Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.219124524212631e-179
Sklu_1537.124524212301e-174
YPR016C (TIF6)24524212301e-174
ADL030C24524212181e-172
Scas_602.524524212161e-172
CAGL0K02497g24524212151e-171
KLLA0D02046g24524212111e-171
AER159C119167750.16
YPL006W (NCR1)117030681.2
YKR031C (SPO14)168343662.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2191
         (242 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2191                                                          491   e-179
Sklu_1537.1 YPR016C, Contig c1537 383-1120 reverse complement         478   e-174
YPR016C (TIF6) [5450] chr16 complement(592327..593064) Translati...   478   e-174
ADL030C [1712] [Homologous to ScYPR016C (TIF6) - SH] (647423..64...   473   e-172
Scas_602.5                                                            473   e-172
CAGL0K02497g 225229..225966 highly similar to sp|Q12522 Saccharo...   472   e-171
KLLA0D02046g complement(175907..176644) highly similar to sp|Q12...   471   e-171
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    33   0.16 
YPL006W (NCR1) [5431] chr16 (544626..548138) Protein involved in...    31   1.2  
YKR031C (SPO14) [3286] chr11 complement(500986..506037) Phosphol...    30   2.0  

>Kwal_14.2191
          Length = 245

 Score =  491 bits (1263), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 242/242 (100%), Positives = 242/242 (100%)

Query: 1   MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG 60
           MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG
Sbjct: 1   MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP 180
           VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP
Sbjct: 121 VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>Sklu_1537.1 YPR016C, Contig c1537 383-1120 reverse complement
          Length = 245

 Score =  478 bits (1230), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 239/242 (98%)

Query: 1   MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG 60
           MA+RTQFENSNEVGVFSKLTNSYCLV +GGSENFYSAFEAELGDAIP+ HTTIAGTRIIG
Sbjct: 1   MATRTQFENSNEVGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQEL HLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP 180
           +DRETEELIADVLGVEVFRQTISGNVLVGSYC+LSNQGGLVHPQT+IQDQEELSSLLQVP
Sbjct: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCSLSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>YPR016C (TIF6) [5450] chr16 complement(592327..593064) Translation
           initiation factor 6 (eIF6), nuclear protein required for
           transit of pre-60S ribosomal subunits from the nucleus
           to the cytoplasm [738 bp, 245 aa]
          Length = 245

 Score =  478 bits (1230), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 240/242 (99%)

Query: 1   MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG 60
           MA+RTQFENSNE+GVFSKLTN+YCLV VGGSENFYSAFEAELGDAIP+VHTTIAGTRIIG
Sbjct: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQEL HLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP 180
           +DRETEELI+DVLGVEVFRQTISGN+LVGSYC+LSNQGGLVHPQTS+QDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>ADL030C [1712] [Homologous to ScYPR016C (TIF6) - SH]
           (647423..648160) [738 bp, 245 aa]
          Length = 245

 Score =  473 bits (1218), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 239/242 (98%)

Query: 1   MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG 60
           MA+RTQFENSNEVGVFSKLTN+YCLVT+GGSENFYSAFEAELGDAIP+VHTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQEL HLRNSLPDSVKIQR+EERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120

Query: 121 VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP 180
           +D ETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQT+IQDQEELSSLLQVP
Sbjct: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGT+NRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDA P++ISGNLRDTL
Sbjct: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>Scas_602.5
          Length = 245

 Score =  473 bits (1216), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 238/242 (98%)

Query: 1   MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG 60
           MA+RTQFENSNE+GVFSKLTN+YCLV +GGSENFYSAFEAELGDAIP+ HTTIAGTRIIG
Sbjct: 1   MATRTQFENSNEIGVFSKLTNTYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQEL HLRN LPDSVKIQRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP 180
           +DRETEELI+DVLGVEVFRQTISGN+LVGSYCALSNQGGLVHPQT+IQDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGS+VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL
Sbjct: 181 LVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>CAGL0K02497g 225229..225966 highly similar to sp|Q12522
           Saccharomyces cerevisiae YPR016c Eukaryotic translation
           initiation factor 6, start by similarity
          Length = 245

 Score =  472 bits (1215), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 227/242 (93%), Positives = 239/242 (98%)

Query: 1   MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG 60
           MA+RTQFENSNEVGVFSKLTN+YCLV VGGSENFYSAFEAELGD+IP+ HTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEVGVFSKLTNTYCLVAVGGSENFYSAFEAELGDSIPIAHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQEL HLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP 180
           +DRETEELI+DVLGVEVFRQTISGN+LVGSYCALSNQGGLVHPQT+IQDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGS+VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQP++ISGNLRDTL
Sbjct: 181 LVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPDAISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>KLLA0D02046g complement(175907..176644) highly similar to sp|Q12522
           Saccharomyces cerevisiae YPR016c TIF6 translation
           initiation factor 6 (eIF6) singleton, start by
           similarity
          Length = 245

 Score =  471 bits (1211), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 237/242 (97%)

Query: 1   MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG 60
           MA+RTQFENSNE+GVFSKLTNSYCLV +GGSENFYSAFEAELGDAIP+ HTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQEL HLRN LPD+VK+QRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP 180
           +DRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQT++QDQEELSSLLQVP
Sbjct: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGS VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPE+ISGNLRDTL
Sbjct: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 33.5 bits (75), Expect = 0.16,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 30/67 (44%), Gaps = 7/67 (10%)

Query: 149 GSYCALSNQGGLVHPQTSIQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVNDYLAVTGL 208
           G   A S+ G LV P      +    +L+  PL+   +  GSSV GAG         TG+
Sbjct: 314 GEQRATSDTGTLVMPSMRASHEFIAPTLVHTPLIMDFLQIGSSVGGAG-------GFTGV 366

Query: 209 DTTAPEL 215
           DT  P L
Sbjct: 367 DTADPTL 373

>YPL006W (NCR1) [5431] chr16 (544626..548138) Protein involved in
           sterol homeostasis and trafficking [3513 bp, 1170 aa]
          Length = 1170

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 20  TNSYCLVTVGGSENFYSAFEAELGDAIPMV 49
           TN Y +  +GG    YS F   LGDA PM+
Sbjct: 164 TNGYAMDLIGGGAKNYSQFLKFLGDAKPML 193

>YKR031C (SPO14) [3286] chr11 complement(500986..506037)
           Phospholipase D, catalyzes hydrolysis of
           phosphatidylcholine to yield phosphatidic acid and
           choline [5052 bp, 1683 aa]
          Length = 1683

 Score = 30.0 bits (66), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1   MASRTQFENSNEVGVFSKL-TNSYCLVTVGGSENFYSAFEAEL 42
           M++ T +   N  G F+ + TNS+C   V G + F+S  EA L
Sbjct: 660 MSTSTPWSKPNRFGSFAPVRTNSFCKFLVDGRDYFWSLSEALL 702

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,304,684
Number of extensions: 292301
Number of successful extensions: 765
Number of sequences better than 10.0: 11
Number of HSP's gapped: 751
Number of HSP's successfully gapped: 11
Length of query: 242
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 143
Effective length of database: 13,168,927
Effective search space: 1883156561
Effective search space used: 1883156561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)