+  A+  G   + E SA TG GV  +F+
Sbjct: 123 LRQEAHFKENATDEMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFE 171

>Scas_691.36
          Length = 212

 Score = 75.5 bits (184), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 16/172 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++      + +   ++  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWDTAG 67

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGNKLD 123
           QE Y  L P+ Y ++N  L+ + +    SL   Q  W+ E+ +    Q + I LVG K+D
Sbjct: 68  QEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGCKVD 125

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQG---------LLFHEVSAKTGSGVAAIFQ 166
           L  + +    +  ++ Q  +  +G           ++E SAKTG GV  +F+
Sbjct: 126 LRNDPQAIEALRADEQQPVSTAEGQSVAEQIGATGYYECSAKTGLGVREVFE 177

>ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH]
           (191573..192136) [564 bp, 187 aa]
          Length = 187

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 83/168 (49%), Gaps = 8/168 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           +++ KLV++GD + GK+S++H F    F E    T+   +++      + + + ++  +W
Sbjct: 5   VVRRKLVIIGDGACGKTSLLHVFTLGKFPEEYLPTVFENYVTDC----RVDGIKVQLALW 60

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDLVICLVG 119
           DTAGQE Y+ L PM Y  A+  L+ + +   GSL  A + W  E      +  ++  LVG
Sbjct: 61  DTAGQEEYERLRPMSYSKADIILIGFAIDDPGSLSNAREKWTVEALRYCPNAPII--LVG 118

Query: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQGL-LFHEVSAKTGSGVAAIFQ 166
            K DL         V    AQ   +  G   + E SA TG GV  +F+
Sbjct: 119 LKKDLRRPGTQCAMVAPSQAQEVVRAIGAKKYMECSALTGEGVDDVFE 166

>KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromyces
           lactis RHO1, start by similarity
          Length = 208

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 90/175 (51%), Gaps = 16/175 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F +    T+   +++      + +   ++  +WD
Sbjct: 11  IRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWD 66

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ Y +    SL    + W+ E+ +    Q + I LVG 
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGC 124

Query: 121 KLDL-----CTEE---EGGRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAAIFQ 166
           K DL       EE   +G + V +  AQ  A + G + + E SAKTG GV  +F+
Sbjct: 125 KADLRNDPQVVEELRAQGLQPVSQAQAQEVADQIGAVDYIECSAKTGYGVREVFE 179

>ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH]
           complement(755914..756537) [624 bp, 207 aa]
          Length = 207

 Score = 74.7 bits (182), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 87/172 (50%), Gaps = 16/172 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F +    T+   +++      + +   ++  +WDTAG
Sbjct: 13  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWDTAG 68

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDLVICLVGNKLD 123
           QE Y  L P+ Y ++N  L+ Y +    SL    + W+ E+      Q + I LVG K D
Sbjct: 69  QEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLYFC--QGVPIILVGCKAD 126

Query: 124 LCTE--------EEGGRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAAIFQ 166
           L  +        ++G + V +  AQ  A + G + + E SAKTG GV  +F+
Sbjct: 127 LRNDPQVIEQLRQQGQQPVSQAQAQEVADQIGAVEYIECSAKTGFGVREVFE 178

>Kwal_55.21941
          Length = 209

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 90/175 (51%), Gaps = 16/175 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F +    T+   +++      + +   ++  +WD
Sbjct: 11  IRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWD 66

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +    SL    + W+ E+ +    Q + I LVG 
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGC 124

Query: 121 KLDLCTEEE--------GGRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAAIFQ 166
           K+DL  + +        G   V +  AQ  A++ G + + E SAKTG GV  +F+
Sbjct: 125 KVDLRNDSQVIENLRANGHEPVSQGAAQEVAEQIGAVEYIECSAKTGYGVREVFE 179

>Sklu_2345.5 YCR027C, Contig c2345 9936-10595
          Length = 219

 Score = 74.3 bits (181), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 80/153 (52%), Gaps = 5/153 (3%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           K+ ++G  +VGKSSI  +FV+  F E    TI   F S+T+KL K   V    EI DTAG
Sbjct: 27  KIAVVGARNVGKSSITVQFVESHFVESYYPTIENEF-SRTVKLGK---VMYTLEICDTAG 82

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVG-DQDLVICLVGNKLD 123
           Q+ +  +           LVVY V    S        +++ +++G D+++ + + GNK+D
Sbjct: 83  QDEFSLVNNRSLMGVAGFLVVYSVVNRHSFELVGLIRDKILDQLGLDENVPVVVAGNKID 142

Query: 124 LCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAK 156
           LC +    R V +E+ Q  A+  G  F E SAK
Sbjct: 143 LCPDGGNNRQVTREEGQQLAKSLGAGFSECSAK 175

>Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement
          Length = 209

 Score = 74.3 bits (181), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 89/175 (50%), Gaps = 16/175 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F +    T+   +++      + +   ++  +WD
Sbjct: 11  IRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWD 66

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +    SL    + W+ E+ +    Q + I LVG 
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGC 124

Query: 121 KLDLCTEEE--------GGRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAAIFQ 166
           K+DL  + +        G   V +  AQ  A + G + + E SAKTG GV  +F+
Sbjct: 125 KVDLRNDPQVVESLRTNGQEPVSQASAQEVADQIGAVEYIECSAKTGFGVREVFE 179

>Scas_444.4*
          Length = 289

 Score = 74.7 bits (182), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 83/167 (49%), Gaps = 8/167 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
              K+V++GD  VGK+ ++  +V+    EF    I   F +     E  +   ++  +WD
Sbjct: 62  FHVKIVIVGDEGVGKTCLLISYVQR---EFPTGDIPTVFENYVTDFEGPDGEVVELALWD 118

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVK-AQSWVEELKNKVGDQDLVICLVGN 120
           TA QE Y  L P+ Y + +  LV Y V    SL    +SW+ E+K+      ++  LVG 
Sbjct: 119 TAAQEDYNRLRPLSYTDVDILLVCYSVANPTSLKNIKRSWIPEVKHFCYKTPVI--LVGL 176

Query: 121 KLDLC-TEEEGGRGVEKEDAQMYAQEQGLLFH-EVSAKTGSGVAAIF 165
           K DL  + E     V+ ++A+  A++ G L H + SAKT   V  +F
Sbjct: 177 KSDLYDSNENTDTLVDPKEAEQLAEKLGALAHLQCSAKTRQNVEDVF 223

>YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein,
           member of the rho family in the ras superfamily [876 bp,
           291 aa]
          Length = 291

 Score = 74.3 bits (181), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 91/195 (46%), Gaps = 13/195 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
             K+V++GD +VGK+ ++  +V+ +F      TI   F +    +E      I+  +WDT
Sbjct: 72  HLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTI---FENYVTNIEGPNGQIIELALWDT 128

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGNK 121
           AGQE Y  L P+ Y NA+  +V Y V    SL   +  W  E+K+        I LVG K
Sbjct: 129 AGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTP--IMLVGLK 186

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQEQGLLFH-EVSAKTGSGVAAIFQE-----IGENVY-Q 174
            DL   +     VE   A+  A+  G   H + SA+    +  +F+      + +++Y  
Sbjct: 187 SDLYEADNLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLLSDSLYAP 246

Query: 175 KKGAATAASPQARKT 189
           ++   T  +P  R T
Sbjct: 247 REPTHTIKNPFKRNT 261

>KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 254

 Score = 71.6 bits (174), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 89/191 (46%), Gaps = 25/191 (13%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEK-----HEDVTI 55
           M   K V++GD +VGK+S++  +  ++F +    T+   + S TI L        E    
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALPDPYNPDSEPQIF 59

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQD-- 112
           K  +WDTAGQE Y  L P+ Y   +  L+ + V +  S       W  E+K+    ++  
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSVNEPNSFENVYDKWFPEIKHSTNFENLD 119

Query: 113 -------LVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQ--------GLL-FHEVSAK 156
                  L I LVG K DL  ++     +++ ++   +Q+Q        GL+ + E SA 
Sbjct: 120 LYHQSGKLPILLVGTKADLRDDDHERDRLQESNSDFVSQQQIQELVNKLGLMGYVECSAA 179

Query: 157 TGSGVAAIFQE 167
           T  GV  +F++
Sbjct: 180 TQVGVREVFEK 190

>Scas_677.20
          Length = 283

 Score = 72.0 bits (175), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 99/226 (43%), Gaps = 24/226 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLE-----KHEDVTI 55
           M   K  ++GD  VGK+ ++  +  ++F      T+   + S TI L      K E    
Sbjct: 1   MRSIKCTVIGDGCVGKTCLLISYTTNTFPNEYVPTVFDNY-STTITLPPVGKGKEEPEYY 59

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLV 114
           K  +WDTAGQ+ Y +L P+ Y   +  ++ + V    SL   +S WV E+KN   + +L 
Sbjct: 60  KLNLWDTAGQDDYDTLRPLSYPQTDIFIICFAVNDLVSLDNVKSKWVPEIKNSFNEDELK 119

Query: 115 I---------CLVGNKLDLCTEEE-GGRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAA 163
           +          LVG K D   ++E  G+    E  Q    + G + + E SA +  G+  
Sbjct: 120 VFQSRNRFPMLLVGTKADTRYDDEIDGKFATNETIQSVVDQCGFVGYVECSALSQMGIKD 179

Query: 164 IFQE------IGENVYQKKGAATAASPQARKTPNVKLQRPSTNDST 203
           +F+E       G+ +   +  A AA      + N  L  P +  ST
Sbjct: 180 VFEEAVKAVVYGDGIETPERGAMAAQKTRTTSTNTALDVPVSGVST 225

>KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces
           cerevisiae YKR055w RHO4 GTP-binding protein of the rho
           family, hypothetical start
          Length = 218

 Score = 70.5 bits (171), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 81/165 (49%), Gaps = 7/165 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
             K+V++GD +VGK+S++  + +  F E    TI   F +    LE      ++  +WDT
Sbjct: 31  HLKIVVVGDGAVGKTSLLISYTQGKFPEDYVPTI---FENYVTNLEGPNGKIVELALWDT 87

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGNK 121
           AGQE Y  L P+ Y + +  ++ Y +    S    +  W+ E+K+     D+ I +VG K
Sbjct: 88  AGQEEYSRLRPLSYTDVDVLMICYAINSKVSFYNIEEMWLPEVKHFC--PDVPIMIVGLK 145

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQEQGLLFH-EVSAKTGSGVAAIF 165
            DL  E+     V+   A+  A+  G   H + S+K+   V  +F
Sbjct: 146 SDLYAEDNISDFVDAFKAEETAKRIGAFVHLQCSSKSQQKVREVF 190

>CAGL0K08316g 838393..839364 some similarities with sp|Q00246
           Saccharomyces cerevisiae YKR055w RHO4 GTP-binding
           protein, hypothetical start
          Length = 323

 Score = 71.6 bits (174), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 81/165 (49%), Gaps = 7/165 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
             K+V++GD +VGK+S++  +V+  F   +   I   F +    ++  +   I+  +WDT
Sbjct: 83  HLKIVVVGDGAVGKTSLLISYVEKVF---KHENIPTIFENYVTNIQGPKGQIIELALWDT 139

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGNK 121
           AGQE Y  L P+ Y  A+  ++ Y +    SL   +  W  E+++      ++  LVG K
Sbjct: 140 AGQEEYSRLRPLSYTGADVLMICYAIDSITSLKNVEDVWFPEVRHFCPGTPVM--LVGLK 197

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQEQGLLFH-EVSAKTGSGVAAIF 165
            DL  EE     V+  +A   A++ G   H + SAK    V  +F
Sbjct: 198 SDLYEEESCDSKVDPAEADSIAKKNGAFAHIQCSAKLRVKVDNVF 242

>AER132W [2636] [Homologous to ScYML064C (TEM1) - SH]
           complement(888052..888750) [699 bp, 232 aa]
          Length = 232

 Score = 69.3 bits (168), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 82/168 (48%), Gaps = 6/168 (3%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + I L   +   + F I D
Sbjct: 14  VKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTD---VIFSIMD 70

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNK 121
             GQ  + ++ P+    A A + ++D+T+  +L   + W  + +    ++  +  LVG K
Sbjct: 71  LGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYRQARG--FNETAIPLLVGTK 128

Query: 122 LDLCTEEEGGRGVEKEDAQM-YAQEQGLLFHEVSAKTGSGVAAIFQEI 168
            DL    +     E     M YAQ  G      S  +   V  IF+ I
Sbjct: 129 YDLFVNLDVAYQEELSKTSMRYAQVMGAPLVFCSTASSINVQKIFKVI 176

>KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya
           gossypii Rho3, start by similarity
          Length = 223

 Score = 68.6 bits (166), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 84/189 (44%), Gaps = 29/189 (15%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F +  E TI   ++       +H    I   +WD
Sbjct: 13  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTIFENYIHDIFVDNQH----ISLSLWD 68

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGN 120
           TAGQE +  L  + Y + +  ++ + V    SL   Q+ WV E+ +      LV  LV  
Sbjct: 69  TAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVQNKWVGEIADHCEGVKLV--LVAL 126

Query: 121 KLDLCTEEEGG-------------RGVEKEDAQMYAQEQG---------LLFHEVSAKTG 158
           K DL   EE G             R    +D  + + E+G         L + E SAK  
Sbjct: 127 KCDLRNLEEFGNESAAITPGSIQNRNSNAKDNGLISYEEGLDMAKKIGALRYLECSAKMN 186

Query: 159 SGVAAIFQE 167
            GV   F E
Sbjct: 187 RGVNEAFTE 195

>Kwal_33.14452
          Length = 260

 Score = 68.9 bits (167), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 86/188 (45%), Gaps = 23/188 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKL---EKHEDVTIKF 57
           M   K V++GD +VGK+S++  +  ++F +    T+   + + TI L   +  E    + 
Sbjct: 1   MRSVKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-TTTIALNDGDSAEPQVFRL 59

Query: 58  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDL--- 113
            +WDTAGQE Y  L P+ Y   +  L+ + + +  S    +  W  E+++    ++L   
Sbjct: 60  NLWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFENVKDKWFPEIRHNTNYENLELF 119

Query: 114 ------VICLVGNKLDLCTEEE--------GGRGVEKEDAQMYAQEQGLL-FHEVSAKTG 158
                  I LVG K DL  +E             V + D      + GL+ + E SA T 
Sbjct: 120 RVCGKYPILLVGTKADLRDDEHEQDRLAEVNSDFVSRGDIDQCVSQCGLMGYVECSAATQ 179

Query: 159 SGVAAIFQ 166
            GVA +F+
Sbjct: 180 VGVADVFE 187

>Scas_417.3
          Length = 291

 Score = 69.3 bits (168), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 93/199 (46%), Gaps = 32/199 (16%)

Query: 1   MLQFKLVLLGDSSVGKSSIV---------HRFVKDSFDEFRES-TIGAAFLSQTIKLEKH 50
           M Q K V++GD +VGK+S++           ++   FD +  + ++   FLS+     ++
Sbjct: 1   MRQIKTVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYSTTISLRDPFLSRESLANEN 60

Query: 51  EDVTI---KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVK-AQSWVEELKN 106
           E+  +   K  +WDTAGQE Y  L P+ Y   +  L+ + V +  S       W+ E+K 
Sbjct: 61  ENDHLELFKLNLWDTAGQEEYDRLRPLSYPQTDVFLICFSVAELSSFENVVDKWLPEIKQ 120

Query: 107 KVGDQD---------LVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQ--------GLL 149
               +          L I L+G K DL  +E   + +++ ++Q   ++Q        G L
Sbjct: 121 NANVESSELFLQFGKLPIMLIGTKADLRDDEAVQKKLQETNSQFITRDQIDQVVDKYGFL 180

Query: 150 -FHEVSAKTGSGVAAIFQE 167
            + E SA T  GV  +F++
Sbjct: 181 GYVECSAATQMGVREVFEK 199

>Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement
          Length = 261

 Score = 67.0 bits (162), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 87/196 (44%), Gaps = 25/196 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVT-----I 55
           M   K V++GD +VGK+S++  +  ++F +    T+   + S TI L    D++      
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALADPSDLSAEQEVF 59

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDL- 113
           K  +WDTAGQE Y  L P+ Y   +  ++ + V +  S       W  E+++    +++ 
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFIICFSVNEPSSFENVIDKWFPEIRHNTNYENME 119

Query: 114 --------VICLVGNKLDLCTEEE--------GGRGVEKEDAQMYAQEQGLL-FHEVSAK 156
                    I LVG K DL  +E             V++ +      + G + + E SA 
Sbjct: 120 LFSSCGKFPILLVGTKADLREDEHELDRLRELNSDFVDRHEIDHAVSKCGFMGYVECSAA 179

Query: 157 TGSGVAAIFQEIGENV 172
           T  GV  +F+   E V
Sbjct: 180 TQFGVREVFERAVECV 195

>ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH]
           complement(258349..259023) [675 bp, 224 aa]
          Length = 224

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 93/213 (43%), Gaps = 32/213 (15%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F +  E T+   ++       +H    I   +WD
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIHDIFVDNQH----ITLSLWD 69

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGN 120
           TAGQE +  L  + Y + +  ++ + V    SL   ++ WV E+ +      LV  LV  
Sbjct: 70  TAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVKNKWVSEIADHCEGVKLV--LVAL 127

Query: 121 KLDLCTEEE--------------------GGRGVEKEDAQMYAQEQ--GLLFHEVSAKTG 158
           K DL + +E                    GG G+   D  +   +Q   L + E SAK  
Sbjct: 128 KCDLRSSDEYGNESAITPGSIQNQKYNGGGGNGLIPYDEGLAMAKQIGALRYLECSAKMN 187

Query: 159 SGVAAIFQEIGENVY--QKKGAATAASPQARKT 189
            GV   F E          KGA  +A P+A  +
Sbjct: 188 RGVNEAFTEAARCALTATPKGARDSA-PEAESS 219

>Scas_703.41
          Length = 225

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 68/119 (57%), Gaps = 7/119 (5%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQER 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + +KL   +   I F + D  GQ+ 
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLHSTD---IVFSLMDLGGQKE 81

Query: 68  YKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVI-CLVGNKLDLC 125
           + ++ P+    ++  + ++D+T+  +L   + W  ++K   G  D+ I  LVG K DL 
Sbjct: 82  FINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVK---GLNDIAIPILVGTKYDLL 137

>YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein
           involved in regulation of cAMP pathway, homolog of
           mammalian proto-oncogene ras [930 bp, 309 aa]
          Length = 309

 Score = 67.0 bits (162), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 98/194 (50%), Gaps = 10/194 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           + ++K+V++G   VGKS++  +F++  F +  + TI  ++  Q +  +K   V+I  +I 
Sbjct: 8   IREYKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVVIDDK---VSI-LDIL 63

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV-ICLVG 119
           DTAGQE Y ++   Y R     L+VY VT   S  +  S+ ++++ +V D D + + +VG
Sbjct: 64  DTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQ-RVKDSDYIPVVVVG 122

Query: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAA 179
           NKLDL    E  R V  ED    A++    F E SAK    V   F  +   V    G  
Sbjct: 123 NKLDL----ENERQVSYEDGLRLAKQLNAPFLETSAKQAINVDEAFYSLIRLVRDDGGKY 178

Query: 180 TAASPQARKTPNVK 193
            + + Q   T  ++
Sbjct: 179 NSMNRQLDNTNEIR 192

>YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein
           involved in control of actin cytoskeleton, exocytosis,
           and beta 1,6-glucan biosynthesis, member of the rho
           family in the ras superfamily [696 bp, 231 aa]
          Length = 231

 Score = 65.5 bits (158), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 66/140 (47%), Gaps = 7/140 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F E  E T+   ++       KH    I   +WD
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDSKH----ITLSLWD 70

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGN 120
           TAGQE +  L  + Y +    ++ + +    SL   Q+ WV E+ +      LV  LV  
Sbjct: 71  TAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLV--LVAL 128

Query: 121 KLDLCTEEEGGRGVEKEDAQ 140
           K DL   E     +   + Q
Sbjct: 129 KCDLRNNENESNAITPNNIQ 148

>ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH]
           (134875..135759) [885 bp, 294 aa]
          Length = 294

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 86/190 (45%), Gaps = 25/190 (13%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVT-----I 55
           M   K V++GD +VGK+S++  +  +SF +    T+   + S TI ++     T      
Sbjct: 17  MRSIKCVVIGDGAVGKTSLLISYTTNSFPQDYIPTVFDNY-STTIAVQDPASSTGEQQLF 75

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDL- 113
           K  +WDTAGQE Y  L P+ Y   +  L+ + + +  S    +  W  E+K+    +++ 
Sbjct: 76  KLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSINEPVSFQNIRDKWFPEIKHNTNYENME 135

Query: 114 --------VICLVGNKLDLCTE--------EEGGRGVEKEDAQMYAQEQGLL-FHEVSAK 156
                    I LVG K DL  +        E     V + + +   Q+ G + + E SA 
Sbjct: 136 LFLECGKYPILLVGTKADLRDDDHEEDRLREMNTDFVSQAEIERVVQDCGFMGYVECSAA 195

Query: 157 TGSGVAAIFQ 166
           T  GV  +F+
Sbjct: 196 TQEGVREVFE 205

>Scas_671.35
          Length = 234

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 7/124 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F E  E T+   ++       KH    I   +WD
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDNKH----ITLSLWD 70

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGN 120
           TAGQE +  L  + Y + +  ++ + +    SL   Q  WV E+ +      LV  LV  
Sbjct: 71  TAGQEEFDRLRSLSYSDTHTIMLCFSIDSRDSLANVQHKWVGEIADHCEGVKLV--LVAL 128

Query: 121 KLDL 124
           K DL
Sbjct: 129 KCDL 132

>Scas_547.3
          Length = 223

 Score = 64.3 bits (155), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 70/126 (55%), Gaps = 5/126 (3%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           +Q ++ L+GD+ VGK+S++ ++ ++ FDE    T+G   L + ++++      I F + D
Sbjct: 23  IQIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSS---NIVFSLMD 79

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNK 121
             GQ+ + ++ P+   N++  + ++D+T+  SL   ++W  +      + D V  LVG K
Sbjct: 80  LGGQKEFINMLPIASVNSSVIIFLFDLTRPESLESIKNWYMQAHGL--NHDAVCILVGTK 137

Query: 122 LDLCTE 127
            DL  +
Sbjct: 138 YDLFID 143

>KLLA0B05038g complement(457608..458279) similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 223

 Score = 64.3 bits (155), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 100/208 (48%), Gaps = 33/208 (15%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + + L   +   + F I D
Sbjct: 15  VKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTD---VIFSIMD 71

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVI-CLVGN 120
             GQ  + ++ P+    A A + ++D+T+  +L   + W  + +   G  D  I  LVG 
Sbjct: 72  LGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQAR---GFNDTAISILVGT 128

Query: 121 KLDLCT--EEEGGRGVEKEDAQMYAQ--EQGLLFHEVSAKTGSGVAAIF----------- 165
           K DL    + E    V +  A  YAQ  +  L+F   S ++   V  IF           
Sbjct: 129 KYDLFVDMDPEYQENVSRT-AMKYAQVMKSPLIF--CSTQSSINVQKIFKVVIAKAFNLT 185

Query: 166 ------QEIGEN--VYQKKGAATAASPQ 185
                 ++IGE   +Y+  G +  +SP+
Sbjct: 186 LKVPEYKQIGEPLLIYKSFGPSRPSSPK 213

>CAGL0G08558g complement(804969..805652) highly similar to sp|Q00245
           Saccharomyces cerevisiae YIL118w RHO3, start by
           similarity
          Length = 227

 Score = 64.3 bits (155), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 82/192 (42%), Gaps = 24/192 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           K+V+LGD + GK+S+++ F +  F E  E T+   ++       +H    I   +WDTAG
Sbjct: 22  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDNRH----ITLSLWDTAG 77

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQDLVICLVGNKLD 123
           QE +  L  + Y + +  ++ + +    SL   ++ WV E+ +     +LV  LV  K D
Sbjct: 78  QEEFDRLRSLSYSDTHTIMLCFSIDSRDSLENVKNKWVGEITDHCEGVNLV--LVALKCD 135

Query: 124 LCTEEEG----------------GRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAAIFQ 166
           L   E                     +  E+    A++ G L + E SAK   GV   F 
Sbjct: 136 LRNNENNVITPNNIQNNRNNNNNNNLITYEEGLAMAKQIGALRYLECSAKLNKGVNEAFT 195

Query: 167 EIGENVYQKKGA 178
           E        K A
Sbjct: 196 EAARVALTAKNA 207

>Kwal_47.16983
          Length = 223

 Score = 63.9 bits (154), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 65/121 (53%), Gaps = 5/121 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K+ L+GD+ VGK+S++ ++V++ FDE    T+G   LS+ I L   E   I F I D  
Sbjct: 19  LKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLGSAE---ILFYIMDLG 75

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQ  + ++ P+    A A + ++D+T+  +L   + W  +      ++  V  LVG K D
Sbjct: 76  GQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQATG--FNEQAVPLLVGTKYD 133

Query: 124 L 124
           L
Sbjct: 134 L 134

>YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-binding
           protein involved in bud site selection, member of the
           ras family in the ras superfamily [819 bp, 272 aa]
          Length = 272

 Score = 64.3 bits (155), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 104/208 (50%), Gaps = 12/208 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +TI+++         EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY-RKTIEIDNK---VFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV-ICLVG 119
           DTAG  ++ ++  +Y ++    L+VY VT   SL +     E++  ++ D D V + L+G
Sbjct: 57  DTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL-RIKDSDRVPMVLIG 115

Query: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAAIFQEIGENVYQKKGA 178
           NK DL  E    R +  E+    + + G + F+E SA   S V  +F ++   + + +  
Sbjct: 116 NKADLINE----RVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEME 171

Query: 179 ATAASPQARKTPNV-KLQRPSTNDSTSC 205
           + A      ++    K++ PST   +S 
Sbjct: 172 SVAVKDARNQSQQFSKIESPSTRLPSSA 199

>Sklu_1653.3 YML064C, Contig c1653 2277-3047
          Length = 256

 Score = 63.5 bits (153), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 68/123 (55%), Gaps = 5/123 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + I L   + V   F I D
Sbjct: 58  VKVKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKIALGSTDVV---FSIMD 114

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNK 121
             GQ  + ++ P+    A + + ++D+T+  +L   + W  + +    ++  +  LVG K
Sbjct: 115 LGGQREFINMLPLVSEGAVSIIFLFDLTRPETLSSIKEWYRQARG--FNETAIALLVGTK 172

Query: 122 LDL 124
            DL
Sbjct: 173 YDL 175

>CAGL0E03113g complement(289164..290135) some similarities with
           sp|P13856 Saccharomyces cerevisiae YGR152c RSR1
           GTP-binding protein, start by similarity
          Length = 323

 Score = 63.9 bits (154), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 85/172 (49%), Gaps = 15/172 (8%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M  +KLV+LG   VGKSS+  +FV+  + +  + TI  ++  +TI+++         EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSSLTVQFVQGVYLDTYDPTIEDSY-RKTIEIDNK---VFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAG  ++ ++  +Y +     L+VY VT   SL +     E++      Q + + LVGN
Sbjct: 57  DTAGVAQFTAMRELYIKAGMGFLLVYSVTDRDSLRELMELKEQVLRIKDSQRVPMVLVGN 116

Query: 121 KLDLCTEE----EGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEI 168
           K DL  +     E G GV        +Q   + F+E SA   S V  +F ++
Sbjct: 117 KADLVDDRIIPVEEGIGVS-------SQWGKVPFYETSALLRSNVDEVFVDL 161

>Kwal_14.2244
          Length = 244

 Score = 63.2 bits (152), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 102/202 (50%), Gaps = 14/202 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +T++++         EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY-RKTMEIDNK---VFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAG  ++ ++  +Y ++    L+VY VT   SL +     E++     +  + + LVGN
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVLRIKDNSRVPMVLVGN 116

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAAT 180
           K DL  ++E    VE E  +M ++   + F+E SA   S V  +F ++   + + +  A 
Sbjct: 117 KADL--QDERVISVE-EGIEMSSKWGKVPFYETSALLRSNVDEVFVDVVRQIIRNEIEAQ 173

Query: 181 AASPQARKTPNVKLQRPSTNDS 202
           A+S       NV L   S N++
Sbjct: 174 ASS-------NVGLGHLSRNNT 188

>CAGL0L11242g 1197075..1197839 highly similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, hypothetical start
          Length = 254

 Score = 63.2 bits (152), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 74/140 (52%), Gaps = 10/140 (7%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQER 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + + +   +   I F + D  GQ  
Sbjct: 33  LIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTD---IVFSLMDLGGQRE 89

Query: 68  YKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVI-CLVGNKLDLCT 126
           + ++ P+    ++  ++++D+T+  +L   + W    +  +G  D  I  LVG K DL  
Sbjct: 90  FINMLPIATLGSSVIILLFDLTRPETLNSIKEW---YRQALGLNDSAIPILVGTKYDLFI 146

Query: 127 --EEEGGRGVEKEDAQMYAQ 144
             EEE    V K   + YAQ
Sbjct: 147 DLEEEYQEKVSKTSMK-YAQ 165

>AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH]
           complement(1274158..1274952) [795 bp, 264 aa]
          Length = 264

 Score = 62.4 bits (150), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 83/169 (49%), Gaps = 9/169 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     K  + +D     EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGEYLDTYDPTIEDSYR----KSMEIDDKAFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120
           DTAG  ++ ++  +Y ++    L+VY VT   SL +     E++      + + + LVGN
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLAELMELREQILRIKDSKRVPMVLVGN 116

Query: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEI 168
           K DL  E    R +  E+    +   G + F+E SA   S V  +F ++
Sbjct: 117 KADLQNE----RAISVEEGIDVSSRWGKVPFYETSALLKSNVDEVFIDL 161

>YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of
           the rho family in the ras superfamily, involved in
           negative regulation of the Slt2p MAP kinase branch of
           the Pkc1p pathway [996 bp, 331 aa]
          Length = 331

 Score = 62.8 bits (151), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 92/214 (42%), Gaps = 49/214 (22%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSF---------DEFRES-TIGAAFLSQTIKLEKH 50
           M   K V++GD +VGK+S++  +  +SF         D +  +  I     S  ++L+  
Sbjct: 1   MRSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNG 60

Query: 51  EDVT----------------IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSL 94
            D                   K  +WDTAGQE Y  L P+ Y   +  L+ + V++  S 
Sbjct: 61  NDKRGSLSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASF 120

Query: 95  VK-AQSWVEELK-----------NKVGDQDLVICLVGNKLDLCTEEEGGRGVEKEDAQMY 142
               + W+ ELK            K+G     I LVG K DL  +    + +++ ++   
Sbjct: 121 ANVTEKWLPELKQTSNIEGTSLYTKLG--KYPILLVGTKSDLRDDPATQKKLQEANSDYV 178

Query: 143 AQEQ--------GLL-FHEVSAKTGSGVAAIFQE 167
           +QE+        G + + E SA T +GV  +F++
Sbjct: 179 SQEEIDELVQRCGFMGYTECSAATQAGVREVFEQ 212

>YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-binding
           protein involved in regulation of cAMP pathway, homolog
           of mammalian proto-oncogene ras [969 bp, 322 aa]
          Length = 322

 Score = 62.8 bits (151), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 87/164 (53%), Gaps = 10/164 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           ++KLV++G   VGKS++  +  +  F +  + TI  ++  Q +     ++V+I  +I DT
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTIEDSYRKQVVI---DDEVSI-LDILDT 65

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV-ICLVGNK 121
           AGQE Y ++   Y RN    L+VY +T   SL +  ++ +++  +V D D V I +VGNK
Sbjct: 66  AGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQIL-RVKDTDYVPIVVVGNK 124

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIF 165
            DL  E++    V  +D    A++    F E SAK    V   F
Sbjct: 125 SDLENEKQ----VSYQDGLNMAKQMNAPFLETSAKQAINVEEAF 164

>Scas_575.10
          Length = 271

 Score = 62.0 bits (149), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 12/189 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +TI+++         EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGIYLDTYDPTIEDSY-RKTIEIDNK---VFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV-ICLVG 119
           DTAG  ++ ++  +Y ++    L+VY VT   SL +     E++  ++ D D V + LVG
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVTDPQSLDELMELREQVL-RIKDTDRVPMVLVG 115

Query: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQKKGA 178
           NK DL TE+   R +  E+    + + G + F+E SA   S V  +F ++   + + +  
Sbjct: 116 NKADL-TED---RVISVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVRQIIRNE-M 170

Query: 179 ATAASPQAR 187
            T A  +AR
Sbjct: 171 ETVAKSEAR 179

>Kwal_23.4875
          Length = 230

 Score = 61.2 bits (147), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 64/129 (49%), Gaps = 7/129 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F +  E T+   ++       +H    I   +WD
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIHDIFVDNQH----ITLSLWD 69

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQ-SWVEELKNKVGDQDLVICLVGN 120
           TAGQE +  L  + Y + +  ++ + V    SL   Q  WV E+ +      LV  LV  
Sbjct: 70  TAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLDNVQHKWVGEIADHCEGVKLV--LVAL 127

Query: 121 KLDLCTEEE 129
           K DL +  E
Sbjct: 128 KCDLRSNNE 136

>KLLA0C12001g complement(1029092..1029871) similar to sp|P13856
           Saccharomyces cerevisiae YGR152c RSR1 GTP-binding
           protein, start by similarity
          Length = 259

 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 99/192 (51%), Gaps = 13/192 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +T++++         EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSY-RKTMEIDNK---VFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV-ICLVG 119
           DTAG  ++ ++  +Y ++    L+VY V+   SL +     E++  ++ D D V I LVG
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVSDRQSLNELLELREQVL-RIKDSDRVPIVLVG 115

Query: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQK--K 176
           NK DL  E    R +  E+    + + G + F+E SA   S V  +F ++   + +   +
Sbjct: 116 NKADLQDE----RVISVEEGIEVSSKWGKVPFYEASALLRSNVDEVFIDLVRQIIRNELE 171

Query: 177 GAATAASPQARK 188
            A+   + Q+RK
Sbjct: 172 SASNINNSQSRK 183

>CAGL0G05764g complement(552809..553681) similar to sp|P53879
           Saccharomyces cerevisiae YNL180c RHO5, start by
           similarity
          Length = 290

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 87/195 (44%), Gaps = 23/195 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M   K VL+GDS VGK++ +  +   SF      T+   +L+ TI+ +K    T     W
Sbjct: 1   MKSLKCVLVGDSEVGKTAFLMSYTTGSFSPEYVPTVFDEYLT-TIQ-DKETGYTFHTTFW 58

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS-WVEELKNKVGDQD----LVI 115
           DT+G +++  L P+ Y   +  L  +      S    +  W+ ELK  +   D    + I
Sbjct: 59  DTSGDKQHDHLRPLTYPQTDVFLACFPYNDIRSFRNVKDKWIPELKKYIRKSDNSSTVPI 118

Query: 116 CLVGNKLDLC-----------TEEEGGRGVEKEDAQMYAQEQGLL-FHEVSAKTGSGVAA 163
            LV  K DL            ++E  G  + +        ++ LL F + S+KTG G+  
Sbjct: 119 LLVATKCDLNDDNSSNNILNQSQEVDGMPLPESLVDGLVIDENLLGFVKCSSKTGYGL-- 176

Query: 164 IFQEIGENVYQKKGA 178
             Q++ +NV +  GA
Sbjct: 177 --QDVIDNVAKYVGA 189

>YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase
           possibly involved in non-selective vesicle transport,
           interacts with Myo2p and plays a role in distribution of
           mitochondria into growing buds [1068 bp, 355 aa]
          Length = 355

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 58/120 (48%), Gaps = 12/120 (10%)

Query: 34  STIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQERYKS-LAPMYYRNANAALVVYDVTQAG 92
           STIG    +  + ++      I   +WDTAGQERY++ + P  Y+  NA ++ YD+T A 
Sbjct: 142 STIGIDIKTNLVNIDNRFFNVI---LWDTAGQERYQNAIIPSLYKKTNAVILTYDITNAK 198

Query: 93  SLVKA-QSWVEELKNKVGDQDLV---ICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGL 148
           S     + W+ +       QDL+     LVGNK+DL  E    R V   D     QE  L
Sbjct: 199 SFQSCMERWIVQALENFSSQDLLKARFFLVGNKIDLYKE----RQVTHYDVVQMVQEMQL 254

>Kwal_34.16142
          Length = 192

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 4/157 (2%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           K+ ++G  +VGKSS+  +FV+  F E    TI   F  Q +        T   EI DTAG
Sbjct: 13  KIAVVGARNVGKSSLTVQFVESRFVEPYYPTIENQFTKQIV----LGRTTYTLEICDTAG 68

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLDL 124
           Q+ +  +            +VY      S    +   +++ ++VG + +   ++GNK+DL
Sbjct: 69  QDEFSLINTKSLIGVKGVAIVYSCVNRASFEIVELIRDKILDQVGLEQIPTVILGNKIDL 128

Query: 125 CTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGV 161
                 G  V +++ +  A   G  F E SAK   GV
Sbjct: 129 RDSGINGGKVRRQEGEELAARLGAGFVECSAKLNIGV 165

>Kwal_55.21971
          Length = 421

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query: 34  STIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTQAG 92
           STIG    +  + ++       K  +WDTAGQERY+ ++ P  Y+ +N  L+ YD+    
Sbjct: 202 STIGVDIRTNLVNIDNR---YFKVTMWDTAGQERYRNAMIPSLYKGSNGILLSYDICSRK 258

Query: 93  SLVKA-QSWVEELKNKVG-DQDLVICLVGNKLDL 124
           S       W++E+ N    D+ L I LVGNK+DL
Sbjct: 259 SFQNCLDYWLQEVLNCCADDKALRIYLVGNKIDL 292

>Scas_697.46
          Length = 324

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 85/166 (51%), Gaps = 10/166 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           + ++KLV++G   VGKS++  + +   F +  + TI  ++  Q +  +K   VT+  ++ 
Sbjct: 8   IREYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTIEDSYRKQVVIDDK---VTV-LDVL 63

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV-ICLVG 119
           DTAGQE Y ++   Y R     L+VY VT   S  +  ++ ++++ +V D D + + +VG
Sbjct: 64  DTAGQEEYSAMREQYMRTGEGFLLVYSVTSKNSFEELLTYYQQIQ-RVKDSDYIPVVIVG 122

Query: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIF 165
           NK DL    E  R V  +     A++    F E SAK    V   F
Sbjct: 123 NKSDL----EDERQVPYQSGVNLAKQMNAPFLETSAKQAINVEEAF 164

>Kwal_26.8387
          Length = 292

 Score = 58.2 bits (139), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 85/164 (51%), Gaps = 10/164 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           ++KLV++G   VGKS++  + ++  F +  + TI  ++  Q +  +K   V+I  +I DT
Sbjct: 16  EYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVVIDDK---VSI-LDILDT 71

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV-ICLVGNK 121
           AGQE Y ++   Y R     L+VY VT   S  +  ++ +++  +V D D V + LVGNK
Sbjct: 72  AGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFDELMTYYQQIL-RVKDADYVPVFLVGNK 130

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIF 165
            DL    E  R V  E+    A++    F E SAK    V   F
Sbjct: 131 SDL----EDERQVAYEEGVSLAKQFNAPFMETSAKQAINVEDSF 170

>YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-binding
           protein involved in termination of M-phase, member of
           the ras superfamily [738 bp, 245 aa]
          Length = 245

 Score = 57.8 bits (138), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 64/121 (52%), Gaps = 7/121 (5%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQER 67
           L+GD+ VGK+S++ ++V++ +D+    T+G  FL + + +   +   I F I D  GQ  
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTD---IIFSIMDLGGQRE 81

Query: 68  YKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVI-CLVGNKLDLCT 126
           + ++ P+    ++  + ++D+T+  +L   + W  +     G  D  I  LVG K DL  
Sbjct: 82  FINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQ---AYGLNDSAIPILVGTKYDLLI 138

Query: 127 E 127
           +
Sbjct: 139 D 139

>CAGL0B04521g complement(439732..440751) similar to sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein or sp|P01119 Saccharomyces cerevisiae YOR101w
           RAS1, hypothetical start
          Length = 339

 Score = 58.2 bits (139), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 86/164 (52%), Gaps = 10/164 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           ++KLV++G   VGKS++  + V   F +  + TI  ++  Q +  +K   VTI  +I DT
Sbjct: 8   EYKLVVVGGGGVGKSALTIQLVHSHFVDEYDPTIEDSYRKQVVIDDK---VTI-LDILDT 63

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV-ICLVGNK 121
           AGQE Y ++   Y R     L+VY VT   S  +  ++ ++++ +V D + + + +VGNK
Sbjct: 64  AGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELITYYQQIQ-RVKDVEYIPVVVVGNK 122

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIF 165
            DL TE    R V  E+    A++    F E SAK    V   F
Sbjct: 123 SDLETE----RQVSFEEGASLAKQLNAPFLETSAKQAINVEDAF 162

>KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida
           albicans, start by similarity
          Length = 190

 Score = 56.6 bits (135), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 82/166 (49%), Gaps = 9/166 (5%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKF--EIWDT 62
           K+++LG  +VGK++++ +  +  F E    TI   F+ + + L+K     +KF  +I DT
Sbjct: 7   KIIVLGSRNVGKTTLLVQLTESHFVESYYPTIENQFIHEFV-LKKPNGTELKFNLDIVDT 65

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
           +GQ+ +  +           +++Y V    S    +   +++ + +G  +L + LVGNK+
Sbjct: 66  SGQDEFSMINAKSMLGVAGCILMYSVANRHSFEIVELIRDKMLDMLGLLELPMVLVGNKI 125

Query: 123 DLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEI 168
           DL       R V  ++ +  A+     F E+  K GSG+   F+ +
Sbjct: 126 DL------DRQVSYKEGEELAKRLKCGFVEICVKQGSGIEMPFKTL 165

>CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 384

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 60/132 (45%), Gaps = 19/132 (14%)

Query: 55  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVK-AQSWVEELKNKVGDQ-- 111
            K  +WDTAGQE Y  L P+ YR  +  L+ + V++  S       W  ELK   G +  
Sbjct: 117 FKLNLWDTAGQEEYDRLRPLSYRQTDVFLICFSVSEPSSFRNVVDKWFPELKRVSGIESG 176

Query: 112 DLV-------ICLVGNKLDLCTEE--------EGGRGVEKEDAQMYAQEQGLL-FHEVSA 155
           DL        I LVG K DL  +E        +    V KE+     ++ G + + E SA
Sbjct: 177 DLYTNFKKYPILLVGTKSDLRDDENEIQKMRDQNLSFVSKEEIDKVVEDNGFMGYVECSA 236

Query: 156 KTGSGVAAIFQE 167
            T + V  +F++
Sbjct: 237 ATQNNVRQVFEK 248

>AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH]
           complement(532002..532577) [576 bp, 191 aa]
          Length = 191

 Score = 53.5 bits (127), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 81/178 (45%), Gaps = 18/178 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ +    D      ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIG---DEPYTLGLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+ +       V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVVSPPSFENVKEKWFPEVHHHCPG---VPCLIV 113

Query: 119 GNKLDLC--------TEEEGGRGVEKEDAQMYAQE-QGLLFHEVSAKTGSGVAAIFQE 167
           G ++DL          + +  R +  E  + +A+E + + + E SA T  G+  +F E
Sbjct: 114 GTQIDLRENKMVIEKLQRQRLRPITPEQGEKFARELRAVKYVECSALTQRGLKNVFDE 171

>KLLA0A04213g complement(382243..382818) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42 GTP-binding
           protein of RAS superfamily, start by similarity
          Length = 191

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 87/192 (45%), Gaps = 10/192 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ +    D      ++
Sbjct: 1   MQTLKCVVIGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIG---DEPYTLGLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+ +       V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPG---VPCLIV 113

Query: 119 GNKLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQKKG 177
           G ++DL  ++     ++++  +    EQG  L  E+ A      +A+ Q   +NV+ +  
Sbjct: 114 GTQIDLRDDKVIIEKLQRQRLRPITPEQGERLARELRAVKYVECSALTQRGLKNVFDEAI 173

Query: 178 AATAASPQARKT 189
            A    P  +K+
Sbjct: 174 VAALEPPVIKKS 185

>YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein
           involved in regulation of arginine and lysine uptake,
           member of the Rheb family in the Ras superfamily of G
           proteins [630 bp, 209 aa]
          Length = 209

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 69/147 (46%), Gaps = 5/147 (3%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
            Q K+ L+G  +VGK+++  RFV+  F E    TI   F ++ I  + H D T+  EI D
Sbjct: 15  FQRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEF-TRIIPYKSH-DCTL--EILD 70

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNK 121
           TAGQ+    L           ++ Y +    S        ++L +++G  +L + LVG K
Sbjct: 71  TAGQDEVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVILVGTK 130

Query: 122 LDLCTEEEG-GRGVEKEDAQMYAQEQG 147
            DL    +G  R V K + +  A   G
Sbjct: 131 ADLGRSTKGVKRCVTKAEGEKLASTIG 157

>ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C
           (RAS2) - SH] complement(243998..244012,244074..244871)
           [813 bp, 270 aa]
          Length = 270

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 83/164 (50%), Gaps = 10/164 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           ++KLV++G   VGKS++  + ++  F +  + TI  ++  Q +       V+I  +I DT
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVVI---DGQVSI-LDILDT 65

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV-ICLVGNK 121
           AGQE Y ++   Y R     L+VY VT   S  +  ++ +++  +V D + V I +VGNK
Sbjct: 66  AGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQIL-RVKDVEYVPIFVVGNK 124

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIF 165
            DL    EG R V  E+    A+     F E SAK    V   F
Sbjct: 125 SDL----EGERQVSFEEGAELARHFNASFLETSAKQAINVEESF 164

>Kwal_23.3135
          Length = 191

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 88/192 (45%), Gaps = 10/192 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ +    D      ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIG---DEPYTLGLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+ +       V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPG---VPCLIV 113

Query: 119 GNKLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQKKG 177
           G ++DL  ++     ++++  +  + EQG  L  E+ A      +A+ Q   +NV+ +  
Sbjct: 114 GTQIDLRDDKVIIEKLQRQRLRPISAEQGERLARELRAIKYVECSALTQRGLKNVFDEAI 173

Query: 178 AATAASPQARKT 189
            A    P  +K+
Sbjct: 174 VAALEPPVIKKS 185

>YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type
           GTPase involved in bud site assembly, cell polarity, and
           exocytosis, member of the rho family of the ras
           superfamily [576 bp, 191 aa]
          Length = 191

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 87/192 (45%), Gaps = 10/192 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ +    D      ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIG---DEPYTLGLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+ +       V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPG---VPCLVV 113

Query: 119 GNKLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQKKG 177
           G ++DL  ++     ++++  +    EQG  L  E+ A      +A+ Q   +NV+ +  
Sbjct: 114 GTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAI 173

Query: 178 AATAASPQARKT 189
            A    P  +K+
Sbjct: 174 VAALEPPVIKKS 185

>Scas_721.96
          Length = 191

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 87/192 (45%), Gaps = 10/192 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M   K V +GD +VGK+ ++  +  + F      T+   + + T+ +    D      ++
Sbjct: 1   MKTIKAVTIGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIG---DEPYTLGLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+ +       V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPG---VPCLIV 113

Query: 119 GNKLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQKKG 177
           G ++DL ++      ++++  +  + EQG  L  E+ A      +A+ Q   +NV+ +  
Sbjct: 114 GTQIDLRSDPIIIEKLQRQRLRPISPEQGERLARELKAVKYVECSALTQRGLKNVFDEAI 173

Query: 178 AATAASPQARKT 189
            A    P  +K+
Sbjct: 174 VAALEPPVIKKS 185

>Kwal_23.2944
          Length = 184

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 64/125 (51%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + S     F  +T+         +KF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVSFR-----NVKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDL---VICLVG 119
            GQ+R + L   Y+    A + V D      L +A+   EEL + +GD+++   V+ ++ 
Sbjct: 69  GGQDRLRPLWRHYFPATTALIFVVDSQDMERLNEAK---EELYSIIGDKEMENVVLLVLA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH]
           complement(212664..213209) [546 bp, 181 aa]
          Length = 181

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 64/125 (51%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + S     F  +T+         +KF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVAFR-----NVKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDL---VICLVG 119
            GQER + L   Y+    A + V D      L +A+   EEL + +G++++   V+ ++ 
Sbjct: 69  GGQERLRPLWRHYFPATTALIFVIDSHDQARLNEAK---EELYSIIGEKEMENVVLLVLA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>Scas_628.21
          Length = 208

 Score = 51.2 bits (121), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 78/176 (44%), Gaps = 15/176 (8%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWD 61
            Q K+ +LG  +VGK+++  R+V+  F E    T+   F     KL   ++     EI D
Sbjct: 13  FQRKIAVLGAKNVGKTTLTIRYVESRFLESYYPTVENHF----TKLIDFKNQHFTLEIVD 68

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNK 121
           TAGQ+    L           ++ Y V    +        ++L +++   D+ + +VGNK
Sbjct: 69  TAGQDESSLLNLKSLAGVRGVILCYSVVNISTFDMIPVVWDKLLDQLERDDIPVIIVGNK 128

Query: 122 LDLCTEEEGGRGVEKEDAQMYAQ---------EQGLLFHEVSAKTGSGVAAIFQEI 168
           +DL  + +    V K++ +  A          + G  F E SAK  + V   FQ++
Sbjct: 129 IDLRNDLDNRTVVTKQEGKKLANLIRSSDKNIKAG--FIECSAKDDTNVGTTFQKL 182

>CAGL0F05269g complement(533759..534334) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42, start by
           similarity
          Length = 191

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 86/192 (44%), Gaps = 10/192 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ +    D      ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIG---DEPYTLGLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+ +       V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPG---VPCLVV 113

Query: 119 GNKLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQKKG 177
           G ++DL  ++     + ++  +    EQG  L  E+ A      +A+ Q   +NV+ +  
Sbjct: 114 GTQVDLRDDKVIIEKLRRQRLRPITAEQGERLARELRAVKYVECSALTQRGLKNVFDEAI 173

Query: 178 AATAASPQARKT 189
            A    P  +K+
Sbjct: 174 VAALEPPVIKKS 185

>YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with
           similarity to members of the arf family (ras
           superfamily) of GTP-binding proteins [552 bp, 183 aa]
          Length = 183

 Score = 50.8 bits (120), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 65/125 (52%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + K+++LG    GK++I+++      ++ + ST    F  +T+  +      +KF +WD 
Sbjct: 17  EMKILMLGLDKAGKTTILYKL---KLNKIKTSTPTVGFNVETVTYK-----NVKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDL---VICLVG 119
            GQ+R + L   Y+    A + V D +    + +A+   EEL + +G++++   V+ +  
Sbjct: 69  GGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAK---EELYSIIGEKEMENVVLLVWA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>Scas_697.54*
          Length = 181

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 65/125 (52%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + ST    F  +T+  +      +KF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSTPTVGFNVETVSYK-----NVKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDL---VICLVG 119
            GQER + L   Y+    A + V D +    L +A+   EEL + + ++++   V+ +  
Sbjct: 69  GGQERLRPLWRHYFPATTALIFVIDSSDQERLNEAK---EELYSIISEKEMEKVVLLVWA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>Sklu_2320.2 YOR094W, Contig c2320 3571-4065
          Length = 164

 Score = 49.3 bits (116), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 63/124 (50%), Gaps = 14/124 (11%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            K+++LG  + GK++I+++      ++ + S     F  +T+  +      +KF +WD  
Sbjct: 1   MKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVTYK-----NVKFNMWDVG 52

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDL---VICLVGN 120
           GQER + L   Y+    A + V D      L +A+   EE  + VG++++   V+ ++ N
Sbjct: 53  GQERLRPLWRHYFPATTALIFVIDSQDKDRLNEAK---EEFYSIVGEKEMEKVVLLVLAN 109

Query: 121 KLDL 124
           K DL
Sbjct: 110 KQDL 113

>KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, start by
           similarity
          Length = 373

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 10/112 (8%)

Query: 34  STIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQERYKS-LAPMYYRNANAALVVYDVTQAG 92
           STIG    +  + ++       +  +WDTAGQERY++ +    Y+ +N  ++ YD+    
Sbjct: 159 STIGIDIKTNLVNIDNR---FFRVIMWDTAGQERYRNAMISSLYKGSNGVILSYDICDFN 215

Query: 93  SLVKAQSW--VEELKNKVGDQDLVICLVGNKLDLCTEEEGGRGVEKEDAQMY 142
           S +   ++  VE ++N          LVGNKLDL  E    R V  ED   +
Sbjct: 216 SFLNCLNFWLVESIENIPNLSMTRFYLVGNKLDLYKE----RKVTHEDVLQF 263

>KLLA0C13563g complement(1157278..1157826) highly similar to
           sp|P40994 Saccharomyces cerevisiae YOR094w ARF3
           ADP-ribosylation factor 3, start by similarity
          Length = 182

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 65/125 (52%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + S     F  +T+  +      +KF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETLSFK-----NVKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDL---VICLVG 119
            GQ R + L   Y+   +A + V D      L +A+   EEL + +G++++   V+ ++ 
Sbjct: 69  GGQARLRPLWRHYFPATSALIFVIDSNDKERLDQAK---EELFSIIGEKEMEKVVLLVLA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>CAGL0M03817g complement(431237..432664) weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, hypothetical
           start
          Length = 475

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 33  ESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQERYKS-LAPMYYRNANAALVVYDVTQA 91
           ++TIG    +  I ++          +WDTAGQERY++ + P  Y+ +NA ++ YD+T  
Sbjct: 237 KTTIGVDIKTNIINIDNR---IFNCILWDTAGQERYRNAIMPSLYKKSNAIILSYDITDK 293

Query: 92  GSLVKA-QSWVEELKNKVGDQDL---VICLVGNKLDLCTEEE 129
            S   + + W+ E       +D        +GNK DL  + E
Sbjct: 294 CSFKNSYEHWLVEAMGHFAARDYEKARFYFIGNKTDLYKQRE 335

>Sklu_2354.10 YNL304W, Contig c2354 13851-15119
          Length = 422

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 18/122 (14%)

Query: 18  SIVHRFVKDSFDEFRES------------TIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQ 65
           S  H+ +K+  D  ++S            TIG    +  I ++       K  +WDTAGQ
Sbjct: 180 STSHQMIKEEPDNQKDSQDPDEIVIDTKTTIGIDIKTSLINIDNR---FFKVIMWDTAGQ 236

Query: 66  ERYKS-LAPMYYRNANAALVVYDVTQAGSLVKA-QSWVEELKNKVGDQ-DLVICLVGNKL 122
           ERY++ + P  Y+ +N  ++ YD+    S       W+ E      D       LVGNK+
Sbjct: 237 ERYRNAMIPSLYKGSNGIILTYDICDRASFDSCLNHWLREAIQNCKDLGKTRFYLVGNKI 296

Query: 123 DL 124
           DL
Sbjct: 297 DL 298

>Scas_624.4*
          Length = 181

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ +      I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ+R +SL   YYRN    + V D      + +A+  ++ + N+   ++ V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>CAGL0I03916g 343014..343559 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ +      I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ+R +SL   YYRN    + V D      + +A+  ++ + N+   ++ V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein of
           the arf family (ras superfamily) involved in assembly of
           coated vesicles of the secretory system [546 bp, 181 aa]
          Length = 181

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ +      I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ+R +SL   YYRN    + V D      + +A+  ++ + N+   ++ V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>Scas_701.42*
          Length = 181

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ +      I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ+R +SL   YYRN    + V D      + +A+  ++ + N+   ++ V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>CAGL0J09064g 892556..893101 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ +      I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ+R +SL   YYRN    + V D      + +A+  ++ + N+   ++ V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH]
           complement(405601..406815) [1215 bp, 404 aa]
          Length = 404

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 10/127 (7%)

Query: 33  ESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTQA 91
           +STIG    +  + +++      K  +WDTAGQERY+ ++ P  Y+     ++ YD+   
Sbjct: 165 KSTIGVDIKTSFVDIDRQ---LFKVIMWDTAGQERYRNAMVPSLYKGTQGIILSYDICSR 221

Query: 92  GSLVKA-QSWVEELKNKVGDQDLVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLF 150
            +     + W+ E       +     LVGNK+DL  +    R V   D   +A E    +
Sbjct: 222 ETFPDCLEHWLPEALEHCQVEHTRFYLVGNKVDLYKQ----RQVTHADVLAFADEAKRRY 277

Query: 151 -HEVSAK 156
             E+S K
Sbjct: 278 GFEISGK 284

>KLLA0F05225g 515391..515936 highly similar to sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2 GTP-binding
           protein of the ARF family, start by similarity
          Length = 181

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ +      I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ++ + L   Y+RN    + V D      + +A+  ++ + N+   ++ V+ +  NK 
Sbjct: 69  GGQDKIRPLWRHYFRNTEGIIFVVDSNDRARIAEAREVLQRMLNEDEIRNAVLLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein
           involved in assembly of coated vesicles of the secretory
           system, member of the arf family in the ras superfamily
           [546 bp, 181 aa]
          Length = 181

 Score = 45.1 bits (105), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 58/122 (47%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ +      I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ+R +SL   YYRN    + V D      + +A+  ++ + N+   ++    +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W
           (ARF2) - SH] complement(878123..878668) [546 bp, 181 aa]
          Length = 181

 Score = 45.1 bits (105), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ +      I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ++ + L   Y+RN    + V D      + +A+  ++ + N+   ++ V+ +  NK 
Sbjct: 69  GGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRIAEAREVLQRMLNEDEIRNAVLLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>Scas_503.2
          Length = 527

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 82/186 (44%), Gaps = 28/186 (15%)

Query: 25  KDSFDEFRE------STIGAAFLSQTIKLEKHEDVTIKFEIWDTAGQERYKS-LAPMYYR 77
           K SFD+  E       TIG    S  + ++  +   I    WD AGQ+R+K+ +    Y+
Sbjct: 236 KASFDDREEMIIDTRPTIGIDIKSTLVNIQGKKYNCI---FWDPAGQDRFKNVMMDSLYK 292

Query: 78  NANAALVVYDVTQAGSLVK-AQSWVEELKNKVGDQDLV---ICLVGNKLDLCTEEEGGRG 133
            +NA ++ YD+    S     + W+ E    V   DL      LVGNKLDL  +    R 
Sbjct: 293 ISNAIILCYDICNLTSFQNCCRYWLNETLENVRSGDLSEIKFYLVGNKLDLYAK----RQ 348

Query: 134 VEKEDA-QMYAQ---EQGLLF---HEVSAKTGSGVAAIFQEIGENVYQKKGAATAASPQA 186
           V  ED   M      + G+      EV+ K  + V  IF  I  ++ +K    T+ S  A
Sbjct: 349 VNHEDVLNMITNMEYDYGITISGNFEVTCKWENVVERIFDLILMDLVEK---GTSESTPA 405

Query: 187 RKTPNV 192
           ++  N+
Sbjct: 406 KENGNI 411

>Kwal_56.24453
          Length = 181

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ +      I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ++ + L   Y+RN    + V D      + +A+  ++ + N+   ++ V+ +  NK 
Sbjct: 69  GGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>Sklu_1681.2 YDL137W, Contig c1681 2279-2767
          Length = 162

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 58/121 (47%), Gaps = 8/121 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
            +++++G    GK++I+++       E   +     F  +T++ +      I F +WD  
Sbjct: 1   MRVLMVGLDGAGKATILYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDVG 52

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
           GQ++ + L   Y+RN    + V D      + +A+  ++ + N+   ++ V+ +  NK D
Sbjct: 53  GQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFANKQD 112

Query: 124 L 124
           L
Sbjct: 113 L 113

>Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement
          Length = 197

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 78/176 (44%), Gaps = 24/176 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           QF +++LG  + GK++ +    K+     +        + Q +     +D  +KF  WD 
Sbjct: 17  QFSILILGLDNAGKTTFLETLKKEYSLHSKPLEKITPTVGQNVATIPVQDCVLKF--WDV 74

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQD---LVICLVG 119
            GQE  +SL   YY  A+  + V D T    L + +   E L++ V D+D   + + ++ 
Sbjct: 75  GGQETLRSLWAEYYSQAHGIIFVVDSTDRDRLDECK---ETLRSIVMDEDVEGVPVLMLA 131

Query: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTG---SGVAAIFQEIGENV 172
           NK D            +ED +M  Q+   +F++++   G   S V  I    GE V
Sbjct: 132 NKQD------------RED-RMEVQDIKEIFNKIAEHLGARDSRVLPISALTGEGV 174

>Kwal_56.24462
          Length = 181

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 58/122 (47%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ +      I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ++ + L   YYRN    + V D      + +A+  ++ + N+   ++  + +  NK 
Sbjct: 69  GGQDKIRPLWRHYYRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNASLLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>CAGL0I00858g complement(63365..63958) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 197

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 85/190 (44%), Gaps = 36/190 (18%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHED-VTIKFEIWD 61
           + + ++LG  + GKS+IV+  + +S ++    T    F   +I +E  +D  T K  +WD
Sbjct: 16  EIRCLILGLDNSGKSTIVNGLLPES-EKCNSITPTVGFQIHSIVVESAQDGKTYKVNLWD 74

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL----KNKVGDQ-DLVIC 116
             GQ   +     Y+   +  L   D+  +    ++ + + EL    ++++G Q  LV+ 
Sbjct: 75  IGGQRTLRPFWDNYFDKTDVLLWCVDIASSLRFDESFNELRELVMQDRDRIGYQCKLVVA 134

Query: 117 LVGNKLDLCTEEEGGRGVEKEDAQMYAQE-----QGLLFHE-------------VSAKTG 158
           +  NK+DL         VE+ D + YA +     + +L H               S KTG
Sbjct: 135 I--NKIDL---------VEQADLEHYAHDIEQKIEHILHHGQSVGESSIGHYVLCSGKTG 183

Query: 159 SGVAAIFQEI 168
           +G+  + Q I
Sbjct: 184 AGIENLAQMI 193

>Kwal_47.18241
          Length = 230

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 7/124 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           Q  +V++G  + GK+S+    +   F++    T+G      T+ L           I+D 
Sbjct: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI-------VRIFDL 56

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
           AGQ R++ L   Y+  A+  + V D+    +  + +  V ++        + + ++GNK+
Sbjct: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKI 116

Query: 123 DLCT 126
           DL T
Sbjct: 117 DLIT 120

>YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein
           involved in chromosome segregation, mutants arrest at
           mitosis with loss of microtubule structure [576 bp, 191
           aa]
          Length = 191

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 85/181 (46%), Gaps = 18/181 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVK--DSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60
           + + ++LG  + GKS+IV++ +   +  ++    T+G    S  IK     DVTI   +W
Sbjct: 16  EIRCLILGLDNSGKSTIVNKLLPKDEQNNDGIMPTVGFQIHSLMIK-----DVTI--SLW 68

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL----KNKVGDQDLVIC 116
           D  GQ   +     Y+    A +   DV+ +    +    ++EL    +N++G +  VI 
Sbjct: 69  DIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRIGYECAVI- 127

Query: 117 LVGNKLDLCTEE-EGGRG---VEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENV 172
           +V NK+DL  ++ E  R    VE E   ++  +  +   + S  TG G+  +   + E+ 
Sbjct: 128 VVLNKIDLVEDKSELHRRCLLVESELKCLFKPDIRIELVKCSGVTGEGIDNLRDRLVESC 187

Query: 173 Y 173
           +
Sbjct: 188 H 188

>KLLA0F17072g complement(1566668..1567240) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 190

 Score = 39.7 bits (91), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 71/138 (51%), Gaps = 14/138 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           +++LLG  + GK++++++ + +  D+  + TIG  F  +T+KL          ++WD  G
Sbjct: 18  RVLLLGLDNSGKTTVLNQLLNEPIDKI-QPTIG--FQIKTLKLSNK-----VLQMWDIGG 69

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLVGNK 121
           Q+  +     Y+   +  + V D+     L+++ + +EE+    +++  Q  V  L+ NK
Sbjct: 70  QKTLRPFWFNYFEKTDYLIWVIDILD-NRLMESLTLLEEIVQENDRINLQFEVFILL-NK 127

Query: 122 LDLCTEEEGGRGVEKEDA 139
           +DL   +  G G+  +D 
Sbjct: 128 IDLL-PKGNGNGLNDDDT 144

>Kwal_27.11872
          Length = 197

 Score = 39.3 bits (90), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 56/124 (45%), Gaps = 8/124 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           Q+ +++LG  + GK++ +    ++     +        + Q +      +  +KF  WD 
Sbjct: 17  QYSILILGLDNAGKTTFLEMLKREYSKSGKAPDKITPTVGQNVATVPVGNCLLKF--WDV 74

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQD---LVICLVG 119
            GQE  ++L P YY+ A+  + V D      L +     + L+  V D+D   + + ++ 
Sbjct: 75  GGQESLRALWPEYYKQAHGIIFVIDSADRERLDEC---CQTLRTIVMDEDVEGIPVLMLA 131

Query: 120 NKLD 123
           NK D
Sbjct: 132 NKQD 135

>Sklu_1358.1 YMR138W, Contig c1358 536-1192
          Length = 218

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 65/131 (49%), Gaps = 12/131 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRES-TIGAAFLSQTIKLEKHEDVTIKFEIWD 61
           + + ++LG  + GKS++V   ++      R + T+G  F   TI+   H       ++WD
Sbjct: 42  ELRSLVLGLDNSGKSTVVDWLLERGEKRSRITPTVG--FRIHTIEYAGH-----NVQLWD 94

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLV 118
             GQ   +     Y+   +  L V DVT      ++ + +E+L   ++++G +  +I L+
Sbjct: 95  IGGQRTLRPFWDNYFDKTDVLLWVIDVTARSRFSESFAELEKLLQDRDRLGYRCKMIVLL 154

Query: 119 GNKLDLCTEEE 129
            NK+DL  E+E
Sbjct: 155 -NKMDLIDEDE 164

>KLLA0C13387g complement(1142002..1142637) similar to sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1 GTP-binding
           protein, start by similarity
          Length = 211

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 71  LAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV-ICLVGNKLDLCTEEE 129
           +   Y R     L+VY VT   S  +  ++ +++  +V D D V + ++GNK DL    E
Sbjct: 1   MREQYMRTGEGFLLVYSVTSKTSFEELMTYYQQIL-RVKDSDYVPVFVIGNKSDL----E 55

Query: 130 GGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIF 165
             R V  E+ Q  A++    F E SAK    V   F
Sbjct: 56  DERQVSYEEGQTLAKQFDAPFLETSAKQNINVEESF 91

>KLLA0E07634g 688734..690239 similar to sp|P32559 Saccharomyces
           cerevisiae YMR023c MSS1 mitochondrial GTPase involved in
           expression of COX1 singleton, start by similarity
          Length = 501

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 79/179 (44%), Gaps = 32/179 (17%)

Query: 4   FKLVLLGDSSVGKSSIVHRF--------------VKDSFDEFRESTIGAAFLSQTIKLEK 49
            KL LLG+ + GKSS+V+                 +DS D   +       L+ T  + +
Sbjct: 257 IKLTLLGEPNSGKSSLVNEISQDDVAIVSDIPGTTRDSIDVMMDINGFKCILTDTAGIRQ 316

Query: 50  HEDVTIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVG 109
               +I+ +  D + ++  +S         +  ++V DV+       ++ + E +K+ + 
Sbjct: 317 GTSDSIEIKGIDRSKKKSLQS---------DLVVLVIDVSNPNI---SKHFEEFIKDNLS 364

Query: 110 DQDLVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEI 168
           D+ L++ L  NK DL TE +    +EK DA+  A    L  H VS  T  G+  + + +
Sbjct: 365 DKPLIVVL--NKSDLATETQLKYLIEKFDAEFKA----LKIHTVSCLTKIGLEPLVKTL 417

>Sklu_2202.6 YBR164C, Contig c2202 5407-5958
          Length = 183

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 50/121 (41%), Gaps = 8/121 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+  +      +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ   +     YY N  A + V D T    +  A   +  +  +   QD  + +  NK 
Sbjct: 70  GGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMSTASKELHMMLQEEELQDAALLVFANKQ 129

Query: 123 D 123
           D
Sbjct: 130 D 130

>YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408)
           Component of COPII coat of vesicles involved in
           endoplasmic reticulum to Golgi transport, GTP-binding
           protein of the arf family in the ras superfamily [573
           bp, 190 aa]
          Length = 190

 Score = 36.2 bits (82), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   +   E+     IKF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTS---EELAIGNIKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
             + + L   Y+   N  + + D        +A+  ++ L N    +D+   ++GNK+D
Sbjct: 77  HIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKID 135

>CAGL0E05896g
           join(complement(585178..585202),
           complement(584348..584892)) highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family
          Length = 189

 Score = 36.2 bits (82), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   +   E+     IKF  +D  G
Sbjct: 24  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTS---EELAIGNIKFTTFDLGG 75

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
             + + L   Y+   N  + + D        +A+  ++ L N    +D+   ++GNK+D
Sbjct: 76  HVQARRLWKDYFPEVNGIVFLVDSADPDRFDEARVELDALFNITELKDVPFVILGNKID 134

>AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH]
           complement(1164831..1165382) [552 bp, 183 aa]
          Length = 183

 Score = 35.0 bits (79), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 49/121 (40%), Gaps = 8/121 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+         +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QVGEVVTTKPTIGFNVETLTYRN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ   +     YY N  A + V D T    +  A   +  +  +   QD  + +  NK 
Sbjct: 70  GGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMGVAARELHTMLQEEELQDAALLVFANKQ 129

Query: 123 D 123
           D
Sbjct: 130 D 130

>KLLA0E24805g 2194554..2195105 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ARL1 ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 35.0 bits (79), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 50/121 (41%), Gaps = 8/121 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+  +      +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVITTKPTIGFNVETLNYK-----NLKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ   +     YY N  A + V D T    +  A   +  +  +   QD  + +  NK 
Sbjct: 70  GGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMNIASKELHLMLQEEELQDSALLVFANKQ 129

Query: 123 D 123
           D
Sbjct: 130 D 130

>KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus
           musculus Hypothetical 21.4 kDa protein, hypothetical
           start
          Length = 253

 Score = 34.7 bits (78), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/137 (19%), Positives = 65/137 (47%), Gaps = 6/137 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           Q  + ++G  + GK++  +    + F      T+G     + +KL  H ++    +++D 
Sbjct: 23  QLSIAVVGLQNSGKTTFTNLIAGEEFVVDTIPTLGVNI--KDVKLPNHTNL----KVYDL 76

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
           AGQ R++ L    ++  +  + + D++   +  +A++ + ++      + + I ++GNK+
Sbjct: 77  AGQTRFQKLWDRCFQQVDLLVFMIDLSDLTNWEQAKNKLHDVIIATNLEHVPILILGNKV 136

Query: 123 DLCTEEEGGRGVEKEDA 139
           DL  +      V K D 
Sbjct: 137 DLIPKFHRDLYVAKSDV 153

>YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding
           protein of the arf-sar family in the ras superfamily,
           possibly involved in signal transduction, and plays a
           role in membrane trafficking [552 bp, 183 aa]
          Length = 183

 Score = 34.3 bits (77), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 50/121 (41%), Gaps = 8/121 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+  +      +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLSYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ   +     YY +  A + V D T    +  A   +  +  +   QD  + +  NK 
Sbjct: 70  GGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQ 129

Query: 123 D 123
           D
Sbjct: 130 D 130

>CAGL0I10835g 1060258..1060809 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 33.9 bits (76), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 50/121 (41%), Gaps = 8/121 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+  +      +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ   +     YY +  A + V D T    +  A   +  +  +   QD  + +  NK 
Sbjct: 70  GGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQ 129

Query: 123 D 123
           D
Sbjct: 130 D 130

>Scas_700.11
          Length = 183

 Score = 33.5 bits (75), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 50/121 (41%), Gaps = 8/121 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+  +      +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
            GQ   +     YY +  A + V D T    +  A   +  +  +   QD  + +  NK 
Sbjct: 70  GGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMGTASKELHLMLQEEELQDAALLVFANKQ 129

Query: 123 D 123
           D
Sbjct: 130 D 130

>Scas_706.2*
          Length = 190

 Score = 33.1 bits (74), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 8/122 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   +   E+     IKF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTS---EELAIGNIKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLDL 124
             + + L   Y+   N  + + D        +A   ++ L      +D+   ++GNK+D 
Sbjct: 77  HIQARRLWKDYFPEVNGIVFLVDAADPERFHEAYVELDALFKIAELKDVPFVILGNKIDA 136

Query: 125 CT 126
            T
Sbjct: 137 PT 138

>Kwal_47.17857
          Length = 198

 Score = 33.1 bits (74), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 75/178 (42%), Gaps = 20/178 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFV---KDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEI 59
           + + ++LG  + GKS++V   +   K    +    T+G  F   TI  + H       ++
Sbjct: 16  EIRCLVLGLDNSGKSTVVDWILSVYKKRPRQLITPTVG--FQIHTIPFQNHN-----VQL 68

Query: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV----- 114
           WD  GQ   +     Y+   +  + V D   A  L ++   + ELK  + ++D +     
Sbjct: 69  WDIGGQSTLRPYWDNYFDKTDVLMWVIDAAAAQRLEES---IGELKVILQNRDRLGYGCK 125

Query: 115 ICLVGNKLDLCTEEEGGRGVEKEDAQ--MYAQEQGLLFHEVSAKTGSGVAAIFQEIGE 170
           I ++ NK DL  + E      KE+    +  +   +     +A +G G+ ++   I E
Sbjct: 126 IVVLLNKTDLIPDLESITAKLKEELSDILKLETVPIEIKSTNALSGQGLDSLLPAIVE 183

>YMR023C (MSS1) [3987] chr13 complement(319436..321016)
           Mitochondrial GTPase involved in expression of COX1/OXI3
           [1581 bp, 526 aa]
          Length = 526

 Score = 33.9 bits (76), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 79/191 (41%), Gaps = 20/191 (10%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVT-IKFEIWDT 62
            KLVLLG  +VGKSS+V+    D       S +     +    ++   +V   K  I DT
Sbjct: 275 IKLVLLGAPNVGKSSLVNSLTNDDI-----SIVSDIPGTTRDSIDAMINVNGYKVIICDT 329

Query: 63  AG-QERYKSLAPMY--------YRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDL 113
           AG +E+      M            ++  L + D T    L+             G++ +
Sbjct: 330 AGIREKSSDKIEMLGIDRAKKKSVQSDLCLFIVDPTDLSKLLPEDILAHLSSKTFGNKRI 389

Query: 114 VICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVY 173
           +I  V NK DL +++E  + + K   ++ ++   L    VS KT  G+ ++   +  N  
Sbjct: 390 II--VVNKSDLVSDDEMTKVLNKLQTRLGSKYPIL---SVSCKTKEGIESLISTLTSNFE 444

Query: 174 QKKGAATAASP 184
               ++  ASP
Sbjct: 445 SLSQSSADASP 455

>CAGL0D05544g complement(527482..530217) similar to tr|Q07807
           Saccharomyces cerevisiae YLL013c transcript-specific
           regulator of mRNA degradation, hypothetical start
          Length = 911

 Score = 33.9 bits (76), Expect = 0.091,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 101 VEELKNKVGDQDLVI-CLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGS 159
           +EEL+    + DL +  + G+ L+ C ++ G R ++KE A     E+ L+F+E+     S
Sbjct: 551 LEELRANPTNTDLTLKSIYGHALEFCKDQHGSRFIQKELATAPPPERELVFNEIRDHALS 610

Query: 160 GVAAIFQEIGENVYQK 175
               +F   G  V QK
Sbjct: 611 LANDVF---GNYVIQK 623

>CAGL0E06292g 633135..634361 some similarities with sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1, start by
           similarity
          Length = 408

 Score = 32.7 bits (73), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/159 (17%), Positives = 68/159 (42%), Gaps = 32/159 (20%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSF----------DEFRESTIGAAF------------ 40
            F++++LGD  VGK+S++ +++ D++          D +R+     +F            
Sbjct: 20  NFRIMVLGDPKVGKTSMIMQWLTDNYRSGDEATYSDDIYRKKIPYYSFRLLNDKGLIAEK 79

Query: 41  ------LSQTIKLEKHEDVTIKFEIWDTAGQ---ERYKS-LAPMYYRNANAALVVYDVTQ 90
                 L  + + +      IK EI D       E Y + L  +  + ++A ++ +D   
Sbjct: 80  DVIDFNLDNSHRFQYTNKDLIKLEILDANIHDISEYYSNELRSLQVKQSDAIVICFDGKS 139

Query: 91  AGSLVKAQSWVEELKNKVGDQDLVICLVGNKLDLCTEEE 129
             +    + +   +K+ +G++ + + +   K+D   E++
Sbjct: 140 QTTFEHVREYYNTIKDALGEEQIPVVICNTKIDYLMEDK 178

>Scas_567.9
          Length = 199

 Score = 32.3 bits (72), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 12/93 (12%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD------SFDEFRESTIGAAFLSQTIKLEKHEDVTIK 56
           Q+ +++LG  + GK++ +    K+        D+    T+G      TI +E ++ + +K
Sbjct: 17  QYSILILGLDNAGKTTFLETCKKEFNLNSKPLDKI-TPTVGQNV--ATISVENNKKL-LK 72

Query: 57  FEIWDTAGQERYKSLAPMYYRNANAALVVYDVT 89
           F  WD  GQE  +S+   YY   +  + V D T
Sbjct: 73  F--WDVGGQENLRSMWSEYYSQCHGIIFVVDST 103

>KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomyces
           cerevisiae YPL051w ARL3 ADP-ribosylation factor-like
           protein, member of the arf-sar family in the ras
           superfamily, start by similarity
          Length = 199

 Score = 32.0 bits (71), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 57  FEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELK----NKVGDQD 112
           ++I D +GQE ++ L   Y+   N   +VY V  + S  + Q  + EL+    N     D
Sbjct: 70  WKIIDVSGQESFRYLWDSYFNKDNIHGIVYMVDTSDS-DRLQESINELQARYVNTPAAVD 128

Query: 113 LVICLVGNKLDLCTE 127
           + I +V NK D C +
Sbjct: 129 IPIAVVLNKTDQCLD 143

>Kwal_56.24149
          Length = 149

 Score = 31.6 bits (70), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 33/69 (47%)

Query: 55  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLV 114
           IKF  +D  G  + + L   Y+   N  + + D      L +A+  ++ L N    +D+ 
Sbjct: 26  IKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERLNEARVELDALFNIAELKDVP 85

Query: 115 ICLVGNKLD 123
             ++GNK+D
Sbjct: 86  FVILGNKID 94

>Kwal_26.6810
          Length = 664

 Score = 32.3 bits (72), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 7/70 (10%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSF-----DEFRESTIGAAFLSQTIKLEKHEDVTIKF 57
          Q K+V+ GD  VGK+S++   +KD F     D     TI   F S  +  +K   V +  
Sbjct: 5  QIKIVVCGDDGVGKTSLIAALLKDQFILNLQDSLPPVTIPQYFSSSPVCPKK--SVLVDT 62

Query: 58 EIWDTAGQER 67
            +D  G +R
Sbjct: 63 TSYDLPGLQR 72

>Scas_698.27
          Length = 701

 Score = 32.0 bits (71), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 18/102 (17%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDS----FDEFR-------ESTIGAAFLSQTIKLEKHED 52
              V+LG+ S GKS+I+ R ++DS     DE R       +S + A  L  +  +EK   
Sbjct: 271 LNFVMLGNESAGKSTIIGRLLEDSGLVRIDEIRSVKKELEKSKLNAEMLYLSKLMEKKMS 330

Query: 53  VTI-------KFEIWDTAGQERYKSLAPMYYRNANAALVVYD 87
            T        +F  +D  G  ++ S +    R    A++  D
Sbjct: 331 STFSLDKNVSEFSAFDIPGDLKHLSSSIKAIRQCTTAILTID 372

>CAGL0G09977g 951295..955881 similar to sp|Q06625 Saccharomyces
           cerevisiae YPR184w GDB1, hypothetical start
          Length = 1528

 Score = 32.0 bits (71), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 9/91 (9%)

Query: 79  ANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICL-------VGNKLDLCTEEEGG 131
            NAALV +  +  GS+        +L + V ++    C        V   L+   EE   
Sbjct: 685 PNAALVAFCSSAIGSVYGYDEVFPQLLDLVQEKRTYSCAENTGISKVKTLLNNMREEIAS 744

Query: 132 RGVEKEDAQMYAQEQG--LLFHEVSAKTGSG 160
             V+ ED++M+    G  + FH  +AK G G
Sbjct: 745 EAVDIEDSEMHVHHDGQYITFHRTNAKNGKG 775

>YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation
           factor-like protein, member of the arf-sar family in the
           ras superfamily [597 bp, 198 aa]
          Length = 198

 Score = 31.2 bits (69), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 61/129 (47%), Gaps = 17/129 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFR-----ESTIGAAFLSQTIKLEKHEDVTIKF 57
           Q+ +++LG  + GK++ +    K+    F+     + T+G      TI ++  +   +KF
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNV--ATIPVDSKQ--ILKF 72

Query: 58  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDL---V 114
             WD  GQE  +S+   YY   +  + + D +    L +  +    L++ V D+++    
Sbjct: 73  --WDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECST---TLQSVVMDEEIEGVP 127

Query: 115 ICLVGNKLD 123
           I ++ NK D
Sbjct: 128 ILMLANKQD 136

>Kwal_23.5383
          Length = 1514

 Score = 32.0 bits (71), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 13/105 (12%)

Query: 79  ANAALVVYDVTQAGSLV---KAQSWVEELKNKVGDQDLV----ICLVGNKLDLCTEEEGG 131
            NAALV +  T  GS+    +   ++ ++ N+    D+     I LV ++L    +E   
Sbjct: 676 PNAALVSFCSTAIGSVYGYDECFPYLLDVVNETRQYDVTENDGISLVKSRLHKIRDEFAQ 735

Query: 132 RGVEKEDAQMYAQEQG--LLFHEVSAKTGSGVAAI----FQEIGE 170
            G + ED++M+   +G  + F   +AKTG G   I    F + GE
Sbjct: 736 CGADIEDSEMHVHHEGQYVTFQRNNAKTGGGWFLIARTKFSDQGE 780

>AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH]
           complement(222754..223326) [573 bp, 190 aa]
          Length = 190

 Score = 31.2 bits (69), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 54/119 (45%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   +   E+    +IKF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTS---EELAIGSIKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
             + + L   Y+   N  + + D   +    +A+  ++ L      + +   ++GNK+D
Sbjct: 77  HIQARRLWKDYFPEVNGIVFLVDAADSERFNEARVELDALFQIPELKTVPFVILGNKID 135

>CAGL0L12826g complement(1370767..1371366) highly similar to
           tr|Q02804 Saccharomyces cerevisiae YPL051w
           ADP-ribosylation factor-like protein, start by
           similarity
          Length = 199

 Score = 30.8 bits (68), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 57/127 (44%), Gaps = 12/127 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQ---TIKLEKHEDVTIKFEI 59
           Q+ +++LG  + GK++ +    K+     +     A  + Q   TI ++ +  + +KF  
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSMHSKPLDKIAPTVGQNVATIPVDNNRSI-LKF-- 73

Query: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQD---LVIC 116
           WD  GQ   +++   YY   +  + V D T    + +     E L+  V D +   + I 
Sbjct: 74  WDVGGQASLRAMWSEYYPQCHGIIFVVDSTDRSRIDECS---ETLRTIVMDDEIEGIPIL 130

Query: 117 LVGNKLD 123
           ++ NK D
Sbjct: 131 MLANKQD 137

>Sklu_2411.4 YMR023C, Contig c2411 8898-10388
          Length = 496

 Score = 30.8 bits (68), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 61/134 (45%), Gaps = 23/134 (17%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTI-----KFE 58
            KLVLLG  + GKSS+++    D      E++I ++    T       DV I     K  
Sbjct: 248 IKLVLLGPPNAGKSSLLNSLTND------ETSIVSSIPGTT---RDSIDVPIDVNGYKVV 298

Query: 59  IWDTAG-------QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQ 111
           + DTAG       Q   + +     +++ + LVV  V  +  L       + +K+++ D+
Sbjct: 299 LCDTAGIRKNSSDQIELQGIRRAKMKSSQSDLVVLLVDASNELYITDDLKDHIKSQLRDK 358

Query: 112 DLVICLVGNKLDLC 125
           +++I +  NK DL 
Sbjct: 359 NIIIVV--NKSDLV 370

>Scas_721.90
          Length = 397

 Score = 30.8 bits (68), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 26/49 (53%)

Query: 2  LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKH 50
          +QF L+LLG++ +GK++ ++       +   ++ +    LS  I+   H
Sbjct: 27 IQFNLLLLGETGIGKTTFLNNLCNQVIENDNDTQVNVNPLSNNIETTTH 75

>Sklu_1689.1 YHR022C, Contig c1689 285-1358 reverse complement
          Length = 357

 Score = 30.8 bits (68), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 1/98 (1%)

Query: 68  YKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLDLCTE 127
           Y  +  +  + A+  ++ YD T   SL   + +   +    G + + + L GNK D+ TE
Sbjct: 136 YSEMRNIQTQQADGFILCYDSTNEESLDNLRMYQRRIWMLRG-EGVPLLLCGNKCDMGTE 194

Query: 128 EEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIF 165
            +   G+ +E    +  +      E SAK   GV  +F
Sbjct: 195 RKVNLGMVRELCDEFQVDFKTCHFETSAKDNFGVNELF 232

>KLLA0B02046g 178646..179218 highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family, start by similarity
          Length = 190

 Score = 30.0 bits (66), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 52/119 (43%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   +   E+     IKF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTS---EELAIGNIKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKLD 123
             + + L   Y+   N  + + D        +A+  ++ L       ++   ++GNK+D
Sbjct: 77  HLQARRLWKDYFPEVNGIVFLVDAADPERFNEARIELDALFQIKELDNVPFAVLGNKID 135

>Kwal_33.15113
          Length = 758

 Score = 30.4 bits (67), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 95  VKAQSWVEELKNKVGDQDLVIC-LVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEV 153
           V     +EE +N    ++  +  + G+ L+ C ++ G R +++E A+    E+ ++F+E+
Sbjct: 394 VPRSPLLEEFRNNTNGKNYKLPDIYGSALEFCKDQHGSRFIQQELAKASDAEKEVIFNEI 453

>CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces
           cerevisiae YHL020c Negative regulator of phospholipid
           biosynthesis, hypothetical start
          Length = 487

 Score = 30.4 bits (67), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 112 DLVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTG---SGVAAIFQEI 168
           D  +  + N  +  TEE   R    ED+Q   QE+  LF +V   +    + + + F+E+
Sbjct: 74  DSRMSQLSNVSNASTEERVVRVNSHEDSQSKRQEEESLFDKVCRNSNEILTNMGSFFEEM 133

Query: 169 GENVYQKKGAATAASPQARKTPNVKLQRPSTNDSTS 204
             NV+ + G+     P+      V+ +R S + ST+
Sbjct: 134 NSNVFMEGGSDV---PEEHPNGYVRPRRDSRSISTT 166

>AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH]
           complement(218211..218807) [597 bp, 198 aa]
          Length = 198

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 54/128 (42%), Gaps = 15/128 (11%)

Query: 3   QFKLVLLGDSSVGKSS-------IVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTI 55
            + +++LG  + GK++       + H + K    E    T+G      T+ L+K    T 
Sbjct: 17  HYSVLILGLDNAGKTTFLEQLKAVYHLYAKPL--EKIVPTVGQNV--ATVPLDK----TT 68

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVI 115
             + WD  GQE  +++   YY   +  + + D T    L +    +  +    G + + I
Sbjct: 69  LLKFWDVGGQEALRAMWSEYYVQTHGIIFIIDSTDRERLQECCDSLRSIVTDDGVEGVPI 128

Query: 116 CLVGNKLD 123
            ++ NK D
Sbjct: 129 LMLANKQD 136

>KLLA0A03465g complement(314573..316552) similar to sp|P39722
          Saccharomyces cerevisiae YAL048c vacuolar aspartic
          proteasse singleton, start by similarity
          Length = 659

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSF 28
          + ++V+ GDS VGK+S++   VKD F
Sbjct: 5  RIRIVVCGDSGVGKTSLIACLVKDQF 30

>YLL013C (PUF3) [3406] chr12 complement(122074..124713) Protein
           involved in metabolism of COX17 mRNA, has eight
           Pumilio-homology domains [2640 bp, 879 aa]
          Length = 879

 Score = 29.6 bits (65), Expect = 1.9,   Method: Composition-based stats.
 Identities = 11/37 (29%), Positives = 24/37 (64%)

Query: 117 LVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEV 153
           + G+ L+ C ++ G R +++E A   A E+ ++F+E+
Sbjct: 539 IFGHSLEFCKDQHGSRFIQRELATSPASEKEVIFNEI 575

>ADR402W [2142] [Homologous to ScYAL048C - SH]
          complement(1426900..1428885) [1986 bp, 661 aa]
          Length = 661

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSF 28
          + ++V+ GD  VGKSS++   VKD F
Sbjct: 5  RIRIVVCGDKGVGKSSLIACLVKDQF 30

>AER445C [2945] [Homologous to ScYJR076C (CDC11) - SH]
          (1492208..1493443) [1236 bp, 411 aa]
          Length = 411

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 9/72 (12%)

Query: 2  LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFREST---------IGAAFLSQTIKLEKHED 52
          +QF L+++G S  G+S+ ++        E   +          I      +T++LE  E 
Sbjct: 21 IQFTLMVVGQSGSGRSTFINTLCGQEVVETSTTVMLPNDDATQIDVQLREETVELEDDEG 80

Query: 53 VTIKFEIWDTAG 64
          V I+  I DT G
Sbjct: 81 VKIQLTIIDTPG 92

>KLLA0B08129g complement(718086..719732) some similarities with
           sp|P41901 Saccharomyces cerevisiae YGR059w SPR3
           sporulation-specific septin, hypothetical start
          Length = 548

 Score = 28.9 bits (63), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 37/70 (52%), Gaps = 7/70 (10%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDS-FDEFRESTIGAAFLSQTIKLEKHED------VT 54
           +QF ++++G S +GK++ ++     S      ES +    +++T K+ +HE        T
Sbjct: 148 VQFTMMVVGQSGLGKTTFINTLFGTSLLPTVWESDMTERGVTKTTKIVRHESELVENGFT 207

Query: 55  IKFEIWDTAG 64
           +++ + DT G
Sbjct: 208 LRYTVIDTPG 217

>YPR184W (GDB1) [5598] chr16 (902038..906648) Glycogen debranching
           enzyme (4-alpha-glucanotransferase or oligo-1, 4 - 1,
           4-glucantransferase), functions as a
           4-alpha-glucanotransferase and an amylo-1,6-glucosidase,
           plays roles in glycogen and starch catabolism [4611 bp,
           1536 aa]
          Length = 1536

 Score = 28.9 bits (63), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 38/100 (38%), Gaps = 14/100 (14%)

Query: 79  ANAALVVYDVTQAGSLVKAQSWVEELKNKV------------GDQDLVICLVGNKLDLCT 126
            NAALV    +  GS+         L N V            G   + I  V   L+   
Sbjct: 685 PNAALVALCSSAIGSVYGYDEIFPHLLNLVTEKRHYDISTPTGSPSIGITKVKATLNSIR 744

Query: 127 EEEGGRGVEKEDAQMYAQEQG--LLFHEVSAKTGSGVAAI 164
              G +  + ED++M+   QG  + FH +  K+G G   I
Sbjct: 745 TSIGEKAYDIEDSEMHVHHQGQYITFHRMDVKSGKGWYLI 784

>Kwal_56.24532
          Length = 468

 Score = 28.5 bits (62), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 55/134 (41%), Gaps = 12/134 (8%)

Query: 49  KHEDVTIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQA--GSLVKAQSWVEELKN 106
           + +D TI F   DT    RY   A M+    +A   + DV  +  G   +   WV + + 
Sbjct: 47  RDDDPTIFFRENDT---NRYTPRALMFDLEPSA---IADVENSFPGLFNERNVWVSKEEL 100

Query: 107 KVGDQDLVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQ 166
             G+        G    L  +EE    ++KE     + E   L H V+  TGSG+ + F 
Sbjct: 101 GAGNT----WSKGYDYGLENQEEFINMIDKEIDATESFEGFQLLHSVAGGTGSGLGSNFL 156

Query: 167 EIGENVYQKKGAAT 180
           E   + Y KK   T
Sbjct: 157 EALSDRYHKKIVTT 170

>Kwal_14.803
          Length = 693

 Score = 28.5 bits (62), Expect = 4.6,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 13/68 (19%)

Query: 96  KAQSWVEELKNK------VGDQDLVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLL 149
           KA   VE+L+NK      +GD       +  +LDL + E  G+ V+K   +  A+E  +L
Sbjct: 534 KANLVVEDLQNKDARAYQIGD-------LPEQLDLSSLESSGQNVKKNAVKTAAEEFSVL 586

Query: 150 FHEVSAKT 157
             E   KT
Sbjct: 587 ESEEKGKT 594

>Scas_678.24
          Length = 1610

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 108 VGDQDLVICLVGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAI 164
           VG  + +   +G  L + TE   G+G   E   MY+   G++F E+    G+G+  +
Sbjct: 827 VGSTENLTSAIGTALYVATEVLNGKGNYNEKIDMYS--LGIIFFEMIYPFGTGMERV 881

>YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein
           involved in the secretory pathway, has weak similarity
           to GTP-binding proteins of the RAS superfamily [1989 bp,
           662 aa]
          Length = 662

 Score = 28.5 bits (62), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 73/183 (39%), Gaps = 11/183 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63
           F   ++G    GKSS++  F+  SF E    TI       +++L+  +     + I    
Sbjct: 449 FNCFVIGKPCCGKSSLLEAFLGRSFSEEYSPTIKPRIAVNSLELKGGKQY---YLILQEL 505

Query: 64  GQERYKSLAPM-YYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122
           G++ Y  L      +  +   + YD +   S     S +++  +    QDL +  V +K 
Sbjct: 506 GEQEYAILENKDKLKECDVICLTYDSSDPESFSYLVSLLDKFTHL---QDLPLVFVASKA 562

Query: 123 DLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAATAA 182
           DL  +++  +    E A        L    +S++  S +  +F +I E      G  T  
Sbjct: 563 DLDKQQQRCQIQPDELADELFVNHPL---HISSRWLSSLNELFIKITEAALD-PGKNTPG 618

Query: 183 SPQ 185
            P+
Sbjct: 619 LPE 621

>Scas_631.9
          Length = 1521

 Score = 28.1 bits (61), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 118 VGNKLDLCTEEEGGRGVEKEDAQMYAQEQG--LLFHEVSAKTGSGVAAI----FQEIGE 170
           V + L+   E+ G +  + ED +M+   +G  + FH    K+G+G   I    F + GE
Sbjct: 728 VKSLLNEIREDIGSKTKDIEDCEMHVHHEGQYITFHRTDVKSGAGYYLIARTKFYDAGE 786

>Kwal_27.11684
          Length = 335

 Score = 27.7 bits (60), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 61/133 (45%), Gaps = 16/133 (12%)

Query: 8   LLGDSSVGKSSIVHR-FVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFE--IWDTAG 64
           ++G SS+ +S+ + R + K  F+  R +           +L K +D    +   I  TAG
Sbjct: 138 VVGTSSIRRSAQLRRKYPKLVFESVRGNI--------ETRLSKLDDPVTSYACIILATAG 189

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQS---WVEELKNKVGDQDLVICLVGNK 121
             R K LA    +  +++++ + V Q    ++ +S   WV  +  K+ D++  IC +  +
Sbjct: 190 LLRLK-LAHRITQTLDSSIMYHAVGQGALGIEIRSKDPWVTSILEKINDRNSTICCLAER 248

Query: 122 LDLCTEEEGGRGV 134
             L    EGG  V
Sbjct: 249 -SLMRTLEGGCSV 260

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.129    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,460,659
Number of extensions: 263816
Number of successful extensions: 1031
Number of sequences better than 10.0: 222
Number of HSP's gapped: 824
Number of HSP's successfully gapped: 222
Length of query: 205
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 108
Effective length of database: 13,238,163
Effective search space: 1429721604
Effective search space used: 1429721604
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)