Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.22062542515225e-66
KLLA0F11682g374591902e-16
Sklu_2398.2288591864e-16
Scas_656.1*102541721e-15
CAGL0M01870g315641803e-15
CAGL0J01595g344611762e-14
Sklu_2244.3271651722e-14
KLLA0A04609g423531734e-14
Scas_602.4d256571687e-14
ADR308C278641697e-14
KLLA0F20636g285511697e-14
YPR015C247541687e-14
Scas_710.9505571701e-13
Scas_718.36d330661681e-13
Kwal_27.10467302551681e-13
YPR013C317571681e-13
ADL050W146671601e-13
ADL042W281721662e-13
Scas_602.4266541652e-13
AEL077W336561662e-13
ADL040W330711663e-13
Scas_707.46338541654e-13
CAGL0L05786g348571645e-13
Kwal_26.8011190551586e-13
AGL207W277551591e-12
ADL051W173681542e-12
Scas_717.18354581531e-11
Scas_717.17d350571531e-11
AGR186C287511432e-10
KLLA0F22319g203471385e-10
ACR264W769561391e-09
CAGL0A01628g424551382e-09
AFR471C389681372e-09
YGL035C (MIG1)504531373e-09
Kwal_47.17888786561347e-09
AGR031W140551269e-09
Sklu_2351.6548661284e-08
KLLA0B00605g239551254e-08
KLLA0E10989g474511274e-08
Scas_693.31635501232e-07
CAGL0K12078g463531222e-07
KLLA0F01463g781541222e-07
AEL174W661531222e-07
KLLA0F23782g782511222e-07
CAGL0L03916g642571213e-07
YJL056C (ZAP1)880551213e-07
YOR113W (AZF1)914551204e-07
Scas_711.56832541204e-07
Scas_575.3455531195e-07
CAGL0M06831g645521195e-07
Scas_697.35839661187e-07
Kwal_14.2278463511177e-07
CAGL0H07557g476571179e-07
Scas_713.52620491171e-06
Kwal_14.2543711551161e-06
YBR066C (NRG2)220651112e-06
YGL254W (FZF1)299641122e-06
Sklu_2389.2767541133e-06
Scas_695.2571541123e-06
Scas_709.32822581115e-06
Kwal_47.19045266521096e-06
CAGL0J05060g713551116e-06
KLLA0A10373g206531077e-06
KLLA0F18524g357531097e-06
Sklu_2357.7157531041e-05
Kwal_27.10167285501071e-05
CAGL0I02816g291541071e-05
YNL027W (CRZ1)678511081e-05
CAGL0E01331g689571081e-05
ADL198W547541081e-05
Kwal_56.23925745501081e-05
Scas_712.2327591062e-05
Sklu_2289.1291501062e-05
KLLA0B03454g472501072e-05
KLLA0E08679g596571072e-05
YDR146C (SWI5)709561072e-05
Kwal_27.10925264551042e-05
CAGL0L07480g314581042e-05
Scas_569.2293561043e-05
Kwal_27.11460531661053e-05
Scas_721.921152521053e-05
Scas_718.44266551033e-05
CAGL0M04323g703581035e-05
KLLA0D16456g854481028e-05
AGL197W844501011e-04
YDR043C (NRG1)23153981e-04
ACL057W520531001e-04
Sklu_2181.141065991e-04
CAGL0E04884g148953992e-04
KLLA0F13046g137974992e-04
YPR022C113378983e-04
AGL071C39652973e-04
Scas_378.120852944e-04
CAGL0K09372g39652964e-04
YDR096W (GIS1)89448964e-04
CAGL0C02519g31851954e-04
YLR131C (ACE2)77048964e-04
Scas_687.3328851944e-04
Scas_712.42*29051945e-04
YMR037C (MSN2)70457955e-04
Scas_631.743350947e-04
YPR186C (PZF1)42950937e-04
YMR070W (MOT3)49070938e-04
YGL209W (MIG2)38251938e-04
YER028C39453938e-04
YDR216W (ADR1)132353949e-04
Kwal_23.540042951920.001
CAGL0L06072g30053910.001
Kwal_47.1724140365910.001
AEL278W47655900.002
CAGL0L11880g98048910.002
AGR172W105753900.003
CAGL0K02145g31753880.003
YER169W (RPH1)79648890.003
Kwal_26.802150751880.004
Kwal_47.16621117857880.005
Scas_717.1752554870.006
KLLA0C17710g82148870.006
KLLA0F26961g69458870.006
KLLA0B07909g92258870.006
AER159C119157870.006
CAGL0K04631g101357860.007
KLLA0B04477g133257860.007
Sklu_2443.2221357840.008
Scas_602.954753850.008
CAGL0M00594g102056860.008
Kwal_56.2345382848850.011
Kwal_26.835169875840.012
YPL038W (MET31)17749810.012
YKL062W (MSN4)63058840.012
CAGL0F05995g59754840.012
CAGL0L12562g22352820.012
CAGL0E06116g61351840.013
CAGL0K03003g64752840.013
Scas_707.3128960830.014
YDR253C (MET32)19159810.016
Scas_649.2873070830.019
Scas_627.6120759830.020
CAGL0H04213g132168830.020
YML081W125153820.022
Kwal_26.930030479810.022
CAGL0I02838g65551820.023
KLLA0F07073g55859820.024
YPL230W39150810.026
KLLA0C17072g47453810.026
Scas_681.1986448810.027
CAGL0G10021g39453800.031
Scas_683.2587955800.042
AGR117C79948800.044
Scas_721.5619960780.045
ABR089C57158790.048
Scas_720.3331651770.076
Scas_703.23134153770.11
KLLA0E18645g43157760.11
YJR127C (ZMS1)138053760.13
CAGL0M13189g54158760.13
CAGL0K02343g116254760.14
CAGL0H04873g45159750.14
YER130C44359750.14
YMR182C (RGM1)21145730.18
Kwal_47.1657788136740.25
AFR580C83860730.25
CAGL0K04697g51559730.26
YGR067C79460730.27
CAGL0B02651g18948700.39
CAGL0E03762g58448710.46
Scas_670.243568700.68
YDL048C (STP4)49059681.0
AFL136W40946681.0
Sklu_2359.572256681.1
KLLA0E13519g23054661.6
KLLA0E00726g51738661.9
AFR588W31959652.2
Sklu_2126.544838652.2
Kwal_47.1867862551652.4
Sklu_2206.235859652.5
CAGL0L00583g38841634.4
KLLA0C16005g33144625.1
Kwal_55.2063441940625.4
YHL027W (RIM101)62538625.5
YLR375W34359618.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2206
         (251 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2206                                                          205   5e-66
KLLA0F11682g complement(1068992..1070116) some similarities with...    78   2e-16
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                76   4e-16
Scas_656.1*                                                            71   1e-15
CAGL0M01870g complement(219813..220760) some similarities with t...    74   3e-15
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...    72   2e-14
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                71   2e-14
KLLA0A04609g complement(411494..412765) some similarities with s...    71   4e-14
Scas_602.4d                                                            69   7e-14
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    70   7e-14
KLLA0F20636g complement(1914452..1915309) some similarities with...    70   7e-14
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...    69   7e-14
Scas_710.9                                                             70   1e-13
Scas_718.36d                                                           69   1e-13
Kwal_27.10467                                                          69   1e-13
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...    69   1e-13
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    66   1e-13
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    69   2e-13
Scas_602.4                                                             68   2e-13
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    69   2e-13
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    69   3e-13
Scas_707.46                                                            68   4e-13
CAGL0L05786g complement(636176..637222) some similarities with t...    68   5e-13
Kwal_26.8011                                                           65   6e-13
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    66   1e-12
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    64   2e-12
Scas_717.18                                                            64   1e-11
Scas_717.17d                                                           64   1e-11
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    60   2e-10
KLLA0F22319g complement(2086613..2087224) some similarities with...    58   5e-10
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    58   1e-09
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    58   2e-09
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    57   2e-09
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    57   3e-09
Kwal_47.17888                                                          56   7e-09
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    53   9e-09
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       54   4e-08
KLLA0B00605g complement(46736..47455) some similarities with sp|...    53   4e-08
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    54   4e-08
Scas_693.31                                                            52   2e-07
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    52   2e-07
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    52   2e-07
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    52   2e-07
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    52   2e-07
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    51   3e-07
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    51   3e-07
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    51   4e-07
Scas_711.56                                                            51   4e-07
Scas_575.3                                                             50   5e-07
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    50   5e-07
Scas_697.35                                                            50   7e-07
Kwal_14.2278                                                           50   7e-07
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    50   9e-07
Scas_713.52                                                            50   1e-06
Kwal_14.2543                                                           49   1e-06
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    47   2e-06
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    48   2e-06
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            48   3e-06
Scas_695.2                                                             48   3e-06
Scas_709.32                                                            47   5e-06
Kwal_47.19045                                                          47   6e-06
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    47   6e-06
KLLA0A10373g complement(907244..907864) some similarities with c...    46   7e-06
KLLA0F18524g complement(1701498..1702571) some similarities with...    47   7e-06
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        45   1e-05
Kwal_27.10167                                                          46   1e-05
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    46   1e-05
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    46   1e-05
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    46   1e-05
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    46   1e-05
Kwal_56.23925                                                          46   1e-05
Scas_712.2                                                             45   2e-05
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          45   2e-05
KLLA0B03454g complement(314015..315433) some similarities with s...    46   2e-05
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    46   2e-05
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    46   2e-05
Kwal_27.10925                                                          45   2e-05
CAGL0L07480g complement(822240..823184) some similarities with s...    45   2e-05
Scas_569.2                                                             45   3e-05
Kwal_27.11460                                                          45   3e-05
Scas_721.92                                                            45   3e-05
Scas_718.44                                                            44   3e-05
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    44   5e-05
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    44   8e-05
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    44   1e-04
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    42   1e-04
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    43   1e-04
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            43   1e-04
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    43   2e-04
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    43   2e-04
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    42   3e-04
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    42   3e-04
Scas_378.1                                                             41   4e-04
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    42   4e-04
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...    42   4e-04
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    41   4e-04
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    42   4e-04
Scas_687.33                                                            41   4e-04
Scas_712.42*                                                           41   5e-04
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    41   5e-04
Scas_631.7                                                             41   7e-04
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    40   7e-04
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    40   8e-04
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    40   8e-04
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    40   8e-04
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    41   9e-04
Kwal_23.5400                                                           40   0.001
CAGL0L06072g complement(679924..680826) some similarities with s...    40   0.001
Kwal_47.17241                                                          40   0.001
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    39   0.002
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    40   0.002
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    39   0.003
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    39   0.003
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...    39   0.003
Kwal_26.8021                                                           39   0.004
Kwal_47.16621                                                          39   0.005
Scas_717.17                                                            38   0.006
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...    38   0.006
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    38   0.006
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    38   0.006
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    38   0.006
CAGL0K04631g complement(440721..443762) some similarities with s...    38   0.007
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    38   0.007
Sklu_2443.22 , Contig c2443 45390-46027                                37   0.008
Scas_602.9                                                             37   0.008
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    38   0.008
Kwal_56.23453                                                          37   0.011
Kwal_26.8351                                                           37   0.012
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    36   0.012
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    37   0.012
CAGL0F05995g complement(598819..600612) some similarities with s...    37   0.012
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    36   0.012
CAGL0E06116g complement(604708..606549) some similarities with t...    37   0.013
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    37   0.013
Scas_707.31                                                            37   0.014
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    36   0.016
Scas_649.28                                                            37   0.019
Scas_627.6                                                             37   0.020
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    37   0.020
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    36   0.022
Kwal_26.9300                                                           36   0.022
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    36   0.023
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    36   0.024
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    36   0.026
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    36   0.026
Scas_681.19                                                            36   0.027
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    35   0.031
Scas_683.25                                                            35   0.042
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...    35   0.044
Scas_721.56                                                            35   0.045
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    35   0.048
Scas_720.33                                                            34   0.076
Scas_703.23                                                            34   0.11 
KLLA0E18645g complement(1648263..1649558) some similarities with...    34   0.11 
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    34   0.13 
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    34   0.13 
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    34   0.14 
CAGL0H04873g complement(465069..466424) some similarities with t...    33   0.14 
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    33   0.14 
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    33   0.18 
Kwal_47.16577                                                          33   0.25 
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    33   0.25 
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    33   0.26 
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    33   0.27 
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    32   0.39 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    32   0.46 
Scas_670.2                                                             32   0.68 
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    31   1.0  
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    31   1.0  
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          31   1.1  
KLLA0E13519g complement(1190615..1191307) some similarities with...    30   1.6  
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    30   1.9  
AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C (...    30   2.2  
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            30   2.2  
Kwal_47.18678                                                          30   2.4  
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            30   2.5  
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    29   4.4  
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    28   5.1  
Kwal_55.20634                                                          28   5.4  
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    28   5.5  
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    28   8.0  

>Kwal_14.2206
          Length = 254

 Score =  205 bits (522), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 123/251 (49%)

Query: 1   MNMPEERGRGRVLSRKWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MNMPEERGRGRVLSRKW                                           
Sbjct: 1   MNMPEERGRGRVLSRKWSRGMSRGSSGSSAGSVGSVGSVSSIGSVGSVGSMGGCGSGGGG 60

Query: 61  XXXXXXXXXLSEILREVKKPEIXXXXXXXXXXXXXPRDVRLPSCGXXXXXXXXXXXXXXX 120
                    LSEILREVKKPEI             PRDVRLPSCG               
Sbjct: 61  GGGGSGARSLSEILREVKKPEIRSRGGGSSSSSSGPRDVRLPSCGQAPVFPPFPPAPVFP 120

Query: 121 XXXXXXXXXXXXXXAPLVPTPVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTP 180
                         APLVPTPVV                                  MTP
Sbjct: 121 PFPSPPSQFPVAQFAPLVPTPVVLQLSSAGPPPLGSPIGPQSAASSPGAASGSSPGGMTP 180

Query: 181 VHTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLM 240
           VHTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLM
Sbjct: 181 VHTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLM 240

Query: 241 RHRKIHAKWRD 251
           RHRKIHAKWRD
Sbjct: 241 RHRKIHAKWRD 251

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 77.8 bits (190), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 43/59 (72%)

Query: 190 SSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +++ + C  CGK F+RPS LSTH  IHTG +PY C  PNC K+FN KSN++RH K+H K
Sbjct: 300 ANSKYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLK 358

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 76.3 bits (186), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 40/59 (67%)

Query: 193 HHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
            H C  CGK+F RPS L TH++IH G  PYAC    C KRFNVK NL+RH +IH K ++
Sbjct: 217 QHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKKKE 275

>Scas_656.1*
          Length = 102

 Score = 70.9 bits (172), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C ICGK  +R S L TH L+HTG +P+ C   NCGK FNVKSN+ RH K+H K
Sbjct: 41  QCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHLK 94

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 73.9 bits (180), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (62%)

Query: 188 ATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
            +  T   C++C K F RPS LSTH  IHTG +PY C   NC K FN KSN++RH K+H 
Sbjct: 167 TSEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHF 226

Query: 248 KWRD 251
           K  +
Sbjct: 227 KLSN 230

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 40/61 (65%)

Query: 188 ATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           AT+    +C +CGK  SRPS L TH LIHTG  P+ C   +C K FNVKSNL+RH K H 
Sbjct: 278 ATTRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHE 337

Query: 248 K 248
           K
Sbjct: 338 K 338

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 70.9 bits (172), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 184 PRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR 243
           PR    S T+  C  C K F RPSGL TH +IH G  P+ C  PNC K+FNVKSNL+RH 
Sbjct: 207 PRKKRVSYTYC-CPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHY 265

Query: 244 KIHAK 248
           + H +
Sbjct: 266 RSHNR 270

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 71.2 bits (173), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (71%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           ++C ICG+  SRPS L TH  IHTG +PY C   NC KRFNVKSN++RH K H
Sbjct: 341 NQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRH 393

>Scas_602.4d
          Length = 256

 Score = 69.3 bits (168), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 37/57 (64%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           EC +CGK  SRPS L TH LIHTG  P+ C    C K FNVKSN+ RH K H + ++
Sbjct: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKN 252

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 69.7 bits (169), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (68%)

Query: 188 ATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           + S+  + C++CG+   RPS L TH L HTG +P++C  P C K FNV+SN++RH ++H+
Sbjct: 198 SVSTKKNVCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHS 257

Query: 248 KWRD 251
           +  +
Sbjct: 258 RGSE 261

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 69.7 bits (169), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 37/51 (72%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C  CGK F+RPS L TH L+H+G +P+ C    C K+FNVKSNL+RH K+H
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLH 284

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score = 69.3 bits (168), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (68%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C ICGK  SRPS L TH LIHTG  P+ C   +C K FNVKSN++RH + H K
Sbjct: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239

>Scas_710.9
          Length = 505

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 39/57 (68%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C++CGK  +R S L TH LIHTG +P++C  P C K FNVKSN+ RH K+H    D
Sbjct: 448 QCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLHLIKED 504

>Scas_718.36d
          Length = 330

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 40/66 (60%)

Query: 181 VHTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLM 240
           V    SA      + C +CGK F RPS L TH+ I +G++PY C   NC K FN KSN++
Sbjct: 226 VEVETSAFDEKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNML 285

Query: 241 RHRKIH 246
           RH K+H
Sbjct: 286 RHYKLH 291

>Kwal_27.10467
          Length = 302

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 37/55 (67%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           + C  CGK F+RPS L+TH   HTG +PY C   NC K+FN +SN+ RH K+H K
Sbjct: 198 YTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLHFK 252

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (66%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C +CGK  SRPS L TH LIHTG  P+ C    C K FNVKSN++RH K H + R+
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRN 311

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 180 PVHTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNL 239
           P  +P  A  S T   C +C K F+R + L+TH LIH   +PY CD  NC K FNVKSNL
Sbjct: 65  PALSPLMALNSKT---CPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNL 121

Query: 240 MRHRKIH 246
            RH +IH
Sbjct: 122 NRHLRIH 128

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (62%), Gaps = 4/72 (5%)

Query: 179 TPVHTPRSAATSSTHHE----CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFN 234
           +P+HT ++    S + +    C ICGK F RPS L TH ++H   +PY C+   C KRFN
Sbjct: 206 SPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFN 265

Query: 235 VKSNLMRHRKIH 246
           VKSN++RH + H
Sbjct: 266 VKSNMLRHMRKH 277

>Scas_602.4
          Length = 266

 Score = 68.2 bits (165), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 35/54 (64%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C  CGK  SRPS L  H LIHTG  P+ C   NC K FNVKSN++RH K H K
Sbjct: 201 QCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 38/56 (67%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           +C +CGK   RPS L  H  IHTG +P+ C+ P C KRFNVKSN++RH ++H   R
Sbjct: 275 QCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQR 330

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 68.6 bits (166), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 43/71 (60%)

Query: 178 MTPVHTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKS 237
           + P+  P ++    T+  C +CG+  +RPS L TH LIHTG  P+ C  P C KRFNV+S
Sbjct: 242 VLPIVGPAASPRYETNKTCLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRS 301

Query: 238 NLMRHRKIHAK 248
           N+ RH   H +
Sbjct: 302 NMNRHVNSHKR 312

>Scas_707.46
          Length = 338

 Score = 68.2 bits (165), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (68%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C +CGK  SRPS L TH LIHTG  P+ C   +C K FNVKSN++RH K H K
Sbjct: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score = 67.8 bits (164), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 38/57 (66%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C +CGK  SRPS L TH LIHTG  P+ C   +C K FNVKSN++RH K H + + 
Sbjct: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342

>Kwal_26.8011
          Length = 190

 Score = 65.5 bits (158), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           ++C++C K FSR S L  H L HTG +P+ C   +C K FNVKSN++RH K H +
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTHKQ 182

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 65.9 bits (159), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 37/55 (67%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           + C  CGK F+R S L TH  IHTG +P+ C   NCGK FN +SN++RH K+H +
Sbjct: 183 YVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFR 237

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 63.9 bits (154), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 40/68 (58%)

Query: 181 VHTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLM 240
           V  P ++    +   C IC K+F+R + L TH LIHT  +PY C    C K FNVKSNL 
Sbjct: 103 VSDPANSVHKVSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLY 162

Query: 241 RHRKIHAK 248
           RH +IH +
Sbjct: 163 RHERIHKR 170

>Scas_717.18
          Length = 354

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (63%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           H+C IC K  +R + L +H LIHTG +PY C  PNC    +VKSN+ RH K H K ++
Sbjct: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQN 353

>Scas_717.17d
          Length = 350

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (64%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           H C +CGK+ +R + L TH LIHTG +P+ C  PNC    +VKSN+ RH K H K +
Sbjct: 285 HICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLKGQ 341

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C +CGK+F+R S L  H LIHT  +P+ C    C K FNVKSNL RH +IH
Sbjct: 169 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIH 217

>KLLA0F22319g complement(2086613..2087224) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 203

 Score = 57.8 bits (138), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%)

Query: 200 GKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           GK FSRPS L TH ++H+  +P+ C   +C K +NVKSNL RH K H
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKH 198

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           +C  CGK F++   L TH  +HTG +PY CD   CGKRF+ K NL  H   H  ++
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYECD--KCGKRFSRKGNLAAHMLTHENYK 569

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR 243
           +EC  CGK FSR   L+ H L H  ++P+ C   +C K F    N+  H+
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQ 592

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 193 HHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
            H+C  C K F++ + L  H   H G++P+ C+   CGKRF    NL  H ++H   R
Sbjct: 486 QHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLHTGER 541

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           H C ICG+ F R    + H   HTG +P+ACD P C KRF+    L RHR+IH  
Sbjct: 43  HVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTN 97

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%)

Query: 183 TPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           TP S   +   + C IC + F R    + H   HTG +P+ACD   CGKRF+ +  L RH
Sbjct: 11  TPYSGPDAPRPYVCPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRH 70

Query: 243 RKIHAKWR 250
           R+IH   R
Sbjct: 71  RRIHESDR 78

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           H C IC + F R    + H  IHTG +P+ACD P C KRF+    L RHR+IH
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>Kwal_47.17888
          Length = 786

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           +C  CGK F++   L TH  +HTG +PY C+   CG+RF+ K NL  HR  H   +
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYECEK--CGRRFSRKGNLAAHRLTHENLK 585

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 188 ATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           A  +  HEC  C K F++ + L  H   H G++P+ C+   CGKRF    NL  H ++H
Sbjct: 497 ARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR 243
           +EC  CG+ FSR   L+ H L H   +P+ C    C K F    N+  H+
Sbjct: 559 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQ 608

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           H C+ CGK F+    L+ H  IHTG + +AC  P CG+RF+   N ++H + H K
Sbjct: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%)

Query: 183 TPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           +P S   S   + C IC + F R    + H   HTG +P+AC+ P CGKRF+    L RH
Sbjct: 23  SPNSGPDSPRPYVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRH 82

Query: 243 RKIHAK 248
            +IH  
Sbjct: 83  TRIHTN 88

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 29/55 (52%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           C ICG  F R    + H   HTG +P+AC  P C KRF+    L RH K H K R
Sbjct: 14  CEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKSR 68

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (58%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C IC + F R    + H   HTG +P+ACD P C KRF+    L RHR+IH
Sbjct: 28  CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH 78

>Scas_693.31
          Length = 635

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           CGK F R     +H   H   +PYACD PNC K F    +L+RH+K+H++
Sbjct: 496 CGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVHSE 545

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 29/69 (42%)

Query: 182 HTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMR 241
           HT   +  S++    +I  K  + P G     +     + + C  PNCGK F  + N   
Sbjct: 449 HTFDESYLSTSSSPVKITRKLTTLPPGSIDRYVKELPDKTFECLYPNCGKHFKRRYNTRS 508

Query: 242 HRKIHAKWR 250
           H + H + R
Sbjct: 509 HIQTHLEDR 517

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           C++CGK F+    L+ H  IHTG + + C    CG+RFN   N ++H K H K
Sbjct: 404 CKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHLK 456

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C +C K++S  S L  H   HTG +P +C  P C KRFN  SNL +H + H +
Sbjct: 721 KCHLCPKSYSTSSSLRIHIRTHTGEKPLSC--PICNKRFNESSNLAKHIRTHKR 772

 Score = 38.9 bits (89), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 182 HTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMR 241
           H P  +  SS   E   C K F +   L  H  +H+ ++P+ C    CGK FN +  L +
Sbjct: 654 HVP--SGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRC--AECGKCFNTQDILTQ 709

Query: 242 HRKIHAKWR 250
           H ++H+  R
Sbjct: 710 HLRVHSGER 718

 Score = 35.8 bits (81), Expect = 0.027,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 199 CGKTFSRPSGLSTHA---LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           C K F     L+ H     + +G   Y C+   C K F  K  L+RH K+H+K++
Sbjct: 636 CNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSKYK 690

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           C  C K FS  S L  H   HTG +P +C    CGKRFN  SNL +H KIH +
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIHER 624

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C  CGK F++   L TH  +HTG +PY C+   CG++F+ K NL  H+  H
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYECE--RCGRKFSRKGNLAAHKLTH 601

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 27/55 (49%)

Query: 189 TSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR 243
           T    +EC  CG+ FSR   L+ H L H   +P+ C   +C K F    N+  H+
Sbjct: 574 TGEKPYECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQ 628

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 181 VHTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLM 240
           V  P+S        +C  C K F++ + L  H   H G++P++C+   CGKRF    NL 
Sbjct: 512 VEKPKSKGVK--QFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLR 567

Query: 241 RHRKIH 246
            H ++H
Sbjct: 568 THIRLH 573

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           ++C  C K FS+ + L  H   H G++P+ C+   CGKRF    NL  HR++H   R
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLHTGER 534

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           EC  CGK F++   L TH  +HTG +P+ CD   C K F  + NL  H   H
Sbjct: 509 ECEFCGKRFTQAGNLRTHRRLHTGERPFKCDK--CDKTFARRGNLTAHEFTH 558

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           +C  C KTF+R   L+ H   H   +PY C   NC KRF+   N+  H+  +
Sbjct: 537 KCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSHQNKY 588

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           ++C IC K F+  S L  H   HTG +P  C    CGKRFN  SNL +H K H K
Sbjct: 796 YKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQK 848

 Score = 32.7 bits (73), Expect = 0.30,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 199 CGKTFSRPSGLSTH---ALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           C K+FS    L+ H     +  G   Y C   +C + F  +  L+RH K+H+K++
Sbjct: 712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYK 766

 Score = 32.3 bits (72), Expect = 0.43,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           C +TF +   L  H  +H+ ++PY C    C + F+ +  L++H + H+
Sbjct: 745 CHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTHS 791

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           C  CGK F++   L TH  +HTG +PY+CD   C K+F+ K NL  H   H K +
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQKLK 675

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           HEC  C + FS+ + L  H   H G++P+ CD   CGKRF    NL  H ++H
Sbjct: 593 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 643

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 26/55 (47%)

Query: 189 TSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR 243
           T    + C IC K FSR   L+ H + H   +P+ C   NC K F    N+  H+
Sbjct: 644 TGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQ 698

>Scas_711.56
          Length = 832

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C ICGK F+  S L  H   HTG +P  C    CGK FN  SNL +H K H K
Sbjct: 755 KCDICGKRFAISSSLKIHIRTHTGEKPLHCKI--CGKAFNESSNLSKHMKTHLK 806

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           +C IC K FS    L  H   H+G +P+ CD   CGKRF + S+L  H + H
Sbjct: 727 QCSICKKHFSNEETLKQHERTHSGEKPFKCDI--CGKRFAISSSLKIHIRTH 776

 Score = 36.6 bits (83), Expect = 0.016,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 192 THHECRI--CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           + +EC    C K FS+   L  H  +H+G++P+ C    C K F+ +  L +H + H+
Sbjct: 694 SQYECHWANCHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTHS 749

 Score = 34.7 bits (78), Expect = 0.074,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 5/62 (8%)

Query: 194 HECRI--CGKTFSRPSGLSTHA---LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           H CR   C  +FS    L+ H     +  G   Y C   NC K F+ +  L+RH ++H+ 
Sbjct: 663 HNCRWGDCSGSFSSAQELNIHMENMHLLKGQSQYECHWANCHKIFSQRQRLVRHMRVHSG 722

Query: 249 WR 250
           ++
Sbjct: 723 YK 724

>Scas_575.3
          Length = 455

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           H C IC + F R    + H   HTG +P+ CD P C K+F+    L RH++IH
Sbjct: 68  HVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIH 120

 Score = 28.1 bits (61), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 194 HECRI--CGKTFSRPSGLSTHALIHTGHQP 221
           HEC    C K FSR   L+ H  IHT  QP
Sbjct: 96  HECDFPGCVKKFSRSDELTRHKRIHTNPQP 125

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           C +CGK FSRP  L +H   HT  +PY C    CGK F  + +  RH  +H 
Sbjct: 523 CEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLHT 572

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAP-------NCGKRFNVKSNLMRHRK 244
           ++C ICGK F+R      H  +HTG + Y C           CGK+F     L RH K
Sbjct: 549 YQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHFK 606

>Scas_697.35
          Length = 839

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 181 VHTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLM 240
           V  P++    S  H+C  C + F++ + L  H   H G++PY C    CGKRF    NL 
Sbjct: 502 VEKPKTLHEGSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLR 559

Query: 241 RHRKIH 246
            H+++H
Sbjct: 560 THQRLH 565

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           ++C  CGK F++   L TH  +HTG +PY C+   C K+F+ K NL  H   H K
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CDKKFSRKGNLAAHLLTHQK 595

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 30/63 (47%)

Query: 181 VHTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLM 240
           + T +   T    +EC +C K FSR   L+ H L H   +P+ C   NC + F    N+ 
Sbjct: 558 LRTHQRLHTGEKPYECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMK 617

Query: 241 RHR 243
            H+
Sbjct: 618 AHQ 620

>Kwal_14.2278
          Length = 463

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C IC + F R    + H   HTG +P+ACD   C KRF+    L RH++IH
Sbjct: 25  CPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 196 CRI--CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           C+I  C + FS PS L+ H   HT  +PY CD PNCGKRF    +L  H+  HA+ +
Sbjct: 59  CQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRFLRPCHLRVHKWTHAQVK 115

 Score = 31.6 bits (70), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 2/50 (4%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           CGK F RP  L  H   H   +P  C    C +RF     L RH   H +
Sbjct: 94  CGKRFLRPCHLRVHKWTHAQVKPLKCSY--CERRFITNQQLKRHTNTHER 141

>Scas_713.52
          Length = 620

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 28/49 (57%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           CGK F R   + +H   H   +PYACD P C K F    +L+RH+K HA
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHA 535

>Kwal_14.2543
          Length = 711

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           ++C  CGK F+  S L  H   HTG +P  C    CGKRFN  SNL +H + H +
Sbjct: 634 YKCSHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHMRTHER 686

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           C  C KTFS    L  H   H+G +PY C   +CGK F   S+L  H + H 
Sbjct: 608 CVHCLKTFSTQDILQQHMRTHSGEKPYKC--SHCGKGFATSSSLRIHIRTHT 657

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 5/67 (7%)

Query: 189 TSSTHHECR--ICGKTFSRPSGLSTH---ALIHTGHQPYACDAPNCGKRFNVKSNLMRHR 243
           T +  H CR   C + FS    L+TH     I  G   Y C   NCG+    +  L+RH 
Sbjct: 538 TDNQKHICRWDACMQEFSSCEELNTHIEKEHIPRGKSSYVCGWENCGRVITQRQKLLRHL 597

Query: 244 KIHAKWR 250
           ++H +++
Sbjct: 598 RVHTRYK 604

 Score = 27.7 bits (60), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           CG+  ++   L  H  +HT ++P  C   +C K F+ +  L +H + H+
Sbjct: 583 CGRVITQRQKLLRHLRVHTRYKP--CKCVHCLKTFSTQDILQQHMRTHS 629

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%)

Query: 183 TPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           T  + A   T H C+IC   F+    LS H  IHTG + + C    CG+RF+   N  +H
Sbjct: 142 TKTNTAGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQH 201

Query: 243 RKIHA 247
            + HA
Sbjct: 202 YRTHA 206

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 189 TSSTHHECRI--CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           T S +++C    C K ++RPS L  H   HT  +PY CD P CGK+F    +L  H+  H
Sbjct: 7   TKSRNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTH 66

Query: 247 AKWR 250
           ++ +
Sbjct: 67  SQIK 70

 Score = 35.4 bits (80), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           CGK F RP  L  H   H+  +P AC    C KRF     L RH   H +
Sbjct: 49  CGKKFIRPCHLRVHKWTHSQIKPKACTL--CQKRFVTNQQLRRHLNSHER 96

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C  C K F+  S L  H   HTG +P  C    CGKRFN  SNL +H K H +
Sbjct: 687 KCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTHER 738

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 182 HTPRSAATSSTHHECR--ICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNL 239
           H PR  ++    ++C    C K+F++   L  H  +H+G++P+ C  P+C K+F+ +  L
Sbjct: 620 HIPRGQSS----YQCSWDTCSKSFTQRQKLLRHLKVHSGYKPFKC--PHCTKKFSTEDIL 673

Query: 240 MRHRKIHAKWR 250
            +H + H+  R
Sbjct: 674 QQHIRTHSGER 684

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

Query: 178 MTPV-HTPRSAAT-SSTHHECR--ICGKTFSRPSGLSTH---ALIHTGHQPYACDAPNCG 230
           +TPV + P   +T   + H C+   C + F  P  L+ H     I  G   Y C    C 
Sbjct: 577 LTPVSYDPSEGSTGDESVHVCKWANCSQVFPNPEALNNHIESQHIPRGQSSYQCSWDTCS 636

Query: 231 KRFNVKSNLMRHRKIHAKWR 250
           K F  +  L+RH K+H+ ++
Sbjct: 637 KSFTQRQKLLRHLKVHSGYK 656

>Scas_695.2
          Length = 571

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           + C +C KTF+RP  L +H   HT   P+ C+   CGK F  + +  RH  +H 
Sbjct: 452 YACELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAFARQHDRKRHEDLHT 503

 Score = 35.0 bits (79), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 7/59 (11%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAP-------NCGKRFNVKSNLMRHRKIHA 247
           C ICGK F+R      H  +HTG + Y C           C K+F     L RH K  +
Sbjct: 482 CNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHFKTDS 540

>Scas_709.32
          Length = 822

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 195 ECRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C  CGK F R   L  H   +H+  +P+AC  P C K+F+   NL +H K H K  D
Sbjct: 766 KCETCGKAFRRSEHLKRHIRSVHSSERPFAC--PTCDKKFSRSDNLAQHIKTHKKRGD 821

>Kwal_47.19045
          Length = 266

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           +C +CGK F R      H   HTG +P++C+ P C KRF+    L RH + H
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTH 66

 Score = 28.1 bits (61), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 213 ALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           AL   GH+P+ CD   CGK F+   +  RH + H
Sbjct: 5   ALQEGGHRPFKCDM--CGKGFHRLEHKRRHIRTH 36

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +EC IC K F+  + L  H   HTG +P  C    CG+ FN  SNL +H K H K
Sbjct: 625 YECHICHKRFAISNSLKIHIRTHTGEKPLKCKV--CGRCFNESSNLSKHMKTHMK 677

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           C KTFS+   L  H  +H+ ++PY C  P C K F+ +  L +H+++H+
Sbjct: 574 CNKTFSQRQKLVRHLKVHSKYKPYQC--PQCQKCFSTEDTLNQHKRVHS 620

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           ++C  C K FS    L+ H  +H+G +PY C    C KRF + ++L  H + H 
Sbjct: 597 YQCPQCQKCFSTEDTLNQHKRVHSGEKPYECHI--CHKRFAISNSLKIHIRTHT 648

 Score = 34.7 bits (78), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 199 CGKTFSRPSGLSTHAL---IHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           C + F     L+ H     +  G   Y C+   C K F+ +  L+RH K+H+K++
Sbjct: 541 CNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSKYK 595

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 45.8 bits (107), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           C K F RPS L  H L H+  +PY C    CGK F  K    RH++ H + +D
Sbjct: 45  CDKAFLRPSHLRVHMLSHSKVKPYNCSV--CGKGFATKQQFQRHQQTHTQNQD 95

 Score = 40.4 bits (93), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (51%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           CGK +SRP  L  H   HT  +P+ C  P C K F   S+L  H   H+K +
Sbjct: 15  CGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLSHSKVK 66

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           C+IC + F+    L+ H  IHTG + + C  P C +RF+   N ++H + H K
Sbjct: 286 CKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           C+IC + F+    L+ H  IHTG + + C    CG+RF+   N ++H + H K
Sbjct: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154

>Kwal_27.10167
          Length = 285

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           C K + +PS L  H   H  ++P+AC  PNCGKRF    ++  HR  H+K
Sbjct: 42  CNKRYRKPSSLREHVNSHNNNRPFACPEPNCGKRFLRVCHMNVHRWTHSK 91

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR-KIH 246
           +EC IC K FSR   L+ H + H   +P+ C   NC K F+   N+  H+ K H
Sbjct: 11  YECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSHQNKFH 64

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 217 TGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           TG +PY CD   C KRF+ K NL  H+  H K R
Sbjct: 6   TGEKPYECDI--CKKRFSRKGNLAAHKMTHGKIR 37

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C +CGK F+RP  L +H   HT  +P+ C    CGK F  + +  RH  +H
Sbjct: 571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLH 619

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAP-------NCGKRFNVKSNLMRHRKIHAK 248
           C ICGK F+R      H  +HTG + Y C           CGK+F     L RH K  + 
Sbjct: 599 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESG 658

Query: 249 WR 250
            R
Sbjct: 659 RR 660

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 194 HECRI--CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +EC    CGKTF R   + +H   H   +PY CD   C K F    +L+RH+K H +
Sbjct: 556 YECLYPQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQE 612

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           + C +C K F+RP  L +H   HT  +P++C    CGK F  + +  RH  +H+
Sbjct: 426 YSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLHS 477

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAP-------NCGKRFNVKSNLMRHRKIHAK 248
           C +CGK F+R      H  +H+G + Y C           CGK+F     L RH K  + 
Sbjct: 456 CSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTESG 515

Query: 249 WR 250
            R
Sbjct: 516 RR 517

>Kwal_56.23925
          Length = 745

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           CGKTF R   + +H   H   +PY CD   C K F    +L+RH+K HA+
Sbjct: 592 CGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTHAE 641

>Scas_712.2
          Length = 327

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 194 HECRI--CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           ++C+   C + F+RP  L  H   HT  +PY CD   CGKRF    +L  H+  H+K +
Sbjct: 13  YKCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVHKWTHSKVK 71

 Score = 35.4 bits (80), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 2/50 (4%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           CGK F RP  L  H   H+  +P  C    C K F     L RH   HAK
Sbjct: 50  CGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFITNQQLKRHLNTHAK 97

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           CGK +SRP  L  H   HT  +P+ C+ P CGK F   S+L  H+  H++
Sbjct: 15  CGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSHSQ 64

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           CGK F R S L  H   H+  +P AC  P C K F     L RH+K H
Sbjct: 45  CGKGFLRASHLKVHKWSHSQVKPLAC--PVCSKGFTTNQQLSRHKKTH 90

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 199 CGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           C K+F+RPS L+ H L +H G +P+ CD   CGK F  KS+L RH   H 
Sbjct: 113 CNKSFTRPSLLTEHQLTVHHGIKPFKCDT--CGKEFAKKSHLNRHMFSHT 160

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C  CGK F++ S L+ H   HT  +P+ C    CGK    +  L RH   H K
Sbjct: 138 KCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSI--CGKGVTTRQQLKRHEITHTK 189

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 25/54 (46%), Gaps = 7/54 (12%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQP-----YACDAPNCGKRFNVKSNLMRHRK 244
           C  C KTF RP  L  H   H  H P     Y CD  +C   F+  S+L +H K
Sbjct: 222 CPHCNKTFQRPYRLKNHIDKH--HNPESTGMYQCDFLSCTDVFSTWSSLQQHIK 273

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           + C IC K F+RP  L +H   HT  +PY C    CGK F    +  RH  +H   R
Sbjct: 469 YACDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLHTGKR 523

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYAC-------DAPNCGKRFNVKSNLMRHRK 244
           C +CGK F+R    + H  +HTG + Y C       ++  CGK+F     L RH K
Sbjct: 499 CSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFK 554

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 195 ECRI--CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           EC    C KTF R   + +H   H   +PY+CD P C K F    +L+RH+K H +
Sbjct: 551 ECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQE 606

>Kwal_27.10925
          Length = 264

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           + C+IC K F+    L+ H  IHTG + + C    CG+RF+   N ++H K H +
Sbjct: 201 YVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHLR 255

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           H C+IC   F+    LS HA IHTG + + C    C + F+   N ++H + H+K ++
Sbjct: 252 HICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKKE 309

>Scas_569.2
          Length = 293

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           C++C K F+    L+ H  IHTG + + C  P C  +F+   N ++H + H K R+
Sbjct: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVRE 285

>Kwal_27.11460
          Length = 531

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 185 RSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRK 244
           +S   +++ + C +C K F+RP  L +H   HT  +P++C    CGK F  + +  RH  
Sbjct: 404 KSLQKNASVYACELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHED 461

Query: 245 IHAKWR 250
           +H   +
Sbjct: 462 LHTGQK 467

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 26/62 (41%), Gaps = 7/62 (11%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAP-------NCGKRFNVKSNLMRHRKIHAK 248
           C ICGK F+R      H  +HTG + Y C           CGK+F     L RH K    
Sbjct: 443 CAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFKTEGG 502

Query: 249 WR 250
            R
Sbjct: 503 KR 504

>Scas_721.92
          Length = 1152

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIH 246
           C +C + F+R   L  HA  HT  +PY C    C K+F  +  L+RH +K+H
Sbjct: 80  CDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRHAQKVH 129

>Scas_718.44
          Length = 266

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           H C+IC   F+    LS H  IHTG + ++C    C ++F+   N ++H + H K
Sbjct: 210 HVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLK 264

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 193 HHECRI--CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           + EC    CGK F R   + +H   H   +PY CD   C K F    +L RH+K H K
Sbjct: 522 NFECLFPNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C K F+R     TH   H   +PY CD P C K F    +L+RH+K H
Sbjct: 700 CQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSH 747

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           CGK F+R   + +H   H   +P+ CD   C K F    +L+RH+K HA+
Sbjct: 681 CGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTHAE 730

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           C+IC + F+    L+ H  IHTG + + C    C +RF+   N ++H + H K
Sbjct: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 196 CRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           C  C + F R   L  H   +H G +PY CD   CGK+F+   NL +H K H+
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGCDI--CGKKFSRSDNLNQHIKTHS 512

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 184 PRSAATSSTHHECRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           P     +S    C  C + F R   L  H   +H G +PY C+   CGK+F+   NL +H
Sbjct: 344 PSPILDASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEI--CGKKFSRSDNLNQH 401

Query: 243 RKIHA 247
            K H 
Sbjct: 402 IKTHG 406

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 14/25 (56%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTG 218
           + C ICGK FSR   L+ H   H G
Sbjct: 383 YGCEICGKKFSRSDNLNQHIKTHGG 407

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIHA 247
           C+ C + F+R   L+ H   HT  +PY C    C +RF  +  L+RH  K+H 
Sbjct: 32  CQTCTRAFARQEHLTRHERSHTKEKPYCCGI--CDRRFTRRDLLLRHAHKVHG 82

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 178 MTPVHTPRSAATSSTHHE---CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFN 234
           M P H   +  T S       C++C + F+R   L+ H   HT  +PY C    C +RF 
Sbjct: 106 MLPDHLRLNGVTPSGKPRLFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGI--CERRFT 163

Query: 235 VKSNLMRH-RKIHA 247
            +  L+RH +K+H 
Sbjct: 164 RRDLLIRHCQKLHG 177

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 39/78 (50%), Gaps = 10/78 (12%)

Query: 183 TPRSAATSSTHHECR--ICGKTFSRPSGLSTHALIHTGHQPYAC-------DAPNCGKRF 233
           +P S+++ +    C    C KTFSR   LS H L H   + Y C       +AP C K F
Sbjct: 20  SPNSSSSPAERFRCPHPECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAP-CNKTF 78

Query: 234 NVKSNLMRHRKIHAKWRD 251
             K  L+RH K H+K ++
Sbjct: 79  VRKDLLIRHEKRHSKVKN 96

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKI 245
           H+C  C K F R S L  H L H+  +PY+C  P C  R   K NL +H K+
Sbjct: 185 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLKL 234

>Scas_378.1
          Length = 208

 Score = 40.8 bits (94), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKI 245
           ++C +C K+F R S L  H L H+  + Y+C  P C  +   K NL++H K+
Sbjct: 84  YQCHMCVKSFRRHSWLKRHLLAHSSQRHYSC--PKCVSKHKRKDNLLQHLKL 133

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           +C  C + F R      H   HTG +P+ C  P CGK F+    L RH + H
Sbjct: 18  KCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 196 CRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           CR C + FS    L+ H   +H+G +P++C  P CGKRF  + ++++H
Sbjct: 830 CRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C IC + F R      H   HTG +P+ C  P+C K F+    L RH + H
Sbjct: 22  CEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTH 72

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C K F R   + +H   H   +PY+CD P C K F    +L+RH+  H
Sbjct: 610 CNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISH 657

>Scas_687.33
          Length = 288

 Score = 40.8 bits (94), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C IC + F R      H   HTG +P+ C   +CGK F+    L RH +IH
Sbjct: 19  CPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIH 69

>Scas_712.42*
          Length = 290

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C  C + F R      H   HTG +P+ C  P CGK F+    L RH + H
Sbjct: 20  CETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 196 CRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           C IC K+F R   L  H   +H+  +P+AC    C K+F+   NL +H K H K  D
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKKHGD 703

>Scas_631.7
          Length = 433

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 199 CGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           C K F+RPS LS H L  H G +P+ C+   C K+F+ K++L RH   H+
Sbjct: 64  CTKAFTRPSLLSEHQLTFHQGIKPFKCEQ--CDKQFSRKTHLERHLISHS 111

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C  C K FSR + L  H + H+  +P+ C   +CGK    +  L RH   H K
Sbjct: 89  KCEQCDKQFSRKTHLERHLISHSDSKPFCC--LHCGKGVTTRQQLKRHEVTHTK 140

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 3/41 (7%)

Query: 196 CRICGKTFSRPSGLSTHALIHTG---HQPYACDAPNCGKRF 233
           C+ CGK F RP  L  H   H       PY C   NC + F
Sbjct: 173 CKHCGKKFQRPYRLQNHIAKHHNPDVKTPYQCTFANCHRSF 213

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 199 CGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           C K F+RPS L+ H L +H G + + CD   C K F  KS+L RH   H+
Sbjct: 56  CDKAFTRPSILTEHQLSVHQGLRAFQCDK--CAKSFVKKSHLERHLYTHS 103

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C  C K+F + S L  H   H+  +P+ C    CGK    +  L RH   H K
Sbjct: 81  QCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRHEVTHTK 132

 Score = 32.0 bits (71), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 3/52 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTG---HQPYACDAPNCGKRFNVKSNLMRHRK 244
           C  C K+F RP  L  H   H       PY C    C K F + S L  H K
Sbjct: 165 CPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIK 216

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 179 TPVHTPRSAATSSTH---HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNV 235
            PV +    A SS H   H+C+ C K+F R S L  H L H+  + + C  P C  R   
Sbjct: 328 NPVASNLVPAPSSDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKR 385

Query: 236 KSNLMRHRKI 245
           K NL++H K+
Sbjct: 386 KDNLLQHMKL 395

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C  C + F R      H   HTG +P+ C  P CGK F+    L RH + H
Sbjct: 19  CDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 24/53 (45%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           C IC + F R      H   HTG +P+ C    C K F+    L RH + H K
Sbjct: 19  CEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTK 71

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIHA 247
           C +C + F+R   L  H   HT  +PY C    C + F  +  L+RH +KIH+
Sbjct: 106 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRHAQKIHS 156

>Kwal_23.5400
          Length = 429

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 199 CGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           C K FSRPS L+ H  ++H G +P+ C    C ++F+ K++L RH   H++
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCTV--CARQFSRKTHLERHMFSHSE 105

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C +C + FSR + L  H   H+  +P+ C    CGK    K  L RH   H +
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRHEITHTR 133

 Score = 35.4 bits (80), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 3/52 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTG---HQPYACDAPNCGKRFNVKSNLMRHRK 244
           C ICGK F RP  L  H   H      Q Y C   +C + F   S L +H K
Sbjct: 166 CEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWSALQQHMK 217

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 195 ECRICGKTFSRPSGLSTH-ALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           +C +C + F R   L  H + +H G +PY+CD   C K F+   NL +H++ H
Sbjct: 219 KCDMCERRFKRQEHLKRHVSSLHMGERPYSCDI--CLKSFSRSDNLNQHKRTH 269

>Kwal_47.17241
          Length = 403

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 3/65 (4%)

Query: 184 PRSAATSSTHHECRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           P     +S    C  C + F R   L  H   +H G +P+ C    CGK+F+   NL +H
Sbjct: 336 PSPILDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQH 393

Query: 243 RKIHA 247
            K H 
Sbjct: 394 IKTHT 398

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           ++C  CG+ F++ S L  H   H+  +P++C    CGK    +  L RH   H K
Sbjct: 150 YQCEQCGRGFTKKSHLERHLFSHSETKPFSCTV--CGKGVTTRQQLRRHEITHTK 202

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 178 MTPVHTPRSAATSSTHH-ECRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNV 235
           ++ V +  S+    TH+ +   C K F+RPS L+ H    H G + Y C+   CG+ F  
Sbjct: 104 LSSVESTASSTRRKTHYCDYEGCYKAFTRPSLLTEHQQTAHQGIRAYQCE--QCGRGFTK 161

Query: 236 KSNLMRHRKIHAKWR 250
           KS+L RH   H++ +
Sbjct: 162 KSHLERHLFSHSETK 176

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%)

Query: 196 CRICGKTFSRPSGLSTHALIHTG---HQPYACDAPNCGKRFNVKSNLMRH 242
           C  C K F RP  L TH   H G      Y C    C + F   S L +H
Sbjct: 235 CTHCDKRFQRPYRLKTHIAKHHGPASQFRYQCTNAGCVQCFETWSALQQH 284

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 196 CRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           C+ C + FS    L+ H   +H+G +P++C  P CGKRF  + ++++H
Sbjct: 904 CQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 39.3 bits (90), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIHA 247
           C  C + F+R   L  H   HT  +PY C    C +RF+ +  L+RH  K+H 
Sbjct: 51  CHTCTRAFARQEHLIRHKRSHTNEKPYICGI--CDRRFSRRDLLLRHAHKLHG 101

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 196 CRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           C  C + F R   L  H   +H G +PY C    C K+F+   NL +H K H+
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYECHI--CNKKFSRSDNLNQHIKTHS 316

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 194 HECRICGKTFSRPSGLSTHALIHT 217
           +EC IC K FSR   L+ H   H+
Sbjct: 293 YECHICNKKFSRSDNLNQHIKTHS 316

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 38.9 bits (89), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 196 CRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           C+ C + FS    L+ H   +H+G +P++C  P CGKRF  + ++++H
Sbjct: 711 CKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756

>Kwal_26.8021
          Length = 507

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRK 244
           + C +C K+F R S    H L H+  +PY+C  P C  R   + NL +H K
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMK 437

>Kwal_47.16621
          Length = 1178

 Score = 38.5 bits (88), Expect = 0.005,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIHAKWRD 251
           C IC + F+R   L  H   HT  +P+ C    CG+ F  +  ++RH +K+H+   D
Sbjct: 80  CSICTRGFARQEHLKRHQRAHTNEKPFLC--AFCGRCFARRDLVLRHQQKLHSTLAD 134

>Scas_717.17
          Length = 525

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKI-HAK 248
           C IC K F R S L  H L H+  + Y C  P C  R   + NL++H K+ H+K
Sbjct: 390 CHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKLKHSK 441

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 38.1 bits (87), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 196 CRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           C+ C + FS    L+ H   +H+G +P++C  P CGK+F  + ++++H
Sbjct: 757 CQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 195 ECRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C  C KTF R   L  H   +H+  +P+ C    C K+F+   NL +H K H K  D
Sbjct: 622 KCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHKKHGD 677

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 38.1 bits (87), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 3/58 (5%)

Query: 190 SSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIH 246
           S   + C  C K FSR    + H   HTG +P++C    C   F  +  L RH R +H
Sbjct: 4   SQRKYICSFCAKPFSRSEHKARHERSHTGSKPFSCSI--CSHSFVRRDLLQRHIRTVH 59

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 38.1 bits (87), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIHAKWRD 251
           C +C + F+R   L  H   HT  +P+ C    CG+ F  +  ++RH +K+HA   D
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLC--AFCGRCFARRDLVLRHQQKLHASLMD 136

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 37.7 bits (86), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 3/57 (5%)

Query: 191 STHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIH 246
           +  H C  C K FSR    + H   H G +P+ C    C   F  +  L RH R +H
Sbjct: 9   TKRHFCSFCNKAFSRSEHKTRHERSHAGVKPFECQV--CSHSFVRRDLLQRHIRTVH 63

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 37.7 bits (86), Expect = 0.007,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIHAKWRD 251
           C IC + F+R   L  H   HT  +P+ C    CG+ F  +  ++RH +K+HA   D
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLC--AFCGRCFARRDLVLRHQQKLHASLMD 139

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 37.0 bits (84), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIHAKWRD 251
           C IC + F+R   L  H   HT  +P+ C    CG+ F  +  ++RH +K+HA   D
Sbjct: 50  CPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRHQQKLHASLMD 104

>Scas_602.9
          Length = 547

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 196 CRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           C  C + F R   L  H   +H G +PYAC    C K F+   NL +H K H 
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYACHI--CNKNFSRSDNLTQHIKTHG 547

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 37.7 bits (86), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIHAKWR 250
           C IC + F R   L  H   HT  +P+ C    CGK F  K  ++RH +K+H  ++
Sbjct: 29  CPICSRGFVRQEHLKRHQNSHTHEKPFLCLI--CGKCFARKDLVLRHLQKLHRDYK 82

>Kwal_56.23453
          Length = 828

 Score = 37.4 bits (85), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 196 CRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           C+ C + FS    L+ H   +H+G +P++C  P CGK+F  + ++++H
Sbjct: 737 CQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782

>Kwal_26.8351
          Length = 698

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 184 PRSAATSSTHHE------CRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVK 236
           PR++ +SS   E      C+ C K F R   L  H   +H+  +P+ C    C K+F+  
Sbjct: 625 PRNSKSSSPVEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRS 682

Query: 237 SNLMRHRKIHAKWRD 251
            NL +H K H K  D
Sbjct: 683 DNLSQHLKTHKKHGD 697

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 35.8 bits (81), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           + C  C   FSR S L  H  +H+   P+ C   NCGK F  K  L RH
Sbjct: 95  YSCAKCQLKFSRSSDLRRHEKVHSLVLPHIC--SNCGKGFARKDALKRH 141

 Score = 27.3 bits (59), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 201 KTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           +T ++ +G + H+    G Q Y+C    C  +F+  S+L RH K+H+
Sbjct: 76  ETQTKRTGGNNHS--KEGAQLYSC--AKCQLKFSRSSDLRRHEKVHS 118

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 195 ECRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C+ C K F R   L  H   +H+  +P+AC    C K+F+   NL +H K H K  D
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKKHGD 629

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 196 CRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           C +C K F R   L  H   +H+  +P++C    C K+F+   NL +H K H K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKK 588

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 36.2 bits (82), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 2/52 (3%)

Query: 191 STHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           + +H C  C   F+R S L  H   H    PY C    CGK F  K  L RH
Sbjct: 139 TVYHYCSQCSLKFNRSSDLRRHERAHLLVLPYIC--TQCGKGFARKDALKRH 188

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRK-IHAK 248
           C  +FSR   L+ H   HTG +P+ CD   C K F+   NL +H+  +HAK
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDI--CLKYFSRIDNLKQHKDTVHAK 81

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKI 245
           H C +C K F R S L  H L H+  + + C  P C  R   + NL++H K+
Sbjct: 534 HRCHLCPKLFKRKSWLKRHLLSHSQQRHFLC--PWCNSRHKRRDNLLQHMKL 583

>Scas_707.31
          Length = 289

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 190 SSTHHECRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
            S  + C +C K F R   L  H   IH   +P+ C    C KRF+   NL +H +IH +
Sbjct: 219 DSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSV--CHKRFSRNDNLNQHVRIHEQ 276

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 35.8 bits (81), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 24/59 (40%), Gaps = 2/59 (3%)

Query: 184 PRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
            R  +T     +C  C   FSR S L  H   H    P  C  P CGK F  K  L RH
Sbjct: 88  DRRNSTGEKRFKCAKCSLEFSRSSDLRRHEKTHFAILPNIC--PQCGKGFARKDALKRH 144

>Scas_649.28
          Length = 730

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 3/70 (4%)

Query: 183 TPRSAATSSTHHECRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMR 241
           TP S    +   +C  C K F R   L  H   +H+  +P+AC    C K+F+   NL +
Sbjct: 662 TPGSLDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQ 719

Query: 242 HRKIHAKWRD 251
           H K H K  D
Sbjct: 720 HLKTHKKHGD 729

>Scas_627.6
          Length = 1207

 Score = 36.6 bits (83), Expect = 0.020,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACD--APN----CGKRFNVKSNLMRHRKIHAKWRD 251
           C K+F+R   LS H L H   + + C    PN    C K F  K  L+RH+K H K ++
Sbjct: 49  CNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRHQKRHTKSKN 107

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 36.6 bits (83), Expect = 0.020,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 184 PRSAATSSTH----HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNL 239
           P+ + T  T     H C IC + F R   L  H   HT  +P+ C    CG+ F  +  +
Sbjct: 19  PKKSRTIKTDKPRPHLCPICTRGFVRLEHLKRHQRAHTNEKPFLC--VFCGRCFARRDLV 76

Query: 240 MRHR-KIH 246
           +RH+ K+H
Sbjct: 77  LRHQYKLH 84

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 36.2 bits (82), Expect = 0.022,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR-KIHA 247
           C IC + F R   L  H   HT  +P+ C    CG+ F  +  ++RH+ K+H+
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLC--VFCGRCFARRDLVLRHQHKLHS 113

>Kwal_26.9300
          Length = 304

 Score = 35.8 bits (81), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 12/79 (15%)

Query: 178 MTPVHTPRSAATSST---HHECRICGKTFSRPSGLSTHALIHTG--HQPYACDAPNCGKR 232
            TP+  P S+  +S      EC IC   ++    LSTH   H    ++P+ C  P CG+ 
Sbjct: 127 FTPLQIPVSSKPASKPRRKKECPICHNFYA---NLSTHRSSHLQPENKPHKC--PVCGRG 181

Query: 233 FNVKSNLMRHRKIHAKWRD 251
           F   ++L+RHRK H  W+D
Sbjct: 182 FTRHNDLLRHRKRH--WKD 198

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 181 VHTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGK 231
           V  P+SA T S   EC+ C + F++ + L  H   H G +PY C+   CGK
Sbjct: 602 VEKPKSA-TVSKQFECQYCHRCFAQVTHLDVHIRSHLGKKPYQCEY--CGK 649

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 9/59 (15%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQ--PYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C +CG  FS    LSTH   H   +  P+ C+   C + F   ++L+RH+K+H  W+D
Sbjct: 385 QCPLCGLFFSN---LSTHKSTHLSPETRPFKCEV--CSRGFARSNDLIRHKKLH--WKD 436

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 35.8 bits (81), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRK-IHA 247
           C  +F+R   L+ H   HTG +P+ C  P C K F+   NL +HR+ +HA
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQC--PACLKFFSRVDNLKQHRESVHA 96

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 35.8 bits (81), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 196 CRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           C  C + F R   L  H   +H   +PY C    CGK+F+   NL +H K H 
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTHT 470

>Scas_681.19
          Length = 864

 Score = 35.8 bits (81), Expect = 0.027,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 196 CRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           C  C + F+    L+ H   +H+G +P++C  P CGK+F  + ++++H
Sbjct: 767 CLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 35.4 bits (80), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 199 CGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           C K F+RPS L+ H   +H G +P+ C+   C   F  K +L RH   H   R
Sbjct: 43  CDKAFTRPSLLTEHQNTVHLGRKPWKCN--QCESSFTKKIHLERHLYTHTDER 93

 Score = 34.3 bits (77), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +C  C  +F++   L  H   HT  +P+ C    CGK    +  L RH   H K
Sbjct: 68  KCNQCESSFTKKIHLERHLYTHTDERPFYCSF--CGKGLITRQQLKRHEVTHTK 119

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 22/55 (40%), Gaps = 7/55 (12%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQP-----YACDAPNCGKRFNVKSNLMRHRK 244
           +C  C K+F RP  L  H   H  H P     Y C    C K F   S L  H K
Sbjct: 151 KCHECNKSFQRPYRLKNHIAKH--HNPDVVNAYQCTFSVCSKSFKTWSALRLHVK 203

>Scas_683.25
          Length = 879

 Score = 35.4 bits (80), Expect = 0.042,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNL-MRHRK-IHAK 248
           C  C K FSR      H   HTG +PY C    C   F V+S+L +RH K +H K
Sbjct: 17  CSFCAKGFSRAEHKIRHERSHTGLKPYKCKV--CTHCF-VRSDLALRHIKTVHKK 68

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 196 CRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           C+ C + FS    L+ H   +H+G +P++C  P CGK+F  + ++++H
Sbjct: 734 CQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779

>Scas_721.56
          Length = 199

 Score = 34.7 bits (78), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 25/60 (41%), Gaps = 2/60 (3%)

Query: 183 TPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           TPRS   S T  +C  C   F R S L  H   H    P  C    CGK F  K  L R+
Sbjct: 104 TPRSDEGSRTGFQCNKCELYFIRSSDLRRHEKTHLSILPNIC--SQCGKGFARKDALKRY 161

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 195 ECRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C+ C K F R   L  H   +H+  +P+ C    C K+F+   NL +H K H K  D
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPC--TYCDKKFSRSDNLSQHLKTHRKHGD 560

>Scas_720.33
          Length = 316

 Score = 34.3 bits (77), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRK-IHAK 248
           C  TF+R   L+ H   HTG +P+ C    C + F+   NL +HR  +H K
Sbjct: 23  CHMTFTREEHLARHIRKHTGEKPFQCYI--CFRFFSRMDNLKQHRDTVHGK 71

>Scas_703.23
          Length = 1341

 Score = 34.3 bits (77), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR-KIHA 247
           C  C + F R   L  H   HT  +P+ C    CG+ F  +  ++RH+ K+HA
Sbjct: 74  CPTCTRGFVRQEHLKRHQRSHTNEKPFLC--VFCGRCFARRDLVLRHQHKLHA 124

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKI-HAKW 249
           ++C +C K F R S L  H L H+  + + C  P C      K NL++H K+ H ++
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--PWCSSTHKRKDNLLQHLKLKHTQY 360

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 33.9 bits (76), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIHA 247
           C  C + F R   L  H   HT  +PY C    CG+ F  +  ++RH +K+HA
Sbjct: 153 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRHQQKLHA 203

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 195 ECRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C  C K F R   L  H   +H+  +P+ C    C K+F+   NL +H K H +  D
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTHKRHGD 540

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 33.9 bits (76), Expect = 0.14,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 6/54 (11%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYAC------DAPNCGKRFNVKSNLMRHRKIH 246
           C K+FSR   LS H L H   + + C          CGK F  +  L RH K H
Sbjct: 52  CDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNRHEKRH 105

 Score = 29.3 bits (64), Expect = 3.9,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 4/64 (6%)

Query: 183 TPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           TP S +  S+  E  +  K     S   +  +   G   Y C  P C K F+ + +L RH
Sbjct: 10  TPESVSLPSSGGEVHVVRKR----SKTVSMVVGEDGQYRYKCPHPTCDKSFSRQEHLSRH 65

Query: 243 RKIH 246
           +  H
Sbjct: 66  KLNH 69

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 9/59 (15%)

Query: 195 ECRICGKTFSRPSGLSTHALIHT--GHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C IC   F+    L+TH  IH     +P+ C    C + F  ++++MRH K+H  W+D
Sbjct: 265 QCPICHGFFA---NLTTHKAIHLEPDIKPFVCSV--CQRGFVRQNDVMRHEKMH--WKD 316

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 3/59 (5%)

Query: 190 SSTHHECRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           +S    C  C + F R   L  H   +H   +P+ C    C K F+   NL +H K HA
Sbjct: 385 ASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI--CNKNFSRSDNLNQHVKTHA 441

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 32.7 bits (73), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR 243
           C  +F+R   L+ H   HTG +P+ C+   C K F+   NL +H+
Sbjct: 27  CNMSFNRTEHLARHIRKHTGEKPFQCNI--CLKFFSRIDNLRQHQ 69

>Kwal_47.16577
          Length = 881

 Score = 33.1 bits (74), Expect = 0.25,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFN 234
           C K+FSR   L  H   H+  + Y C+ P CG+ F+
Sbjct: 20  CSKSFSRSDHLGRHKANHSSEK-YKCEWPACGREFS 54

 Score = 28.5 bits (62), Expect = 6.3,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 218 GHQPYACDAPNCGKRFNVKSNLMRHRKIHA 247
           G  P+ C  P C K F+   +L RH+  H+
Sbjct: 9   GSGPFFCPFPGCSKSFSRSDHLGRHKANHS 38

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 32.7 bits (73), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 188 ATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIH 246
             S   + C  C + FSR    + H   HTG +P++C    C   F  +  L RH R +H
Sbjct: 2   VASQRKYICSFCAQAFSRSEHKTRHERSHTGVKPFSCKV--CNHSFVRRDLLQRHIRTVH 59

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 9/59 (15%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTGHQ--PYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C IC K F+    LSTH   H   Q  P+ C    C   F   ++L+RHRK H  W+D
Sbjct: 325 QCPICHKYFA---NLSTHKSTHLTSQDRPHKCII--CQSGFARNNDLIRHRKRH--WKD 376

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 32.7 bits (73), Expect = 0.27,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 3/60 (5%)

Query: 188 ATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH-RKIH 246
           A     + C  C K FSR      H   H G +P+ C    C   F  +  L RH R +H
Sbjct: 2   AAGQKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQCQV--CKHSFVRRDLLQRHIRTVH 59

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 31.6 bits (70), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDA-PNCGKRFNVKSNLMRH 242
           C ICG ++ + + L  H      H+P   +   NCGK+F  K  L RH
Sbjct: 122 CNICGISYDKLTDLRKHE--RASHEPKQENVCMNCGKKFARKDALKRH 167

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 32.0 bits (71), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           C     +   +++H  +H   +P+AC    C KRF    +L +H KIH
Sbjct: 196 CTSKTEKRDHMTSHLRVHVPLKPFACST--CSKRFKRPQDLKKHLKIH 241

>Scas_670.2
          Length = 435

 Score = 31.6 bits (70), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 9/68 (13%)

Query: 186 SAATSSTHHECRICGKTFSRPSGLSTHALIHT--GHQPYACDAPNCGKRFNVKSNLMRHR 243
           SA T     +C IC   ++    L+TH   H     +P+ C  P C + F   ++L+RH+
Sbjct: 244 SAKTKRRKKQCPICSGYYAN---LTTHKATHLVPEDRPHKC--PICQRGFGRNNDLIRHQ 298

Query: 244 KIHAKWRD 251
           K H  W+D
Sbjct: 299 KRH--WKD 304

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 9/59 (15%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTG--HQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           EC IC   ++    LSTH   H     +P+ C  P C + F   ++L+RH+K H  W+D
Sbjct: 278 ECPICHNFYA---NLSTHKSTHLTPEDRPHKC--PICQRGFARNNDLIRHKKRH--WKD 329

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRK 244
           C ++F+R   L+ H    TG +P  C+   C + F+   NL +HR+
Sbjct: 28  CDRSFTRAEHLARHIRKQTGEKPSQCEV--CNRFFSRIDNLKQHRE 71

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 6/56 (10%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYAC------DAPNCGKRFNVKSNLMRHRKIHAK 248
           C K+F+R   LS H L H   + + C      D   C + F  +  L+RH K H++
Sbjct: 23  CSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRHEKRHSR 78

>KLLA0E13519g complement(1190615..1191307) some similarities with
           sgd|S0006226 Saccharomyces cerevisiae YPR022c,
           hypothetical start
          Length = 230

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 6/54 (11%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYAC------DAPNCGKRFNVKSNLMRHRKIH 246
           C KTFSR   L  H L H   Q + C      D   C + F  K  L+RH++ H
Sbjct: 25  CEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLVRHQRRH 78

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 209 LSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           +++H  +H   +P+AC    C K+F    +L +H K+H
Sbjct: 164 ITSHLRVHVQLKPFACST--CNKKFKRPQDLKKHLKVH 199

>AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C
           (STP4) - SH] complement(1496510..1497469) [960 bp, 319
           aa]
          Length = 319

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 9/59 (15%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTG--HQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           EC +C   ++    LSTH   H     +P+ CD   C + F   ++L RH+K H  W+D
Sbjct: 128 ECPVCHNFYAN---LSTHKSTHLDPEARPHKCDI--CSRGFARSNDLQRHKKRH--WKD 179

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 209 LSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           +++H  +H   +P+ C    CGK+F    +L +H ++H
Sbjct: 105 ITSHLRVHVPLKPFGCST--CGKKFKRPQDLKKHLRVH 140

>Kwal_47.18678
          Length = 625

 Score = 29.6 bits (65), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 200 GKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWR 250
           G  F++P   +   +  T  + +ACD   C +RF  +S+   H   H  W+
Sbjct: 521 GSDFAKPDTETEPTVPDTEIKSFACDP--CNQRFEDESSFKEHMDYHYAWK 569

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 9/59 (15%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTG--HQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           EC +C   ++    LSTH   H     +P+ C    C + F   ++L+RH+K H  W+D
Sbjct: 162 ECPVCHNFYA---NLSTHKSTHLTPEDRPHKCSV--CSRGFARSNDLLRHKKRH--WKD 213

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 203 FSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR 243
           F+R    + H   HTG +P+ CD   C K F+   NL +H+
Sbjct: 3   FTRAEHHARHIRKHTGEKPFQCDI--CMKFFSRIDNLKQHK 41

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 28.5 bits (62), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 199 CGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRH 242
           C   F+R   L+ H   HTG QP+ C    C + F+   NL +H
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQCHL--CLRFFSRLDNLKQH 69

>Kwal_55.20634
          Length = 419

 Score = 28.5 bits (62), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 209 LSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248
           +++H  +H   +P+AC    C K F    +L +H K+H +
Sbjct: 109 ITSHLRVHVPLKPFACST--CTKTFKRPQDLKKHLKVHLE 146

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 28.5 bits (62), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 209 LSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIH 246
           +++H  +H   +P+ C    C K+F    +L +H KIH
Sbjct: 199 ITSHLRVHVPLKPFGCST--CSKKFKRPQDLKKHLKIH 234

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 28.1 bits (61), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 9/59 (15%)

Query: 195 ECRICGKTFSRPSGLSTHALIHTG--HQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251
           +C IC   ++    L+TH   H     +P+ C  P C + F   ++L+RH+K H  W+D
Sbjct: 143 QCPICRNFYAN---LTTHKATHLTPEDRPHKC--PICHRGFARNNDLLRHKKRH--WKD 194

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.134    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,862,944
Number of extensions: 87783
Number of successful extensions: 667
Number of sequences better than 10.0: 183
Number of HSP's gapped: 552
Number of HSP's successfully gapped: 267
Length of query: 251
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 152
Effective length of database: 13,168,927
Effective search space: 2001676904
Effective search space used: 2001676904
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)