Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.21881371367201e-99
Sklu_1537.21311332791e-32
CAGL0K02475g1501402383e-26
YPR017C (DSS4)1431362366e-26
Scas_602.61461392081e-21
YJR123W (RPS5)22549631.1
ADR146C37837631.5
CAGL0I08437g133028631.5
Sklu_2389.744764622.0
Sklu_1603.248842595.2
Kwal_26.877944639586.7
Scas_711.5244525577.5
CAGL0J05126g447101579.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2188
         (136 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2188                                                          281   1e-99
Sklu_1537.2 YPR017C, Contig c1537 1997-2392 reverse complement        112   1e-32
CAGL0K02475g 224263..224715 similar to sp|P32601 Saccharomyces c...    96   3e-26
YPR017C (DSS4) [5451] chr16 complement(593481..593912) Guanine-n...    96   6e-26
Scas_602.6                                                             85   1e-21
YJR123W (RPS5) [3015] chr10 (651816..652493) Ribosomal protein R...    29   1.1  
ADR146C [1887] [Homologous to ScYKL080W (VMA5) - SH] (961970..96...    29   1.5  
CAGL0I08437g 824776..828768 no similarity, hypothetical start          29   1.5  
Sklu_2389.7 YJL060W, Contig c2389 13116-14459 reverse complement       28   2.0  
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         27   5.2  
Kwal_26.8779                                                           27   6.7  
Scas_711.52                                                            27   7.5  
CAGL0J05126g complement(484849..486150) highly similar to sp|P47...    27   9.1  

>Kwal_14.2188
          Length = 137

 Score =  281 bits (720), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%)

Query: 1   MSDKLRCPYTECDSCIVSFDDKRKTKLPLEVYETTKLAIPAGGGEANGEFLVFEDIWDFD 60
           MSDKLRCPYTECDSCIVSFDDKRKTKLPLEVYETTKLAIPAGGGEANGEFLVFEDIWDFD
Sbjct: 1   MSDKLRCPYTECDSCIVSFDDKRKTKLPLEVYETTKLAIPAGGGEANGEFLVFEDIWDFD 60

Query: 61  NIGMSRPIPEELISGQEEPPISFSWEQHEYKLRKLLRYIICAECDKGPLGIVCEVENDEG 120
           NIGMSRPIPEELISGQEEPPISFSWEQHEYKLRKLLRYIICAECDKGPLGIVCEVENDEG
Sbjct: 61  NIGMSRPIPEELISGQEEPPISFSWEQHEYKLRKLLRYIICAECDKGPLGIVCEVENDEG 120

Query: 121 NSMNVNLLSLASVRAN 136
           NSMNVNLLSLASVRAN
Sbjct: 121 NSMNVNLLSLASVRAN 136

>Sklu_1537.2 YPR017C, Contig c1537 1997-2392 reverse complement
          Length = 131

 Score =  112 bits (279), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 87/133 (65%), Gaps = 7/133 (5%)

Query: 4   KLRCPYTECDSCIVSFDDKRKTKLPLEVYETTKLAIPAGGGEANGEFLVFEDIWDFDNIG 63
           KL CP+ +C  CI+  +   +  LPL+VY+   + +P       G+FL+  D+WDFDNIG
Sbjct: 3   KLICPFDQCKCCIIPLEKGTQVTLPLQVYKDLNILLPTKEHCPQGKFLIVNDVWDFDNIG 62

Query: 64  MSRPIPEELISGQEEPPISFSWEQHE-YKLRKLLRYIICAECDKGPLGIVCEVENDEG-N 121
           +SR IP+  + G E   +S S E+   + + ++++Y+ICA+CDKGPLGIVCE  + +G +
Sbjct: 63  VSRNIPD--LKGFE---MSVSCEEETVFTINRVIKYLICADCDKGPLGIVCEARSKDGLD 117

Query: 122 SMNVNLLSLASVR 134
           +  +NLLSL SV+
Sbjct: 118 TKVINLLSLESVK 130

>CAGL0K02475g 224263..224715 similar to sp|P32601 Saccharomyces
           cerevisiae YPR017c exchange factor for SEC4P,
           hypothetical start
          Length = 150

 Score = 96.3 bits (238), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 81/140 (57%), Gaps = 11/140 (7%)

Query: 4   KLRCPYTECDSCIVSF---DDKRKTKL---PLEVYETTKLAIPAGGGEANGE--FLVFED 55
           K RC +TEC S ++S    D K   +L   P  + E  K+     G +A  E  FLV  +
Sbjct: 9   KARCQFTECASSLISVPAVDSKTTDRLIYFPGAIMEKYKIMETREGADAQKEYEFLVVPE 68

Query: 56  IWDFDNIGMSRPIPEELISGQEEPPISFSWEQHEYKLRKLLRYIICAECDKGPLGIVCEV 115
            WDFDNIG+SR + + +   ++     F W+ H ++L    RY+ CAECD+GP+G++CEV
Sbjct: 69  FWDFDNIGVSRDLCQ-VTEDRDNAEFKFEWDGHTWELIHCQRYLACAECDRGPIGLLCEV 127

Query: 116 E--NDEGNSMNVNLLSLASV 133
           +  ND  ++  + LLS+ASV
Sbjct: 128 QDANDHSSTRKICLLSIASV 147

>YPR017C (DSS4) [5451] chr16 complement(593481..593912)
           Guanine-nucleotide exchange factor for Sec4p [432 bp,
           143 aa]
          Length = 143

 Score = 95.5 bits (236), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 79/136 (58%), Gaps = 5/136 (3%)

Query: 4   KLRCPYTECDSCIVSFDDKRKTKLPLEVYETTKLAIPAGGGEAN---GEFLVFEDIWDFD 60
           K  C +  C S +++ +D     LP +V+   KL       +A      FLV  D+WDFD
Sbjct: 3   KATCSFEGCHSAVITINDDNIINLPEQVHSEFKLLENRTMRDATPSESNFLVVPDVWDFD 62

Query: 61  NIGMSRPIPEELISG-QEEPPISFSWEQHEYKLRKLLRYIICAECDKGPLGIVCEVENDE 119
           N+G+SR IP  ++    ++    F +    +K++K L+Y+ICA+CDKGP+GI+C+V++  
Sbjct: 63  NVGVSREIPSSILGDLSDKSDFVFEYGNSSWKIKKCLKYLICADCDKGPIGIICKVQDQT 122

Query: 120 GNSMNV-NLLSLASVR 134
            N   V +LLSL S++
Sbjct: 123 KNEERVLHLLSLRSLQ 138

>Scas_602.6
          Length = 146

 Score = 84.7 bits (208), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 74/139 (53%), Gaps = 9/139 (6%)

Query: 4   KLRCPYTECDSCIVSFDDKRKTKLPLEVYETTKLAIPAGGGE----ANGEFLVFEDIWDF 59
           K  C +  C   I++ +D +  +LP  ++ET  L       +    +   FL+ ED+WDF
Sbjct: 3   KAICAFGNCGCSIINLNDDKIIQLPGTIFETLHLMQRKQSADIKEGSTTSFLITEDVWDF 62

Query: 60  DNIGMSRP----IPEELIS-GQEEPPISFSWEQHEYKLRKLLRYIICAECDKGPLGIVCE 114
           DNIG+S+     I EEL S       +SF  + + + ++K  +Y+IC +CD+GP+G+VC 
Sbjct: 63  DNIGVSKDLMPGISEELNSRANTNTEVSFQHDGNLWYIKKCEKYLICGDCDRGPIGMVCM 122

Query: 115 VENDEGNSMNVNLLSLASV 133
           +   +       LLSL S+
Sbjct: 123 ISQQDDQERRAYLLSLGSL 141

>YJR123W (RPS5) [3015] chr10 (651816..652493) Ribosomal protein
          Rps5p (rp14; YS8; S2; mammalian S5) of the small
          subunit [678 bp, 225 aa]
          Length = 225

 Score = 28.9 bits (63), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 53 FEDIWDFDNIGMSRPIPEELISGQEEPPI--SFSWEQHEYKLRKLLRYI 99
          FE + +F  + ++ PIPEE+   Q E  +   +S+E+ E K   L+ Y+
Sbjct: 14 FEVVEEFTPVVLATPIPEEVQQAQTEIKLFNKWSFEEVEVKDASLVDYV 62

>ADR146C [1887] [Homologous to ScYKL080W (VMA5) - SH]
           (961970..963106) [1137 bp, 378 aa]
          Length = 378

 Score = 28.9 bits (63), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 6/37 (16%)

Query: 75  GQEEPPISFSWEQHEYKLRKLLRYII------CAECD 105
           G  +PP +F W+   YKL + +R +I      CA+ D
Sbjct: 92  GPADPPSAFRWDTRRYKLDRPIRDLIAELARECAQLD 128

>CAGL0I08437g 824776..828768 no similarity, hypothetical start
          Length = 1330

 Score = 28.9 bits (63), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 5/28 (17%)

Query: 68  IPEELISGQEEPPISFS-----WEQHEY 90
           + +E+I   EEP ISFS     WE HEY
Sbjct: 489 LSDEMIKTLEEPSISFSIVSLPWEIHEY 516

>Sklu_2389.7 YJL060W, Contig c2389 13116-14459 reverse complement
          Length = 447

 Score = 28.5 bits (62), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 27/64 (42%), Gaps = 18/64 (28%)

Query: 58  DFDNIGMSR--PIPEELISGQEE----------------PPISFSWEQHEYKLRKLLRYI 99
           DF  + +    P PEEL+S  ++                PP  F  ++HE     LLR+ 
Sbjct: 366 DFSKVKIPEDYPFPEELLSKAKDFRISYWLINELGVVAIPPTEFYIQEHESAAENLLRFA 425

Query: 100 ICAE 103
           +C +
Sbjct: 426 VCKD 429

>Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement
          Length = 488

 Score = 27.3 bits (59), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 5/42 (11%)

Query: 63  GMSRPIPEELISGQEEP-----PISFSWEQHEYKLRKLLRYI 99
            + +P   E+ +  +EP     P  FS+EQH Y + KL +++
Sbjct: 412 AIEQPFVSEVRNENDEPVCSKGPFDFSYEQHFYSMGKLRQFL 453

>Kwal_26.8779
          Length = 446

 Score = 26.9 bits (58), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 40  PAGGGEANGEFLVFEDIWDFDNIGMSRPIPEELISGQEE 78
           PA  G ANG+     D+ D DN+ + + I EE IS  +E
Sbjct: 108 PASQGSANGDTTDGADVMDLDNLNV-QGIKEEEISRDDE 145

>Scas_711.52
          Length = 445

 Score = 26.6 bits (57), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 79  PPISFSWEQHEYKLRKLLRYIICAE 103
           PP  F  ++HE     LLR+ +C E
Sbjct: 403 PPTEFYIKEHEKAAENLLRFAVCKE 427

>CAGL0J05126g complement(484849..486150) highly similar to sp|P47039
           Saccharomyces cerevisiae YJL060w, hypothetical start
          Length = 447

 Score = 26.6 bits (57), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 37/101 (36%), Gaps = 19/101 (18%)

Query: 3   DKLRCPYTECDSCIVSFDDKRKTKLPLEVYETTKLAIPAGGGEANGEFLVFEDIWDFDNI 62
           DKL   YT+ +       D  K K+P +         P    E   +F +    W  + I
Sbjct: 334 DKLGLNYTQPEGTYFILVDFSKVKIPED------YVYPEELLEKAKDFRI--SYWLINEI 385

Query: 63  GMSRPIPEELISGQEEPPISFSWEQHEYKLRKLLRYIICAE 103
           G+              PP  F  ++HE     LLR+ +C E
Sbjct: 386 GIVAI-----------PPTEFYIKEHEKDAETLLRFAVCKE 415

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,012,221
Number of extensions: 217679
Number of successful extensions: 453
Number of sequences better than 10.0: 17
Number of HSP's gapped: 446
Number of HSP's successfully gapped: 18
Length of query: 136
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 45
Effective length of database: 13,445,871
Effective search space: 605064195
Effective search space used: 605064195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (26.2 bits)