Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.217590989743820.0
Scas_707.4492988534390.0
CAGL0K02431g92488133700.0
YPR019W (CDC54)93389133440.0
ADL026W88888133260.0
KLLA0C17512g89287633040.0
CAGL0J06424g9725809341e-111
KLLA0E23276g8265989141e-109
KLLA0F10087g10035919191e-108
ADR041W8135438901e-106
Kwal_47.1896610445919001e-105
Scas_590.67677778801e-105
CAGL0M05423g8125278801e-104
Scas_712.4910195858881e-104
CAGL0F04939g7727808671e-103
YGL201C (MCM6)10175858821e-103
Kwal_56.232827617558631e-103
AGR276W7347558541e-102
AFR546W10055948671e-101
Kwal_27.120028335878551e-101
Scas_721.368555278531e-100
KLLA0D09262g7467018382e-99
Scas_710.218746648411e-98
YBR202W (CDC47)8455648312e-97
Sklu_2098.48465578285e-97
YBL023C (MCM2)8686688218e-96
YLR274W (CDC46)7757308122e-95
CAGL0J04444g8796618132e-94
KLLA0F12584g8776558094e-94
AFR178W8856618095e-94
Sklu_1863.19545878128e-94
Kwal_27.101749455918064e-93
KLLA0E22330g9315847872e-90
Kwal_14.20908606647804e-90
Sklu_2087.48846627807e-90
YEL032W (MCM3)9715937637e-87
Scas_499.29855937551e-85
AFR355C9435887442e-84
CAGL0L01397g9456517126e-80
KLLA0E14278g473121703.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2175
         (897 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2175                                                         1692   0.0  
Scas_707.44                                                          1329   0.0  
CAGL0K02431g complement(219027..221801) highly similar to sp|P30...  1302   0.0  
YPR019W (CDC54) [5453] chr16 (596745..599546) Protein involved i...  1292   0.0  
ADL026W [1716] [Homologous to ScYPR019W (CDC54) - SH] complement...  1285   0.0  
KLLA0C17512g complement(1537707..1540385) similar to sp|P30665 S...  1277   0.0  
CAGL0J06424g complement(611935..614853) highly similar to sp|P53...   364   e-111
KLLA0E23276g complement(2065845..2068325) similar to sp|P38132 S...   356   e-109
KLLA0F10087g complement(935618..938629) similar to sp|P53091 Sac...   358   e-108
ADR041W [1782] [Homologous to ScYBR202W (CDC47) - SH] complement...   347   e-106
Kwal_47.18966                                                         351   e-105
Scas_590.6                                                            343   e-105
CAGL0M05423g 577097..579535 highly similar to sp|P38132 Saccharo...   343   e-104
Scas_712.49                                                           346   e-104
CAGL0F04939g 503890..506208 highly similar to sp|P29496 Saccharo...   338   e-103
YGL201C (MCM6) [1794] chr7 complement(117856..120909) Protein in...   344   e-103
Kwal_56.23282                                                         337   e-103
AGR276W [4587] [Homologous to ScYLR274W (CDC46) - SH] complement...   333   e-102
AFR546W [3738] [Homologous to ScYGL201C (MCM6) - SH] complement(...   338   e-101
Kwal_27.12002                                                         333   e-101
Scas_721.36                                                           333   e-100
KLLA0D09262g 780273..782513 similar to sp|P29496 Saccharomyces c...   327   2e-99
Scas_710.21                                                           328   1e-98
YBR202W (CDC47) [385] chr2 (625729..628266) Member of MCM/P1 fam...   324   2e-97
Sklu_2098.4 YBR202W, Contig c2098 6426-8966 reverse complement        323   5e-97
YBL023C (MCM2) [172] chr2 complement(174885..177491) Member of t...   320   8e-96
YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/...   317   2e-95
CAGL0J04444g 417656..420295 highly similar to sp|P29469 Saccharo...   317   2e-94
KLLA0F12584g complement(1165710..1168343) similar to sp|P29469 S...   316   4e-94
AFR178W [3370] [Homologous to ScYBL023C (MCM2) - SH] complement(...   316   5e-94
Sklu_1863.1 YEL032W, Contig c1863 2885-5749                           317   8e-94
Kwal_27.10174                                                         315   4e-93
KLLA0E22330g 1981275..1984070 similar to sp|P24279 Saccharomyces...   307   2e-90
Kwal_14.2090                                                          305   4e-90
Sklu_2087.4 YBL023C, Contig c2087 7202-9856                           305   7e-90
YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1 f...   298   7e-87
Scas_499.2                                                            295   1e-85
AFR355C [3547] [Homologous to ScYEL032W (MCM3) - SH] (1082128..1...   291   2e-84
CAGL0L01397g 152718..155555 highly similar to sp|P24279 Saccharo...   278   6e-80
KLLA0E14278g complement(1260247..1261668) similar to sp|P43635 S...    32   3.6  

>Kwal_14.2175
          Length = 909

 Score = 1692 bits (4382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 834/897 (92%), Positives = 834/897 (92%)

Query: 1   MSENRSSPVHEXXXXXXXXXXXXXXXXXXXLFYNPSSSSQPDTYESQQRQRTVGSSPFRY 60
           MSENRSSPVHE                   LFYNPSSSSQPDTYESQQRQRTVGSSPFRY
Sbjct: 1   MSENRSSPVHEGASSPMAAPPSSFGGSSPPLFYNPSSSSQPDTYESQQRQRTVGSSPFRY 60

Query: 61  PSSSQDHPHVTSDTFASQSRTQRSSGPGRFTDFXXXXXXXXXXXXXXXXQHAAQRRSDLH 120
           PSSSQDHPHVTSDTFASQSRTQRSSGPGRFTDF                QHAAQRRSDLH
Sbjct: 61  PSSSQDHPHVTSDTFASQSRTQRSSGPGRFTDFSSDGGILSSSLSGRGSQHAAQRRSDLH 120

Query: 121 ASDLSSPRRMVXXXXXXXXXXXXXXXXEATEPLRIIWGTNVSIQECATNFRNFLMSFKYK 180
           ASDLSSPRRMV                EATEPLRIIWGTNVSIQECATNFRNFLMSFKYK
Sbjct: 121 ASDLSSPRRMVDLDSQPPPNSSSDPVSEATEPLRIIWGTNVSIQECATNFRNFLMSFKYK 180

Query: 181 FRKTLDGNEDFLNETDDEELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSY 240
           FRKTLDGNEDFLNETDDEELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSY
Sbjct: 181 FRKTLDGNEDFLNETDDEELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSY 240

Query: 241 PQEIISIMDQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDK 300
           PQEIISIMDQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDK
Sbjct: 241 PQEIISIMDQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDK 300

Query: 301 LISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVACNQQNSMTL 360
           LISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVACNQQNSMTL
Sbjct: 301 LISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVACNQQNSMTL 360

Query: 361 VHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPI 420
           VHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPI
Sbjct: 361 VHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPI 420

Query: 421 RASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDE 480
           RASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDE
Sbjct: 421 RASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDE 480

Query: 481 QIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINI 540
           QIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQL            RYRGDINI
Sbjct: 481 QIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLFGGTNKTFTKGGRYRGDINI 540

Query: 541 LLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLS 600
           LLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLS
Sbjct: 541 LLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLS 600

Query: 601 DGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNP 660
           DGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNP
Sbjct: 601 DGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNP 660

Query: 661 NLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNETDGDVLPV 720
           NLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNETDGDVLPV
Sbjct: 661 NLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNETDGDVLPV 720

Query: 721 ELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRL 780
           ELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRL
Sbjct: 721 ELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRL 780

Query: 781 AEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQED 840
           AEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQED
Sbjct: 781 AEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQED 840

Query: 841 LAREVVSILGARSNLTISYNELLRSINEQSQDKVEAADISEALVRLQQEDKVVVLGE 897
           LAREVVSILGARSNLTISYNELLRSINEQSQDKVEAADISEALVRLQQEDKVVVLGE
Sbjct: 841 LAREVVSILGARSNLTISYNELLRSINEQSQDKVEAADISEALVRLQQEDKVVVLGE 897

>Scas_707.44
          Length = 929

 Score = 1329 bits (3439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/885 (73%), Positives = 745/885 (84%), Gaps = 22/885 (2%)

Query: 31  LFYNPSSSSQPDTYESQQRQR-------TVGSSPFRYPSSSQDHPHVTSDTFASQSRTQR 83
           LFYN SSSSQ D +     Q          GSSP  YPSSSQ+    +SD    Q RT+R
Sbjct: 37  LFYN-SSSSQSDIFGRHGSQAGTARNNAAFGSSPMNYPSSSQNQ---SSDLLNPQRRTRR 92

Query: 84  SSG-----PG--RFTDFXXXXXXXXXXXXXXXXQHAAQ-RRSDLHASDLSSPRRMV---X 132
             G     PG  RF+D                 ++  + RR+D+HASDLSSPRR+V    
Sbjct: 93  PGGSSTNTPGTTRFSDIRSDRNIPSSSSSFGSSRNNIRMRRNDIHASDLSSPRRIVDFDS 152

Query: 133 XXXXXXXXXXXXXXXEATEPLRIIWGTNVSIQECATNFRNFLMSFKYKFRKTLDGNEDFL 192
                          +A EPLRIIWGTNVSIQECAT FRNFLMSFKYKFRKTLD  E F+
Sbjct: 153 HSGVHTSSSSAVPTSDANEPLRIIWGTNVSIQECATKFRNFLMSFKYKFRKTLDEREQFI 212

Query: 193 NETDDEELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIMDQTV 252
           N T DEELYYV++LN+MRE+G+ NLNLDARNLL+FK TE+LYYQL++YPQE+ISIMDQT+
Sbjct: 213 NSTTDEELYYVQQLNEMREVGNCNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTI 272

Query: 253 KDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRST 312
           KDCMVSLVVDN+L+  LD+IE+KFYK+RPYN+ T KGMRELNPNDIDKLIS+KGLVLR+T
Sbjct: 273 KDCMVSLVVDNHLDFNLDDIETKFYKVRPYNVGTVKGMRELNPNDIDKLISLKGLVLRAT 332

Query: 313 PIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVACNQQNSMTLVHNRCSFADKQV 372
           P+IPDMKVAFFKCN+CDHT VVEIDRGVIQEPARC RV C +QNSM+L+HNRCSFADKQV
Sbjct: 333 PVIPDMKVAFFKCNVCDHTMVVEIDRGVIQEPARCERVDCGEQNSMSLIHNRCSFADKQV 392

Query: 373 IKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRASTTQRALKSL 432
           IKLQETPD VPDGQTPH+VSLCVYDELVDSCRAGDRIE+TG FRSIPIRA++ QR LKSL
Sbjct: 393 IKLQETPDLVPDGQTPHAVSLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRILKSL 452

Query: 433 YKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRKLHAIAARD 492
           YKTY+DVVH+KKV++ RLG DTST+EQEL+QN+++H++V+E+ +ITD+ I K+  +A R+
Sbjct: 453 YKTYIDVVHIKKVSDTRLGVDTSTIEQELMQNKLDHNEVEEVKKITDQDIAKIRDVANRE 512

Query: 493 DVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQ 552
           D+Y+VL+RS+APSIFELDD+KKGILLQL            RYRGDINILLCGDPSTSKSQ
Sbjct: 513 DLYDVLSRSIAPSIFELDDVKKGILLQLFGGANKVFKKGGRYRGDINILLCGDPSTSKSQ 572

Query: 553 ILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCCIDEFDK 612
           ILQYVHKIAPRGVYTSGKGSSAVGLTAYITRD+DTKQLVLESGALVLSDGG+CCIDEFDK
Sbjct: 573 ILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGICCIDEFDK 632

Query: 613 MSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTENIDLPP 672
           MSDSTRSVLHEVMEQQTISIAKAGIITTLNAR+SILASANPIGSRYNPNLPVTENIDLPP
Sbjct: 633 MSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPP 692

Query: 673 PLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNETDGDVLPVELLTLYINYAKQ 732
           PLLSRFDLVYLVLDKVDE+TDRELAKHLT+LYL+D P + ++ D+LPVE LT+YINYAK+
Sbjct: 693 PLLSRFDLVYLVLDKVDESTDRELAKHLTSLYLQDKPEHVSNADILPVEFLTMYINYAKE 752

Query: 733 QYAPVIIEQAKTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQT 792
              PVI+E+AK ELVRAYV MRK+GDDSRSDEKRITATTRQLESMIRLAEAHAKMRLS  
Sbjct: 753 HIHPVILEEAKIELVRAYVGMRKLGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSNE 812

Query: 793 VELQDVQEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLAREVVSILGAR 852
           V+L+DVQEAVRL+KSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDL REV+ +L   
Sbjct: 813 VQLEDVQEAVRLMKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLTREVLRVLTNH 872

Query: 853 SNLTISYNELLRSINEQSQDKVEAADISEALVRLQQEDKVVVLGE 897
           ++ ++S+NEL++ INE SQD+VE++DIS+ L RLQQEDKV+VLGE
Sbjct: 873 TSDSMSFNELIKQINEHSQDRVESSDISDVLSRLQQEDKVIVLGE 917

>CAGL0K02431g complement(219027..221801) highly similar to sp|P30665
           Saccharomyces cerevisiae YPR019w Cell division control
           protein, start by similarity
          Length = 924

 Score = 1302 bits (3370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/881 (72%), Positives = 733/881 (83%), Gaps = 21/881 (2%)

Query: 31  LFYNPSSSSQPDTYESQQRQRTVGSSPFRYPSSSQDHPHVTSDTFASQSRTQR------- 83
           LF+N SSSSQP        Q    SSP  +PSSS + P ++SD  +   R+ R       
Sbjct: 39  LFFN-SSSSQPQG----DSQPVAPSSPIHFPSSS-NRP-MSSDVHSQGRRSNRNHLAANR 91

Query: 84  SSGPGRFTDFXXXXXXXXXXXXXXX---XQHAAQRRSDLHASDLSSPRRMV----XXXXX 136
           SS  GRF+D+                   Q    RR+D+HASDLSSPRR+V         
Sbjct: 92  SSALGRFSDYGSDRQVLHSSSSNMGGYPSQRTNLRRNDIHASDLSSPRRIVDFDSRSGIQ 151

Query: 137 XXXXXXXXXXXEATEPLRIIWGTNVSIQECATNFRNFLMSFKYKFRKTLDGNEDFLNETD 196
                      EATEPLRIIWGTNVSIQECA +FRNFLMSFKYK+R+ LDG  D  ++  
Sbjct: 152 QPSSSSSSMPSEATEPLRIIWGTNVSIQECANSFRNFLMSFKYKYRRVLDGKTDITDDEA 211

Query: 197 DEELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIMDQTVKDCM 256
           +EELYYVK+LN+MRE+G+ NLNLDARNLL+FK TE+LYYQL++YPQE+ISIMDQT+KDCM
Sbjct: 212 EEELYYVKQLNEMRELGTSNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCM 271

Query: 257 VSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIP 316
           VSLVVDN LE  LDEIESKFYK+RPYN+ETQKGMRELNPNDIDKLIS+KGLVLR+TP+IP
Sbjct: 272 VSLVVDNQLEHELDEIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIP 331

Query: 317 DMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQ 376
           DMKVAFFKCNICDHT  VEIDRGVIQEPARC RV CN+ NSMTL+HNRCSFADKQVIKLQ
Sbjct: 332 DMKVAFFKCNICDHTMAVEIDRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQ 391

Query: 377 ETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRASTTQRALKSLYKTY 436
           ETPD VPDGQTPHSVSLCVYDELVDSCRAGDRIE+TG FRSIPI+A++ QR LKSLYKTY
Sbjct: 392 ETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTY 451

Query: 437 LDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRKLHAIAARDDVYE 496
           +DVVHVKKV+N R+G D ST+EQELLQN+++++DV+E+ QI+D +I K+  +A R D+Y+
Sbjct: 452 IDVVHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYD 511

Query: 497 VLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQY 556
           +LARS+APSI+ELDD+KKGILLQL            RYRGDINILLCGDPSTSKSQILQY
Sbjct: 512 LLARSIAPSIYELDDVKKGILLQLFGGTNKTFKKGGRYRGDINILLCGDPSTSKSQILQY 571

Query: 557 VHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDS 616
           VHKIAPRGVYTSGKGSSAVGLTAY+TRD+D+KQLVLESGALVLSDGG+CCIDEFDKMS+S
Sbjct: 572 VHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSES 631

Query: 617 TRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLS 676
           TRSVLHEVMEQQTIS+AKAGIITTLNAR+SILASANPIGSRYNPNLPVTENIDLPPPLLS
Sbjct: 632 TRSVLHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLS 691

Query: 677 RFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNETDGDVLPVELLTLYINYAKQQYAP 736
           RFDLVY++LDKVDE+TDR+LAKHLT+LYLED P + T  DVLP++ LT YINY KQ   P
Sbjct: 692 RFDLVYIILDKVDESTDRDLAKHLTSLYLEDKPAHVTTDDVLPIDFLTQYINYVKQNVHP 751

Query: 737 VIIEQAKTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQ 796
           ++ EQAK ELV+AYV MRKMGDDSRSDEKRITATTRQLESMIRL+EAHAKMRLS TV+L+
Sbjct: 752 LVTEQAKNELVKAYVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLE 811

Query: 797 DVQEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLAREVVSILGARSNLT 856
           DV+EAVRL+KSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLARE++ IL      +
Sbjct: 812 DVREAVRLMKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLAREIIRILKEYPADS 871

Query: 857 ISYNELLRSINEQSQDKVEAADISEALVRLQQEDKVVVLGE 897
           +S+NEL++ INEQ+QD+VE + +S  L RLQQEDKV++LGE
Sbjct: 872 MSFNELIKQINEQAQDRVEPSQVSSTLSRLQQEDKVIILGE 912

>YPR019W (CDC54) [5453] chr16 (596745..599546) Protein involved in
           DNA synthesis initiation, member of the MCM family of
           DNA-dependent ATPases required for initiation of DNA
           replication [2802 bp, 933 aa]
          Length = 933

 Score = 1292 bits (3344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/891 (71%), Positives = 731/891 (82%), Gaps = 28/891 (3%)

Query: 31  LFYNPSSSSQPDTYESQQRQR----------TVGSSPFRYPSSSQDHPHVTSDTFASQSR 80
           LFY+ SSSSQ D Y     Q            +GSSP  +PSSSQ      SD F SQ R
Sbjct: 35  LFYS-SSSSQGDIYGRNNSQNLSQGEGNIRAAIGSSPLNFPSSSQRQ---NSDVFQSQGR 90

Query: 81  TQR-------SSGPGRFTDFXXXXX--XXXXXXXXXXXQHAAQRRSDLHASDLSSPRRMV 131
             R       S      +D                        RR+D+H SDLSSPRR+V
Sbjct: 91  QGRIRSSASASGRSRYHSDLRSDRALPTSSSSLGRNGQNRVHMRRNDIHTSDLSSPRRIV 150

Query: 132 -----XXXXXXXXXXXXXXXXEATEPLRIIWGTNVSIQECATNFRNFLMSFKYKFRKTLD 186
                                EA+EPLRIIWGTNVSIQEC TNFRNFLMSFKYKFRK LD
Sbjct: 151 DFDTRSGVNTLDTSSSSAPPSEASEPLRIIWGTNVSIQECTTNFRNFLMSFKYKFRKILD 210

Query: 187 GNEDFLNETDDEELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIIS 246
             E+F+N T DEELYY+K+LN+MRE+G+ NLNLDARNLL++K TE LY+QL++YPQE+IS
Sbjct: 211 EREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLNYPQEVIS 270

Query: 247 IMDQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKG 306
           IMDQT+KDCMVSL+VDNNL+  LDEIE+KFYK+RPYN+ + KGMRELNPNDIDKLI++KG
Sbjct: 271 IMDQTIKDCMVSLIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKG 330

Query: 307 LVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVACNQQNSMTLVHNRCS 366
           LVLRSTP+IPDMKVAFFKCN+CDHT  VEIDRGVIQEPARC R+ CN+ NSM+L+HNRCS
Sbjct: 331 LVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCS 390

Query: 367 FADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRASTTQ 426
           FADKQVIKLQETPD VPDGQTPHS+SLCVYDELVDSCRAGDRIE+TG FRSIPIRA++ Q
Sbjct: 391 FADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQ 450

Query: 427 RALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRKLH 486
           R LKSLYKTY+DVVHVKKV++ RL  DTST+EQEL+QN+++H++V+E+ QITD+ + K+ 
Sbjct: 451 RVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIR 510

Query: 487 AIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDP 546
            +AAR+D+Y +LARS+APSI+EL+D+KKGILLQL            RYRGDINILLCGDP
Sbjct: 511 EVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDP 570

Query: 547 STSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCC 606
           STSKSQILQYVHKI PRGVYTSGKGSSAVGLTAYITRD+DTKQLVLESGALVLSDGGVCC
Sbjct: 571 STSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCC 630

Query: 607 IDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTE 666
           IDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR+SILASANPIGSRYNPNLPVTE
Sbjct: 631 IDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTE 690

Query: 667 NIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNETDGDVLPVELLTLY 726
           NIDLPPPLLSRFDLVYLVLDKVDE  DRELAKHLTNLYLED P + +  DVLPVE LT+Y
Sbjct: 691 NIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMY 750

Query: 727 INYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAK 786
           I+YAK+   P+I E AKTELVRAYV MRKMGDDSRSDEKRITATTRQLESMIRLAEAHAK
Sbjct: 751 ISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAK 810

Query: 787 MRLSQTVELQDVQEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLAREVV 846
           M+L   VEL+DVQEAVRLI+SAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDL+RE++
Sbjct: 811 MKLKNVVELEDVQEAVRLIRSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREIM 870

Query: 847 SILGARSNLTISYNELLRSINEQSQDKVEAADISEALVRLQQEDKVVVLGE 897
           ++L  +++ ++S+NEL++ INE SQD+VE++DI EAL RLQQEDKV+VLGE
Sbjct: 871 NVLKDQASDSMSFNELIKQINEHSQDRVESSDIQEALSRLQQEDKVIVLGE 921

>ADL026W [1716] [Homologous to ScYPR019W (CDC54) - SH]
           complement(653657..656323) [2667 bp, 888 aa]
          Length = 888

 Score = 1285 bits (3326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/881 (72%), Positives = 725/881 (82%), Gaps = 34/881 (3%)

Query: 31  LFYNPSSSSQPDTYESQQRQ--RTVGSSPFRYPSSSQDHPHVTSD---TFASQS--RTQR 83
           LFYNPSSSSQPDTYE  Q+     +GSSPF YPSSSQ   +  S+    F+SQ   R++R
Sbjct: 16  LFYNPSSSSQPDTYERGQQNAGNMIGSSPFHYPSSSQSQQNTRSNRGGAFSSQGVPRSER 75

Query: 84  S----SGPGRFTDFXXXXXXXXXXXXXXXXQHAAQRRSDLHASDLSSPRRMVXXXXXXXX 139
           S    S PG                     QH    RSD+HASDLSSPRRMV        
Sbjct: 76  SYAGSSLPG---------------TARTRLQHYG--RSDIHASDLSSPRRMVNFNSPSTL 118

Query: 140 XXXXXXXXEATEPLRIIWGTNVSIQECATNFRNFLMSFKYKFRKTLDGNEDFLNETDDEE 199
                   E  EP+RIIWGTNVSIQE A  F+NFLM+FKYK+RK  D  E F+NET DEE
Sbjct: 119 SSSDPPS-ENDEPMRIIWGTNVSIQEVACTFKNFLMTFKYKYRKIKDEQELFINETTDEE 177

Query: 200 LYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIMDQTVKDCMVSL 259
           LYYV +L+QMR++G+ NLNLD RNL+SF  TEKLY+QL++YPQE+ISIMDQ VKDCMV L
Sbjct: 178 LYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQL 237

Query: 260 VVDNNLESG---LDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIP 316
            VD +   G   L E+ESK YKIRPYN+++++GMRELNPNDIDKL+S+KGLVLRSTP+IP
Sbjct: 238 AVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIP 297

Query: 317 DMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQ 376
           DMK+AFFKC++CDHT  VEIDRG+IQEP RCPRVACNQ+NSM+L+HNRCSFADKQVIKLQ
Sbjct: 298 DMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQ 357

Query: 377 ETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRASTTQRALKSLYKTY 436
           ETPD VPDGQTPHSVSLC+YDELVDSCRAGDRIE+TGIFRSIPIRA+  QRALKSLYKTY
Sbjct: 358 ETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQRALKSLYKTY 417

Query: 437 LDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRKLHAIAARDDVYE 496
           LDVVHV+KV+  RL  DTSTVEQ++LQN+M+  +V+E+ ++TDE I K++A+AAR DVYE
Sbjct: 418 LDVVHVRKVSARRLDIDTSTVEQQILQNQMD--NVEELRKVTDEDIAKINAVAARPDVYE 475

Query: 497 VLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQY 556
           VLARS+APSI+ELDDIKKGILLQL            RYRGDINILLCGDPSTSKSQILQY
Sbjct: 476 VLARSIAPSIYELDDIKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQY 535

Query: 557 VHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDS 616
           VHKIAPRGVYTSGKGSSAVGLTAYITRD DTKQ VLESGALVLSDGGVCCIDEFDKMSDS
Sbjct: 536 VHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDS 595

Query: 617 TRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLS 676
           TRSVLHEVM+QQ IS+AKAGIITTLNARTSILASANPIGSRYN NLPVTENIDLPPPLLS
Sbjct: 596 TRSVLHEVMKQQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLS 655

Query: 677 RFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNETDGDVLPVELLTLYINYAKQQYAP 736
           RFDLVYLVLDKV E+TDRELAKHLT+LYLED P + ++ D+LPV  LT+YINYAKQ   P
Sbjct: 656 RFDLVYLVLDKVSESTDRELAKHLTSLYLEDKPAHVSESDILPVHFLTMYINYAKQHIHP 715

Query: 737 VIIEQAKTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQ 796
           VI E AKTELVRAYV MR MGDDSR+DEKRITATTRQLESMIRL+EAHAK+RLSQ VE+ 
Sbjct: 716 VITEGAKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVS 775

Query: 797 DVQEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLAREVVSILGARSNLT 856
           DVQEAVRLIKSAIKDYA DPKTGKIDMNL+QTGKSVIQRKLQEDLARE+V +L  RS   
Sbjct: 776 DVQEAVRLIKSAIKDYAIDPKTGKIDMNLIQTGKSVIQRKLQEDLAREIVRLLTERSADV 835

Query: 857 ISYNELLRSINEQSQDKVEAADISEALVRLQQEDKVVVLGE 897
           I+YNEL R +NE SQD+++   IS+AL RLQQEDK+VVLG+
Sbjct: 836 ITYNELARLLNENSQDRLDNMTISDALNRLQQEDKIVVLGD 876

>KLLA0C17512g complement(1537707..1540385) similar to sp|P30665
           Saccharomyces cerevisiae YPR019w CDC54 member of the
           CDC46P/MCM2P/MCM3P family, start by similarity
          Length = 892

 Score = 1277 bits (3304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/876 (72%), Positives = 719/876 (82%), Gaps = 18/876 (2%)

Query: 31  LFYNPSSSSQP-DTYESQQRQ-RTVGSSPFRYPSSSQDHPHVTSDTFASQSRTQRSSGPG 88
           LFY+PSSS  P  T +SQ  Q R VGSSPF YPSSS       S+     +R   SS   
Sbjct: 14  LFYDPSSSPAPHGTQDSQASQDRGVGSSPFHYPSSS-------SNATQETARAAPSSSGL 66

Query: 89  RFTDFXXXXXXXXXXXXXXXXQ--HAAQRRSDLHASDLSSPRRMVXXXXXXXXXXXXX-- 144
           R  +                 +  H+  RR +++ASDLSSPRR+V               
Sbjct: 67  RSNNLRSDLLNYSSSLSSSAREGRHSRSRRGEINASDLSSPRRIVTFNNLSSSDNGFSSS 126

Query: 145 ---XXXEATEPLRIIWGTNVSIQECATNFRNFLMSFKYKFRKTLDGNEDFLNETDDEELY 201
                  A +PL+IIWGTNVSIQEC  +FR FLMSFK K+RK LD  E F+NET D+ELY
Sbjct: 127 SRPASEAADQPLKIIWGTNVSIQECGNSFREFLMSFKLKYRKELDDQEIFINETTDQELY 186

Query: 202 YVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIMDQTVKDCMVSLVV 261
           YV +LNQMR++G+ NLNLD RNLL++K TEKL++Q++ YPQEII+IMDQTVKDCMVSL +
Sbjct: 187 YVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIMDQTVKDCMVSLAL 246

Query: 262 DNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVA 321
           DN LES L+EIESK +K+RPYN+ET+KGMRELNPNDIDKL+S+KGLVLRSTPIIPDM VA
Sbjct: 247 DNGLESYLNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVA 306

Query: 322 FFKCNICDHTAVVEIDRGVIQEPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDT 381
           FFKCN+C+HT  VEIDRG+IQEP RCPRV CN  NSM LVHNRC+F D+QVIKLQETPD 
Sbjct: 307 FFKCNVCNHTVEVEIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQETPDL 366

Query: 382 VPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRASTTQRALKSLYKTYLDVVH 441
           VPDGQTPHSVSLCVYDELVDSCRAGDRIE++GIFRSIPIR++  QRALKSLYKTY+DVVH
Sbjct: 367 VPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQRALKSLYKTYIDVVH 426

Query: 442 VKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARS 501
           ++KV  DR+G DTSTVEQ+LLQN+++  +V+EI  ++ E IR++   A R DVY+VL+RS
Sbjct: 427 IQKVAKDRVGVDTSTVEQQLLQNQID--NVEEIRTLSSEDIRRIKETARRSDVYDVLSRS 484

Query: 502 VAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIA 561
           +APSI+ELDD+KKGILLQL            RYRGDINILLCGDPSTSKSQILQYVHKIA
Sbjct: 485 IAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIA 544

Query: 562 PRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVL 621
           PRGVYTSGKGSSAVGLTAY+TRD+DTKQLVLESGALVLSDGGVCCIDEFDKM+D+TRSVL
Sbjct: 545 PRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVL 604

Query: 622 HEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLV 681
           HEVMEQQTISIAKAGIITTLNARTSILASANPI SRYNPNLPVTENIDLPPPLLSRFDLV
Sbjct: 605 HEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLV 664

Query: 682 YLVLDKVDENTDRELAKHLTNLYLEDAPTNETDGDVLPVELLTLYINYAKQQYAPVIIEQ 741
           YLVLDKV+E +DRELAKHLT+LYLED P + + GD+LPVE LT YINYAKQ   PVI E 
Sbjct: 665 YLVLDKVNEASDRELAKHLTSLYLEDRPDSVSQGDILPVEFLTAYINYAKQNIHPVITES 724

Query: 742 AKTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEA 801
           AKTELVRAYV MRKMGDDSRSDEKRITATTRQLESMIRL+EAHAKMRLS+ VEL+DV+EA
Sbjct: 725 AKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEA 784

Query: 802 VRLIKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLAREVVSILGARSNLTISYNE 861
           VRLIKSAIKDYATDPKTGKIDMNLVQTGKSV+QRKL EDLARE++ IL  R+  TIS+NE
Sbjct: 785 VRLIKSAIKDYATDPKTGKIDMNLVQTGKSVVQRKLLEDLAREILKILTERTTDTISFNE 844

Query: 862 LLRSINEQSQDKVEAADISEALVRLQQEDKVVVLGE 897
           L + INEQSQDKVE+ ++S AL RLQQEDKVV+LGE
Sbjct: 845 LSKLINEQSQDKVESIELSNALTRLQQEDKVVILGE 880

>CAGL0J06424g complement(611935..614853) highly similar to sp|P53091
           Saccharomyces cerevisiae YGL201c MCM6, start by
           similarity
          Length = 972

 Score =  364 bits (934), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 221/580 (38%), Positives = 326/580 (56%), Gaps = 54/580 (9%)

Query: 275 KFYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVV 334
           + ++I  +N+ T   +RE+  + I  L+ + G V R++ + P++  A F C++C    V 
Sbjct: 248 RLFQISFFNLPTVHRIREIRSDKIGSLMCISGTVTRTSEVRPELYKASFTCDMC-RAMVD 306

Query: 335 EIDRGV-IQEPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSL 393
            +++     EP  CP  AC  +   TL  +R  F D Q +++QE  + +P+G  P ++ +
Sbjct: 307 NVEQSFKYTEPTFCPNPACENRAFWTLNVSRSKFLDWQKVRIQENTNEIPNGSMPRTLDV 366

Query: 394 CVYDELVDSCRAGDRIEITGIFRSIP---------IRASTTQ----------------RA 428
            +  + VD  + GD+ + TG+   +P         ++ S++                   
Sbjct: 367 ILRGDAVDRAKPGDKCQFTGVEIVVPDVSQLMLPGVKPSSSLDTRGIARSSEGLNSGVTG 426

Query: 429 LKSL------YKTYLDVVHVKKVTNDRLGADTSTVEQEL-----LQNEMNHSDVQE---- 473
           LKSL      YK      HV  V ++    + S+ E  L     LQN   +SD ++    
Sbjct: 427 LKSLGVRDLTYKITFLGSHVVSVGSNMNPNENSSAETNLQFISKLQNNDIYSDREKDQEI 486

Query: 474 -IPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXX 532
            +  ++ ++I +L  +   D VY+ L RS+APS+F  + IKKGILLQ+            
Sbjct: 487 FLSSLSPDEINELQDMVKDDHVYDKLVRSIAPSVFGHEAIKKGILLQMLGGVHKTTVEGI 546

Query: 533 RYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVL 592
           + RGDINI + GDPSTSKSQ L+YV + APR VYTSGK SSA GLTA + RD +     +
Sbjct: 547 KLRGDINICIVGDPSTSKSQFLKYVCRFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTI 606

Query: 593 ESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASAN 652
           E+GAL+L+D G+CCIDEFDKM  S +  +HE MEQQTISIAKAGI  TLNARTSILA+AN
Sbjct: 607 EAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAAN 666

Query: 653 PIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNE 712
           PIG RYN    +  N+++  P++SRFDL ++VLD  +E  D ELA H+ +L+++    +E
Sbjct: 667 PIGGRYNRKTSLRANLNMTAPIMSRFDLFFVVLDDCNEKIDTELASHIIDLHMKQ---DE 723

Query: 713 TDGDVLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRSDEK---RITA 769
                   E L  YI YAK  + PVI ++A+  LV  Y  +RK  DD++   +   RI  
Sbjct: 724 AITSPYSAEQLQRYIKYAK-TFKPVINKEARKFLVEKYKALRK--DDAQGYSRSSYRI-- 778

Query: 770 TTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
           T RQLESM+RL+EA A+   S  +  + V EA  L+K +I
Sbjct: 779 TVRQLESMVRLSEAIARANCSDEITPEFVAEAYDLLKQSI 818

>KLLA0E23276g complement(2065845..2068325) similar to sp|P38132
           Saccharomyces cerevisiae YBR202w CDC47 cell division
           control protein, start by similarity
          Length = 826

 Score =  356 bits (914), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 225/598 (37%), Positives = 342/598 (57%), Gaps = 56/598 (9%)

Query: 278 KIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEID 337
           K++P ++      RE+  + + KLI+V+G++ R + + P + V  + C+ C H    E++
Sbjct: 212 KLKPMSV------REIKGSYLGKLITVRGIITRVSDVKPSVTVNAYTCDQCGHEVFQEVN 265

Query: 338 RGVIQEPARCPRVAC--NQQNSMTLVHNRCS-FADKQVIKLQETPDTVPDGQTPHSVSLC 394
           +        CP   C  NQ      +  R S F+  Q  K+QE  D VP G  P ++++ 
Sbjct: 266 KRTFTPIIECPSAQCSENQTKGQLFMSTRASKFSAFQECKIQELSDQVPIGHIPRTLTIH 325

Query: 395 VYDELVDSCRAGDRIEITGIFRSIPIRASTTQRALKS--LYKTYLDVVHVKKVTNDRLGA 452
           +   L  S   GD +++TGI+   P    T  RALK+  L +TYL+              
Sbjct: 326 INGPLTRSMIPGDVVDVTGIYLPSPY---TGFRALKAGLLTETYLET------------- 369

Query: 453 DTSTVEQELLQNEMNHSDVQEIPQITDEQIR-KLHAIAARDDVYEVLARSVAPSIFELDD 511
                 Q + Q++   +  Q      D+Q++ ++  I  + DVY  LA+S+AP I+   D
Sbjct: 370 ------QFVYQHKKKFASFQ-----VDDQLKERVAKIVNQGDVYNRLAKSIAPEIYGNLD 418

Query: 512 IKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKG 571
           +KK +LL L            + RGDINI L GDP  +KSQ+L+ + KI+PRGVYT+GKG
Sbjct: 419 VKKSLLLLLVGGVEKKVGDGLKIRGDINICLMGDPGVAKSQLLKSICKISPRGVYTTGKG 478

Query: 572 SSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTIS 631
           SS VGLTA + +D  T ++VLE GALVL+D G+CCIDEFDKM +S R+ +HEVMEQQTIS
Sbjct: 479 SSGVGLTAAVMKDPVTDEMVLEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTIS 538

Query: 632 IAKAGIITTLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEN 691
           I+KAGI TTLNAR SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD   + 
Sbjct: 539 ISKAGINTTLNARASILAAANPLYGRYNPRLSPLENINLPAALLSRFDIMFLLLDMPSKE 598

Query: 692 TDRELAKHLTNLYLEDAPTNETDGDVLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYV 751
            D +LA+H+T +++ D    +   + +P   +  YI YAK +  PV+       +V +Y 
Sbjct: 599 NDEKLAEHVTYVHMYDRQP-DFGFEPIPSSEMREYIAYAKTK-RPVLSADVNEHIVLSYT 656

Query: 752 TMRKMGDDSRSDEKRIT---ATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSA 808
            MR+  D  ++ + + +   AT R L ++IRL++A AK+RLS TVE++DV EA+RL++ +
Sbjct: 657 RMRQ--DSKKALDSKFSFGQATPRTLLAIIRLSQALAKLRLSDTVEIEDVDEALRLVEVS 714

Query: 809 IKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLAREVVSILGARSNLTISYNELLRSI 866
            +   +D K    D N      ++I++   E+           R N  + Y+ ++R+I
Sbjct: 715 KESLYSDRKNPYEDENPTTRIYTIIKKMATEN----------GRFNKRLPYDAIVRTI 762

>KLLA0F10087g complement(935618..938629) similar to sp|P53091
           Saccharomyces cerevisiae YGL201c MCM6 involved in
           replication, start by similarity
          Length = 1003

 Score =  358 bits (919), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 220/591 (37%), Positives = 327/591 (55%), Gaps = 63/591 (10%)

Query: 270 DEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICD 329
           D++E +  +I   N+ T   +R++  N I  L+++ G V R++ I P++  A F C +C 
Sbjct: 239 DQVE-RVLQISFLNLPTVHRIRDIRANKIGSLMAISGTVTRTSEIRPELYKASFTCELC- 296

Query: 330 HTAVVEIDRGVIQ--EPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQT 387
             AV++    V +  EP  CP   C  Q+  +L  NR  F D Q +++QE  + +P G  
Sbjct: 297 -RAVIDNVEQVFKYTEPTSCPNPTCENQSFWSLNVNRSKFLDWQKVRIQENSNEIPSGSM 355

Query: 388 PHSVSLCVYDELVDSCRAGDRIEITGIFRSIP---------IRASTTQ------------ 426
           P ++ + +  + V+  + GDR +  G    +P         ++AS+T             
Sbjct: 356 PRTLDIILRGDCVERAKPGDRCKFIGTEIVVPDVSQLGLPGVKASSTPDSRGISRTTEGL 415

Query: 427 ----RALKSL------YKTYLDVVHVKKV--------TNDRLGADTSTVEQELLQNEMNH 468
                 LKSL      YK      HV+ V         N+     TS  +   L+N  N+
Sbjct: 416 NSGISGLKSLGVRDLTYKISFLACHVENVGTSFNGSRINEEDADKTSKFDYINLRNYQNY 475

Query: 469 SDVQEIPQ------ITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXX 522
               E  Q      +  ++I +L  +   +++Y+ L +S+AP++F  + IKKGILLQ+  
Sbjct: 476 EMAAETDQEIFLTRLDSDEINELKEMVKDENIYDKLVKSIAPAVFGHETIKKGILLQMLS 535

Query: 523 XXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYIT 582
                     + RGDINI + GDPSTSKSQ L+YV   +PR VYTSGK SSA GLTA + 
Sbjct: 536 GVHKTTVEGIKLRGDINICIVGDPSTSKSQFLKYVCNFSPRAVYTSGKASSAAGLTAAVV 595

Query: 583 RDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLN 642
           +D +     +E+GAL+L+D GVCCIDEFDKM  + +  +HE MEQQTISIAKAGI  TLN
Sbjct: 596 KDEEGGDFTIEAGALMLADNGVCCIDEFDKMDIADQVAIHEAMEQQTISIAKAGIHATLN 655

Query: 643 ARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTN 702
           ARTSILA+ANP+G RYN  L +  N+++  P++SRFDL +++LD  +E  D ELA H+ +
Sbjct: 656 ARTSILAAANPVGGRYNRKLTLRSNLNMSAPIMSRFDLFFVILDDCNEKIDTELASHIVD 715

Query: 703 LYLE-DAPTNETDGDVLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSR 761
           L+++ D+  N         E L+ YINYAK  + PV+ ++A+  LV+ Y  +RK  DD++
Sbjct: 716 LHMKRDSAINPP----FSAEQLSRYINYAK-TFKPVMTKEARDYLVKRYTELRK--DDAQ 768

Query: 762 SDEK---RITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
              K   RI  T RQLES+IRL+EA A+      +    V EA  L++ +I
Sbjct: 769 GYSKSSYRI--TVRQLESLIRLSEAIARANCVDEIVPSFVAEAYDLLRQSI 817

>ADR041W [1782] [Homologous to ScYBR202W (CDC47) - SH]
           complement(777754..780195) [2442 bp, 813 aa]
          Length = 813

 Score =  347 bits (890), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 209/543 (38%), Positives = 315/543 (58%), Gaps = 52/543 (9%)

Query: 291 RELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRV 350
           RE+  + + KLI+V G+V R + + P + V  + C+ C      E+++        C   
Sbjct: 215 REVKGSHLGKLITVSGIVTRISDVKPAVLVTAYTCDQCGAEVFQEVNKRTFTPFLECTSR 274

Query: 351 AC--NQQNSMTLVHNRCS-FADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGD 407
            C  NQ      +  R S F+  Q  K+QE    VP G  P ++++ V   LV S   GD
Sbjct: 275 QCQQNQNKGQLFMSTRASKFSAFQECKIQEMSHQVPIGHIPRTLTIHVNGPLVRSMVPGD 334

Query: 408 RIEITGIFRSIPIRASTTQRALKS--LYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNE 465
            +++TGI+   P    T  +ALK+  L +TYL+  +V+                   Q++
Sbjct: 335 IVDVTGIYLPAPY---TGFKALKAGLLTETYLEAQYVR-------------------QHK 372

Query: 466 MNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXX 525
              S  +    IT +  +++ +I  + DVY  LA+S+AP I+   D+KK +LL +     
Sbjct: 373 KKFSSFE----ITSDVEKRVMSIVQQGDVYTRLAKSIAPEIYGNLDVKKALLLLMVGGVH 428

Query: 526 XXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDI 585
                  + RGDINI L GDP  +KSQ+L+ + KI PRGVYT+GKGSS VGLTA + +D 
Sbjct: 429 KTVGDGMKIRGDINICLMGDPGVAKSQLLKSICKITPRGVYTTGKGSSGVGLTAAVMKDP 488

Query: 586 DTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNART 645
            T ++VLE GALVL+D G+CCIDEFDKM +S R+ +HEVMEQQTISI+KAGI TTLNART
Sbjct: 489 VTDEMVLEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNART 548

Query: 646 SILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYL 705
           SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD      D +LA+H+  +++
Sbjct: 549 SILAAANPVYGRYNPRLSPLENINLPAALLSRFDIMFLLLDMPHRENDEKLAEHVAYVHM 608

Query: 706 EDAPTNETDGDVLPVELLTL--YINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRSD 763
            +    + + D  P+E   +  +I +AK +  P++ ++    +V++Y+ MR+       D
Sbjct: 609 HN---RQPELDFEPIEPAAMREFIAFAKTK-RPIMTQEVNELVVQSYIRMRQ-------D 657

Query: 764 EKRIT--------ATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYATD 815
            K +T        AT R L ++IR+++A AK+R S  V+++DV+EA+RLI+ +      D
Sbjct: 658 SKNVTDPKQQFGQATPRTLLAVIRISQALAKLRFSDQVDVEDVEEALRLIQVSKDSLYND 717

Query: 816 PKT 818
            +T
Sbjct: 718 TQT 720

>Kwal_47.18966
          Length = 1044

 Score =  351 bits (900), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 217/591 (36%), Positives = 315/591 (53%), Gaps = 78/591 (13%)

Query: 275 KFYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVV 334
           + ++I  +N+ T   +R++    I  L+S+ G V R++ + P++  A F C +C   AVV
Sbjct: 278 RIFQISFFNLPTVNRIRDIRAEKIGSLMSISGTVTRTSEVRPELYKASFTCEMC--RAVV 335

Query: 335 EIDRGVIQ--EPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVS 392
           +    V +  +P  CP  +C  Q   TL   R  F D Q +++QE  + +P G  P ++ 
Sbjct: 336 DNVEQVFKYTQPTYCPNPSCENQAFWTLSVGRSKFLDWQKVRIQENANEIPTGSMPRTLD 395

Query: 393 LCVYDELVDSCRAGDRIEITGIFRSIP---------IRASTTQ----------------R 427
           + +  + V+  + GDR + TG    +P         ++ S+T                  
Sbjct: 396 VVLRGDCVERAKPGDRCKFTGTEIVVPDITQLGLPGVKPSSTMDNRGIARSSEGLNTGVS 455

Query: 428 ALKSL------YKTYLDVVHVKKVTNDR--------LGADTSTVE-----------QELL 462
            LKSL      YK      HV     D          G D  +++           QE+ 
Sbjct: 456 GLKSLGVRDLTYKISFLACHVTPTGKDANNNANAQDEGGDLLSMQVNNVGNDDERDQEIF 515

Query: 463 QNEMNHSDVQEIPQ-ITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLX 521
            N +N  ++ E+ + + DEQI            Y+ L RS+AP++F  + +KKGILLQ+ 
Sbjct: 516 LNSLNSQEINELKEMVKDEQI------------YDKLVRSIAPAVFGHNTVKKGILLQML 563

Query: 522 XXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYI 581
                        RGDINI + GDPSTSKSQ L+YV   APR VYTSGK SSA GLTA +
Sbjct: 564 GGVHKTTVEGINLRGDINICIVGDPSTSKSQFLKYVCGFAPRAVYTSGKASSAAGLTAAV 623

Query: 582 TRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTL 641
            +D +     +E+GAL+L+D G+CCIDEFDKM  S +  +HE MEQQTISIAKAGI  TL
Sbjct: 624 VKDEEAGDFTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATL 683

Query: 642 NARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLT 701
           NARTSILA+ANP+G RYN  L +  N+++  P++SRFDL ++VLD  +E  D ELA H+ 
Sbjct: 684 NARTSILAAANPVGGRYNRKLTLRGNLNMTAPIMSRFDLFFVVLDDCNEKIDTELAAHIV 743

Query: 702 NLYLEDAPTNETDGDVLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSR 761
           +L+++    +E        E L  YI YA+  + PV+ E+A+  LV  Y  +R+  DD++
Sbjct: 744 DLHMK---RDEAIDPPFTAEQLRRYIKYAR-TFKPVMNEEARNYLVEKYKELRR--DDAQ 797

Query: 762 SDEK---RITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
              K   RI  T RQLESMIRL+E  A+      +    V EA  L++ +I
Sbjct: 798 GFSKSSYRI--TVRQLESMIRLSEGIARANCVDEITPNFVAEAYDLLRQSI 846

>Scas_590.6
          Length = 767

 Score =  343 bits (880), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 241/777 (31%), Positives = 397/777 (51%), Gaps = 98/777 (12%)

Query: 165 ECATNFRNFLMSFKYKFRKTLDGNEDFLNETDDEELYYVKRLNQMREMGSLNLNLDARNL 224
           E   +F+NF++ F+                  D +  Y  +L     + + +LN++  +L
Sbjct: 26  EIIKSFKNFILEFRL-----------------DSQFIYRDQLRNSLLVKNYSLNVNMEHL 68

Query: 225 LSFKATEKLYYQLMSYPQEIISIMDQTVKDCMVSLVV-------DNNLESGLDEIESKF- 276
           + +   E L+ +L   P ++I + +  +      + +       +N   +  D+++++  
Sbjct: 69  IGYN--EDLFKRLSDGPSDVIPLFETAITQVAKRITLLNRSSQNENGTANETDDLDTRNS 126

Query: 277 --------YKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNIC 328
                   +++   +   Q  +R L+   + K++ + G+++ ++ +          C  C
Sbjct: 127 ISSALIPNFQLILTSTANQTPLRSLDSEHVSKIVRLSGIIISASVLSSRATHLSLMCRSC 186

Query: 329 DHTAVVEIDR--GVIQEPARCPRVAC-------------NQQNS----MTLVHNRCSFAD 369
            HT  ++ID    +       P  AC             N +N       ++H   +F D
Sbjct: 187 RHTTSIKIDNFNSITGNSVTLPH-ACLSSVTATDTGDDSNNKNCGPDPYLIIHESSTFID 245

Query: 370 KQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRASTTQRAL 429
           +Q +KLQE P+ VP G+ P ++++     L +    G R+ I GI+ SI    S+ +R  
Sbjct: 246 QQFLKLQEIPELVPVGEMPRNITMSCDRYLTNRVIPGTRVTIVGIY-SI---YSSKKRGY 301

Query: 430 KSLYKTYLDVVHVKKVTNDRLGADTSTVEQELL--QNEMNHSDV-QEIPQITDEQIRKLH 486
            S               ND  G        ++L  Q ++  S +   +   ++E+  +  
Sbjct: 302 NS--------------NNDGGGVAIRNPFIKVLGIQTDVETSSIWNSVTMFSEEEEEEFL 347

Query: 487 AIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDP 546
            ++ R+D+YEVL +S+APSIF  +DIKK I+  L            R RGDIN+LL GDP
Sbjct: 348 QLSRREDLYEVLTKSIAPSIFGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDP 407

Query: 547 STSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCC 606
            T+KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+VL+DGGV C
Sbjct: 408 GTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPATREFYLEGGAMVLADGGVVC 467

Query: 607 IDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTE 666
           IDEFDKM D  R  +HE MEQQTISIAKAGI T LN+RTS+LA+ANPI  RY+      E
Sbjct: 468 IDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGE 527

Query: 667 NIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTN-----ETDGDVLPVE 721
           NID    +LSRFD++++V D+ +E  D  +A H+ N++  ++ T      E  G  L +E
Sbjct: 528 NIDFQTTILSRFDMIFIVKDEHNEARDISIANHVINIHTGNSTTQQDQDLENSGSELSME 587

Query: 722 LLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRK---MGDDSRSDEKRITATTRQLESMI 778
            +  YI Y + + AP +  QA  +L   +VT+RK   + +   ++   I  T RQLE++I
Sbjct: 588 KMKRYITYCRIKCAPRLSVQAAEKLSSQFVTIRKQLLINELESTERSSIPITIRQLEAII 647

Query: 779 RLAEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYAT-DPKTGKIDMNLVQTGKSVIQ--R 835
           R+ E+ AK+ LS     + V+EA+RL +++  D A+ DP  G   +N    G +++   R
Sbjct: 648 RITESLAKLELSPVAHERHVEEAIRLFQASTMDAASQDPIGG---LNQTGNGSNIMAEIR 704

Query: 836 KLQEDLAREVVSILGARSNLTISYNELLRSINEQSQDKVEAADISEALVRLQQEDKV 892
           +++ +L R +   +G     + SY  L R   E ++    A D  +AL  L++ D +
Sbjct: 705 RIESELKRRLP--IG----WSTSYQTLRREFVESNRFSQGALD--KALYALEKHDTI 753

>CAGL0M05423g 577097..579535 highly similar to sp|P38132
           Saccharomyces cerevisiae YBR202w CDC47, start by
           similarity
          Length = 812

 Score =  343 bits (880), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 212/527 (40%), Positives = 310/527 (58%), Gaps = 42/527 (7%)

Query: 290 MRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPR 349
           +R++    + +LI+V+G++ R + + P + V  + C+ C +    E++         C  
Sbjct: 221 VRQIKGELLGELITVRGIITRVSDVKPAVTVIAYTCDQCGYEIFQEVNSKTFTPLVECTS 280

Query: 350 VAC--NQQNSMTLVHNRCS-FADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAG 406
             C  NQ      +  R S F   Q  K+QE    VP G  P S+++ V   LV S   G
Sbjct: 281 RECSQNQTKGQLFMSTRASKFNAFQECKIQELSQQVPVGHIPRSLTIHVNGPLVRSVTPG 340

Query: 407 DRIEITGIFRSIPIRASTTQRALKS--LYKTYLDVVHVKKVTNDRLGADTSTVEQELLQN 464
           D ++I GIF   P    T  +ALK+  L +TYL+  HV+                   Q+
Sbjct: 341 DIVDIAGIFLPSPY---TGFKALKAGLLTETYLEAHHVR-------------------QH 378

Query: 465 EMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXX 524
           +   +  Q  PQ+       + A+A   +VYE LA+S+AP I+   D+KK +LL L    
Sbjct: 379 KKKFASFQMTPQVRS----NVDALAQSGNVYERLAKSIAPEIYGNLDVKKALLLLLVGGV 434

Query: 525 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRD 584
                   + RGDINI L GDP  +KSQ+L+ + KI PRGVYT+GKGSS VGLTA + +D
Sbjct: 435 DKRVGDGMKIRGDINICLMGDPGVAKSQLLKAICKITPRGVYTTGKGSSGVGLTAAVMKD 494

Query: 585 IDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR 644
             T +++LE GALVL+D G+CCIDEFDKM +S R+ +HEVMEQQTISI+KAGI TTLNAR
Sbjct: 495 PVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNAR 554

Query: 645 TSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLY 704
           TSILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD  +   D +LA H+  ++
Sbjct: 555 TSILAAANPLYGRYNPRLSPLENINLPAALLSRFDVMFLLLDTPNRENDEQLANHVAYVH 614

Query: 705 LEDAPTNETDGDVLPVE--LLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRS 762
           + +    + D D  P+E  ++  +I YA+    PV+  +    +V AY+ +R+  D  R 
Sbjct: 615 MYN---KQPDLDFEPIEPTMMREFIAYARTM-RPVMTAEINDHVVSAYIRLRQ--DSKRE 668

Query: 763 DEKRIT---ATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIK 806
            + + +   AT R L ++IRL++A AK+RLS+TV++ DV+EA+RLI+
Sbjct: 669 MDSKFSFGQATPRTLLAIIRLSQALAKLRLSETVDIDDVEEALRLIR 715

>Scas_712.49
          Length = 1019

 Score =  346 bits (888), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 211/585 (36%), Positives = 320/585 (54%), Gaps = 56/585 (9%)

Query: 271 EIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDH 330
           E   + ++I  +N+ T   +R++    I  L+S+ G V R++ + P++  A F C++C  
Sbjct: 245 EQSERIFQISFFNLPTVFRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDLC-R 303

Query: 331 TAVVEIDRGV-IQEPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPH 389
             V  +++     EP  CP  +C  +   TL   R  F D Q +++QE  + +P G  P 
Sbjct: 304 AQVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSKFLDWQKVRIQENANEIPSGSMPR 363

Query: 390 SVSLCVYDELVDSCRAGDRIEITGIFRSIP---------IRASTTQ-------------- 426
           ++ + +  + V+  + GDR + TG    +P         I+ +++               
Sbjct: 364 TLDVILRGDCVERAKPGDRCKFTGTEIVVPDVTQLGLPGIKPTSSMDTRGIARSTEGLNN 423

Query: 427 --RALKSL------YKTYLDVVHVKKVTNDRLGADTSTVEQEL-LQNEMNHSDV------ 471
               L++L      YK      HV  + ++   +     E EL L   ++ S+V      
Sbjct: 424 GVSGLRALGVRDLTYKISFLACHVISIGSNTDASSNGNTENELQLAATLHGSNVYQDYEK 483

Query: 472 -QEI--PQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXX 528
            QE+    +  E+I +L  +   + +Y+ L RS+AP++F  + +KKGILLQ+        
Sbjct: 484 DQEVFLNSLNSEEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKST 543

Query: 529 XXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTK 588
               + RGDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GLTA + RD +  
Sbjct: 544 VEGIKLRGDINICIVGDPSTSKSQFLKYVCGFVPRSVYTSGKASSAAGLTAAVVRDEEGG 603

Query: 589 QLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSIL 648
              +E+GAL+L+D G+CCIDEFDKM  S +  +HE MEQQTISIAKAGI  TLNARTSIL
Sbjct: 604 DYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSIL 663

Query: 649 ASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLE-D 707
           A+ANPIG RYN  L +  N+++  P++SRFDL +++LD  +E  D ELA H+ +L+++ D
Sbjct: 664 AAANPIGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKRD 723

Query: 708 APTNETDGDVLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRSDEK-- 765
           A  +         E L  YI YA+  + P++ ++A+  LV  Y  +RK  DD++   K  
Sbjct: 724 AAIHSP----FTAEQLRRYIRYAR-TFKPILTKEARQYLVEKYKDLRK--DDAQGYSKSS 776

Query: 766 -RITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
            RI  T RQLESMIRL+EA A+      +    + EA  L++ +I
Sbjct: 777 YRI--TVRQLESMIRLSEAIARANCVDEITPAFIAEAYDLLRQSI 819

>CAGL0F04939g 503890..506208 highly similar to sp|P29496
           Saccharomyces cerevisiae YLR274w CDC46 cell division
           control protein, start by similarity
          Length = 772

 Score =  338 bits (867), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 243/780 (31%), Positives = 384/780 (49%), Gaps = 99/780 (12%)

Query: 165 ECATNFRNFLMSFKYKFRKTLDGNEDFLNETDDEELYYVKRLNQMREMGSLNLNLDARNL 224
           E    F+ F++ F+                  D +  Y  +L     + + +L++D  +L
Sbjct: 26  EIIKAFKRFILEFRL-----------------DSQFLYRDQLRNSLLVKNYSLSVDLEHL 68

Query: 225 LSFKATEKLYYQLMSYPQEIISIMDQTVKDCMVSLVVDN---NLESGLDEIESK------ 275
           + +   E LY +L   P ++I + +  +      +++ N   N   GLD+I+        
Sbjct: 69  IGYN--EDLYKRLSDEPSDVIPLFETAITQVAKRIMILNKSSNTNDGLDDIDENSNDLAD 126

Query: 276 ---------FYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCN 326
                     +++   +   Q  +R+LN   +  ++ + G+++ ++ +          C 
Sbjct: 127 DEDGITDIPVFQLILSSRANQVSLRQLNSEHVSNIVRLSGIIVSASVLSQRATHLSLMCR 186

Query: 327 ICDHTAVVEIDR--GVIQEPARCPRVACNQQNSMT------------------------- 359
            C HT  + I+    +       P    +  N+ T                         
Sbjct: 187 NCRHTMSLNINNFNSITGNSVTLPHSCQSTNNNSTAAYIHDTGDDPTGSGAASKNCGPDP 246

Query: 360 --LVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRS 417
             ++H    F D+Q +KLQE P+ VP  + P ++++     L +    G R+ I GI+ S
Sbjct: 247 YIIIHESSKFIDQQFLKLQEVPELVPVSEMPRNITMTCDRYLTNRVNPGTRVTIEGIY-S 305

Query: 418 IPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQI 477
           I      +  A +S     +   ++K      LG  T  VE   + N M           
Sbjct: 306 IYNSKKRSGAAGQSGSGVAIRTPYIKV-----LGIQTD-VEASSIWNSMT--------MF 351

Query: 478 TDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGD 537
           ++E+  +   ++ R D+YE+LA S+APSIF   DIKK I+  L            R RGD
Sbjct: 352 SEEEEEEFLQLSRRPDIYELLANSIAPSIFGNQDIKKAIVCLLMGGSKKLLPDGMRLRGD 411

Query: 538 INILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGAL 597
           IN+LL GDP T+KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  TK+  LE GA+
Sbjct: 412 INVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPITKEFFLEGGAM 471

Query: 598 VLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSR 657
           VL+DGGV CIDEFDKM D  R  +HE MEQQTISIAKAGI T LN+RTS+LA+ANPI  R
Sbjct: 472 VLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGR 531

Query: 658 YNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTN-ETDGD 716
           Y+      ENID    +LSRFD++++V D+ +E  D  +A H+ N++        E +G 
Sbjct: 532 YDELKSPGENIDFQTTILSRFDMIFIVKDEHNEERDISIANHVMNIHTGHTDAQLEANGS 591

Query: 717 VLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRK---MGDDSRSDEKRITATTRQ 773
            L +E +  YI Y K + AP +  +A  +L   +VT+RK   + +   ++   I  T RQ
Sbjct: 592 ELSIEKMKRYITYCKSRCAPRLTPEAAEKLSSQFVTIRKQLLINELESTERSSIPITIRQ 651

Query: 774 LESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYAT-DPKTGKIDMNLVQTGKSV 832
           LE++IR+ E+ AK+ LS   E + V EA+RL +++  D A  DP  G   MN  QT    
Sbjct: 652 LEAIIRITESLAKLELSPIAEERHVDEAIRLFQASTMDAAAQDPIGG---MN--QTNSLS 706

Query: 833 IQRKLQEDLAREVVSILGARSNLTISYNELLRSINEQSQDKVEAADISEALVRLQQEDKV 892
             R+++++L R +   +G     + SY  L R   +   +KV  + +  AL  L++ + +
Sbjct: 707 DIRRVEQELKRRLP--IG----WSTSYQTLKREFVD--TNKVSQSSLDRALYALEKHETI 758

>YGL201C (MCM6) [1794] chr7 complement(117856..120909) Protein
           involved in DNA replication, member of the MCM/P1 family
           of proteins [3054 bp, 1017 aa]
          Length = 1017

 Score =  344 bits (882), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 209/585 (35%), Positives = 324/585 (55%), Gaps = 60/585 (10%)

Query: 275 KFYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVV 334
           + ++I  +N+ T   +R++    I  L+S+ G V R++ + P++  A F C++C    V 
Sbjct: 261 RVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMC-RAIVD 319

Query: 335 EIDRGV-IQEPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSL 393
            +++     EP  CP  +C  +   TL   R  F D Q +++QE  + +P G  P ++ +
Sbjct: 320 NVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDV 379

Query: 394 CVYDELVDSCRAGDRIEITGIFRSIP---------IRASTTQ----------------RA 428
            +  + V+  + GDR + TG+   +P         ++ S+T                   
Sbjct: 380 ILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSGVTG 439

Query: 429 LKSL------YKTYLDVVHVKKVTNDRLGA-----DTSTVEQEL-----LQNEMNHSDVQ 472
           L+SL      YK      HV  + ++ +GA     +++  E EL     LQ    + D +
Sbjct: 440 LRSLGVRDLTYKISFLACHVISIGSN-IGASSPDANSNNRETELQMAANLQANNVYQDNE 498

Query: 473 E-----IPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXX 527
                 +  ++ ++I +L  +   + +Y+ L RS+AP++F  + +KKGILLQ+       
Sbjct: 499 RDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKS 558

Query: 528 XXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDT 587
                + RGDINI + GDPSTSKSQ L+YV   APR VYTSGK SSA GLTA + RD + 
Sbjct: 559 TVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEG 618

Query: 588 KQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSI 647
               +E+GAL+L+D G+CCIDEFDKM  S +  +HE MEQQTISIAKAGI  TLNARTSI
Sbjct: 619 GDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSI 678

Query: 648 LASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLED 707
           LA+ANP+G RYN  L +  N+++  P++SRFDL +++LD  +E  D ELA H+ +L+++ 
Sbjct: 679 LAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMK- 737

Query: 708 APTNETDGDVLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRSDEK-- 765
              +E        E L  YI YA+  + P++ ++A++ LV  Y  +RK  DD++   +  
Sbjct: 738 --RDEAIEPPFSAEQLRRYIKYAR-TFKPILTKEARSYLVEKYKELRK--DDAQGFSRSS 792

Query: 766 -RITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
            RI  T RQLESMIRL+EA A+      +    + EA  L++ +I
Sbjct: 793 YRI--TVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSI 835

>Kwal_56.23282
          Length = 761

 Score =  337 bits (863), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 234/755 (30%), Positives = 374/755 (49%), Gaps = 86/755 (11%)

Query: 165 ECATNFRNFLMSFKYKFRKTLDGNEDFLNETDDEELYYVKRLNQMREMGSLNLNLDARNL 224
           E   +F NF++ F+                  D    Y ++L     + + ++ +D  +L
Sbjct: 26  EIVKSFHNFVLEFRL-----------------DAHFVYREQLRSNLLVKNYSITVDTAHL 68

Query: 225 LSFKATEKLYYQLMSYPQEIISIMDQTVKDCMVSLVV---------DNNLESGLDEIESK 275
           + +   E LY +L   P +++ + +Q V      + +         +N LE+   +    
Sbjct: 69  IGYN--EDLYKRLYDEPTDVLPLFEQAVSQVARRIALLSRDPNMDPNNQLENASTDDAPN 126

Query: 276 FYKIRPYNIET----------QKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKC 325
                 ++I T          +  +R L   ++ K++ V G+V+ ++ +          C
Sbjct: 127 SGASLAFDIPTCQVMLISDSSETSLRVLGSENVSKIVRVSGIVVSASVLSSRATFLTLMC 186

Query: 326 NICDHTAVVEID-------------RGVIQEPARCPRVACNQQNSMTLVHNRCSFADKQV 372
             C H   + ++             R  + + +R        Q+   +VH    F D+Q 
Sbjct: 187 RNCRHVTTMHLNSFGSLGGNHVSLPRNCLADHSRETGSNPCGQDPYMIVHESSRFVDQQF 246

Query: 373 IKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRASTTQRALKSL 432
           +KLQE P+ VP G+ P ++ +     L +    G R  I GI+     ++     A    
Sbjct: 247 LKLQEIPELVPVGEMPRNILMSCDRYLTNRIVPGTRATIVGIYSIYQAKSRGAGTAASGG 306

Query: 433 YKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRKLHAIAARD 492
               +   +VK      LG     ++ +L  N M+++ V      TDE+  +   ++ R 
Sbjct: 307 KAVAIRNPYVKI-----LG-----IQTDLDGNPMSNTVV-----FTDEEEEQFLTLSRRP 351

Query: 493 DVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQ 552
           D+YE+  +S+APSI+  +DIKK I+  L            R RGDIN+LL GDP T+KSQ
Sbjct: 352 DLYEIFTKSIAPSIYGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKSQ 411

Query: 553 ILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCCIDEFDK 612
           +L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+VL+DGGV CIDEFDK
Sbjct: 412 LLKFVEKVSPISVYTSGKGSSAAGLTASVQRDPATREFYLEGGAMVLADGGVVCIDEFDK 471

Query: 613 MSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTENIDLPP 672
           M D  R  +HE MEQQTISIAKAGI T LN+RTS+LA+ANPI  RY+      ENID   
Sbjct: 472 MRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGENIDFQT 531

Query: 673 PLLSRFDLVYLVLDKVDENTDRELAKHLTNLY----LEDAPTNETDGDVLPVELLTLYIN 728
            +LSRFD++++V D  +E  D  +A H+ N++      +    E   + +P+E +  YI 
Sbjct: 532 TILSRFDMIFIVKDHHNEERDISIANHVMNIHTGRTATNEEEREAAANEIPIEKMKRYIT 591

Query: 729 YAKQQYAPVIIEQAKTELVRAYVTMRK--MGDDSRSDEK-RITATTRQLESMIRLAEAHA 785
           Y + + AP +  QA  +L   +V +RK  + ++ +S+++  I  T RQLE++IR++E+ A
Sbjct: 592 YCRMKCAPRLSPQAAEKLSSHFVGIRKKLLINELQSEQRSSIPITVRQLEAIIRISESLA 651

Query: 786 KMRLSQTVELQDVQEAVRLIKSAIKDYATDPKTGKIDMN--LVQTGKSVIQRKLQEDLAR 843
           K+ LS     + V EA+RL +++  D A+    G +  N  LVQ       R+++E+L R
Sbjct: 652 KLELSPVAHERHVDEAIRLFQASTMDAASQDPIGGLGQNQDLVQD-----VRRIEEELKR 706

Query: 844 EVVSILGARSNLTISYNELLRSINEQSQDKVEAAD 878
            +          + SY  L R   EQ      A D
Sbjct: 707 RL------PVGWSTSYQTLRREFCEQKSYAAPALD 735

>AGR276W [4587] [Homologous to ScYLR274W (CDC46) - SH]
           complement(1257348..1259552) [2205 bp, 734 aa]
          Length = 734

 Score =  333 bits (854), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 229/755 (30%), Positives = 377/755 (49%), Gaps = 87/755 (11%)

Query: 165 ECATNFRNFLMSFKYKFRKTLDGNEDFLNETDDEELYYVKRLNQMREMGSLNLNLDARNL 224
           E   +FR+F++ F+                  D    Y ++L     +    L ++  +L
Sbjct: 26  EVVRSFRDFVLEFRL-----------------DARFVYREQLRNNLLVRRYALRVNTEHL 68

Query: 225 LSFKATEKLYYQLMSYPQEIISIMDQTVKDCMVSLVVDNNLESG-LDEIESKFYKIRPYN 283
           + +   E LY  +   P E + + +Q V +    +      ++G L  ++ +       +
Sbjct: 69  IGYN--EALYKLVRDEPVETVPLFEQAVTEIARRMARLRAEDAGALPAVQVELQ-----S 121

Query: 284 IETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEID--RGVI 341
              +  +R+L+   + +L+ + G+V+ ++ +          C  C HT  ++++  + + 
Sbjct: 122 AAAETALRQLDSQSVSRLVRLSGIVVSTSVLTSRATHVALMCRNCRHTTALDLNNFQSLA 181

Query: 342 QEPARCPRVA---------------CNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQ 386
                 PR                 C Q   M +VH    F D+Q +KLQE P++VP G+
Sbjct: 182 GSNVALPRACLADHSNDDGSAAGNPCGQDPYM-IVHESSRFVDQQFLKLQEVPESVPIGE 240

Query: 387 TPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRASTTQRALKSLYKTYLDVVHVKKVT 446
            P ++ L     L +    G R+ + GI+     +         ++   Y+ V+ ++   
Sbjct: 241 MPRNLLLTCDRYLTNRVVPGTRVTVVGIYAIYQSKGGQGGARAVAIRNPYVKVLGIEAQA 300

Query: 447 NDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSI 506
               G                      +   ++E+  +   +A   ++Y++ A S+APSI
Sbjct: 301 GSPAGV---------------------LSMFSEEEEEEFLRLARTPNLYQLFAESIAPSI 339

Query: 507 FELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVY 566
           +  +DIKK I+  L            R RGDIN+LL GDP T+KSQ+L++V K++P  VY
Sbjct: 340 YGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVY 399

Query: 567 TSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVME 626
           TSGKGSSA GLTA + RD +T++  LE GA+VL+DGGV CIDEFDKM D  R  +HE ME
Sbjct: 400 TSGKGSSAAGLTASVQRDPNTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAME 459

Query: 627 QQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLD 686
           QQTISIAKAGI T LN+RTS+LA+ANPI  RY+      ENID    +LSRFD++++V D
Sbjct: 460 QQTISIAKAGITTVLNSRTSVLAAANPIYGRYDELKSPGENIDFQTTILSRFDMIFIVKD 519

Query: 687 KVDENTDRELAKHLTNLY-----LEDAPTNETDGDVLPVELLTLYINYAKQQYAPVIIEQ 741
           + +E  D  +A+H+ N++     + DA     D ++ P++ +  YI Y + + AP +   
Sbjct: 520 EHNEQRDMSIAQHVMNIHTGRTAVPDAGAAGADREI-PIDKMRRYITYCRSKCAPRLSTH 578

Query: 742 AKTELVRAYVTMRK--MGDDSRSDEK-RITATTRQLESMIRLAEAHAKMRLSQTVELQDV 798
           A  +L   +VT+RK  + ++  S EK  I  T RQLE++IR++E+ AK+ LS   E + V
Sbjct: 579 AAEKLSSHFVTIRKQLLINELESKEKSSIPITVRQLEAIIRISESLAKLELSSVAEERHV 638

Query: 799 QEAVRLIKSAIKDYAT-DPKTGKIDMNLVQTGKSVIQRKLQEDLAREVVSILGARSNLTI 857
            EA+RL +++  D A+ DP  G  + N+V        R L+ +L R +          + 
Sbjct: 639 DEAIRLFQASTMDAASQDPIGGMQNSNVVSE-----VRNLEAELKRRLP------IGWST 687

Query: 858 SYNELLRSINEQSQDKVEAADISEALVRLQQEDKV 892
           SY  L R   +  +  ++A D   AL  L++ + +
Sbjct: 688 SYQTLKREFVQSGRYSLQALD--RALYVLERHETI 720

>AFR546W [3738] [Homologous to ScYGL201C (MCM6) - SH]
           complement(1415577..1418594) [3018 bp, 1005 aa]
          Length = 1005

 Score =  338 bits (867), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 207/594 (34%), Positives = 310/594 (52%), Gaps = 83/594 (13%)

Query: 275 KFYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVV 334
           + ++I  +NI     +R++    +  L+++ G V R++ + P++  A F C++C   AVV
Sbjct: 267 RIFQISFFNIPVTNRIRDIRAEKVGTLMTISGTVTRTSEVRPELFKASFTCDMC--RAVV 324

Query: 335 EIDRGVIQ--EPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVS 392
           +    V +  EP  CP  +C  Q   TL   R  F D Q +++QE  + +P G  P ++ 
Sbjct: 325 DNVEQVFKFTEPTFCPNPSCENQAFWTLNIGRSRFLDWQRVRIQENSNEIPTGSMPRTLD 384

Query: 393 LCVYDELVDSCRAGDRIEITGIFRSIP---------IRASTTQ----------------R 427
           + +  + V+  + GDR   TG    +P         ++ S+                   
Sbjct: 385 VILRGDCVERAKPGDRCRFTGTEIVMPDVTQLGLAGMKPSSAPDTRGISRTMEGLNSGVS 444

Query: 428 ALKSL------YKTYLDVVHVKKVTND--------------------RLGADTSTVEQEL 461
            LK+L      YK      HV  V N+                      G D +  +QEL
Sbjct: 445 GLKTLGVRDLTYKIAFLACHVMGVGNNSNPQGDVLSHELDVNMLQHLNKGIDDTERDQEL 504

Query: 462 LQNEMNHSDVQEIPQ-ITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQL 520
             N ++  ++ E+ + + DE+I            Y+ L +S+AP++F  + +KKG+LLQ+
Sbjct: 505 FLNSLSSDEINELKEMVKDERI------------YDKLVQSIAPAVFGHETVKKGLLLQM 552

Query: 521 XXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY 580
                       + RGDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GLTA 
Sbjct: 553 LGGVHKTTVEGIKLRGDINICIVGDPSTSKSQFLKYVCAFVPRAVYTSGKASSAAGLTAA 612

Query: 581 ITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITT 640
           + +D +     +E+GAL+L+D G+CCIDEFDKM  S +  +HE MEQQTISIAKAGI  T
Sbjct: 613 VVKDEEGGDFTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHAT 672

Query: 641 LNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHL 700
           LNARTSILA+ANP+G RYN  L +  N+++  P++SRFDL +++LD  ++  D ELA H+
Sbjct: 673 LNARTSILAAANPVGGRYNRKLTLRGNLNMTAPIMSRFDLFFVILDDCNQKVDTELASHI 732

Query: 701 TNLYLE-----DAPTNETDGDVLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRK 755
            NL+++     D P          ++ L  YI YA+  + P++ E A+  LV  Y  +RK
Sbjct: 733 VNLHMKCDDAIDPP--------FTMDQLRRYIKYAR-TFKPILTEDARQFLVEKYKELRK 783

Query: 756 MGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
             D     +     T RQLESMIRL+EA A+      +    V EA  L++ +I
Sbjct: 784 -NDIQGYSKSSYRITVRQLESMIRLSEAIARANCVDEITPAFVAEAYDLLRQSI 836

>Kwal_27.12002
          Length = 833

 Score =  333 bits (855), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 216/587 (36%), Positives = 332/587 (56%), Gaps = 52/587 (8%)

Query: 290 MRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPR 349
           +R++  + +  LI+ +G+V R + + P + V  + C+ C +    E++       A C  
Sbjct: 217 VRQIRGDLLGNLITARGIVTRVSDVKPSVMVNAYTCDQCGYEVFQEVNSRTFTPLAECTS 276

Query: 350 VAC--NQQNSMTLVHNRCS-FADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAG 406
             C  NQ      +  R S F+  Q  K+QE  + VP G  P ++++ +   LV S   G
Sbjct: 277 EQCSQNQTKGQLFMSTRASKFSAFQECKIQEMSEQVPIGHIPRTLTIHINGALVRSLTPG 336

Query: 407 DRIEITGIFRSIPIRASTTQRALKS--LYKTYLDVVHVKKVTNDRLGADTSTVEQELLQN 464
           D +++TGI+   P    T  +ALK+  L +TYL+  +V                      
Sbjct: 337 DVVDVTGIYMPAPY---TGFKALKAGLLTETYLEAQYV---------------------- 371

Query: 465 EMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXX 524
              H       +IT E   ++  IA + DVY  LA+S+AP I+   D+KK +LL L    
Sbjct: 372 -FQHKKKFATFEITPETEARVFNIARQGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGV 430

Query: 525 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRD 584
                   + RGDINI L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA + +D
Sbjct: 431 DKKVGDGMKIRGDINICLMGDPGVAKSQLLKSICKISPRGVYTTGKGSSGVGLTAAVMKD 490

Query: 585 IDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR 644
             T ++VLE GALVLSD G+CCIDEFDKM +  R+ +HEVMEQQTISI+KAGI TTLNAR
Sbjct: 491 PVTDEMVLEGGALVLSDNGICCIDEFDKMDEGDRTAIHEVMEQQTISISKAGINTTLNAR 550

Query: 645 TSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLY 704
           TSILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD  +   D +LA+H+  ++
Sbjct: 551 TSILAAANPLYGRYNPRLSPLENINLPAALLSRFDILFLLLDTPNREDDEKLAEHVAFVH 610

Query: 705 LEDAPTNETDGDVLPVELLTL--YINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRS 762
           + +    + D    P+E   +  +I YAK +  P +  +    +V++Y+ MR+  D  ++
Sbjct: 611 MHN---KQPDLGFEPIEPSDMREFIAYAKTK-RPTMSSEVNEYVVQSYIRMRQ--DSKKA 664

Query: 763 DEKRIT---ATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYATDPKTG 819
            + R +   AT R L ++IRL++  AK+R S  VE+ D++EA+RLI+ + +    + K  
Sbjct: 665 MDSRFSFGQATPRTLLAIIRLSQGLAKLRFSDIVEVDDIEEALRLIQVSKESLYQENKKS 724

Query: 820 KIDMNLVQTGKSVIQRKLQEDLAREVVSILGARSNLTISYNELLRSI 866
           + D N      ++I+     +LAR+     G     ++ Y+ ++R++
Sbjct: 725 REDDNPTTKIYTIIK-----NLARD-----GPHIQQSLPYDLIVRAV 761

>Scas_721.36
          Length = 855

 Score =  333 bits (853), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 205/527 (38%), Positives = 309/527 (58%), Gaps = 42/527 (7%)

Query: 290 MRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPR 349
           +RE+  + + +LI+V+G+V R + + P + V  + C+ C +    E+          C  
Sbjct: 227 VREIKGDFLGQLITVRGIVTRVSDVKPSVLVIAYTCDQCGYEVFQEVHSRTFTPLIDCTS 286

Query: 350 VAC--NQQNSMTLVHNRCS-FADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAG 406
             C  NQ      +  R S F+  Q +K+QE    VP G  P S+S+ V   LV S   G
Sbjct: 287 EECAQNQTKGQLFMSTRASKFSAFQEVKIQELSQQVPVGHIPRSLSIHVNGALVRSMTPG 346

Query: 407 DRIEITGIFRSIPIRASTTQRALKS--LYKTYLDVVHVKKVTNDRLGADTSTVEQELLQN 464
           D ++++GIF   P    T  +ALK+  L +TYL+   V++        D S+  ++    
Sbjct: 347 DIVDVSGIFLPSPY---TGFKALKAGLLTETYLEAQFVRQHKKKFASFDLSSGMED---- 399

Query: 465 EMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXX 524
                              ++  + A+ DVY  +A+S+AP I+   D+KK +LL L    
Sbjct: 400 -------------------RVTEMIAQGDVYNRMAKSIAPEIYGNLDVKKALLLLLVGGV 440

Query: 525 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRD 584
                   + RGDIN+ L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA + +D
Sbjct: 441 DKKVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKD 500

Query: 585 IDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR 644
             T +++LE GALVL+D G+CCIDEFDKM +S R+ +HEVMEQQTISI+KAGI TTLNAR
Sbjct: 501 PVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNAR 560

Query: 645 TSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLY 704
            SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD  +   D +LA+H+  ++
Sbjct: 561 ASILAAANPLYGRYNPRLSPLENINLPAALLSRFDILFLLLDTPNRENDEKLAEHVAYVH 620

Query: 705 LEDAPTNETDGDVLPVELLTL--YINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRS 762
           +  +   + D +  P+E   +  YI +AK +  PV+ E     +++AY+ +R+  D  R 
Sbjct: 621 MHQS---QPDLEFEPIEPARMREYIAFAKSK-RPVMNEAVNEYVIQAYIRLRQ--DSKRE 674

Query: 763 DEKRIT---ATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIK 806
            + + +   AT R L  +IRL++  AK+RLS TV++ DV+EA+RL++
Sbjct: 675 MDSKFSFGQATPRTLLGIIRLSQGLAKLRLSDTVDIDDVEEALRLVR 721

>KLLA0D09262g 780273..782513 similar to sp|P29496 Saccharomyces
           cerevisiae YLR274w CDC46 cell division control protein,
           start by similarity
          Length = 746

 Score =  327 bits (838), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 226/701 (32%), Positives = 362/701 (51%), Gaps = 82/701 (11%)

Query: 154 RIIWGTNVSIQECATNFRNFLMSFKYKFRKTLDGNEDFLNETDDEELYYVKRLNQMREMG 213
           R++ G  +S  E +   ++F  SF  +FR  LD N             Y ++L     + 
Sbjct: 12  RVLAGEELSSNENSEIIKSF-KSFILEFR--LDSN-----------FVYREQLRNNLLVH 57

Query: 214 SLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIMDQTVKDCMVSLVV-----DNNLESG 268
              L+++  +L+ +   E LY +L   P +II + +Q +      +V+     D + E+ 
Sbjct: 58  KYFLDVNTEHLIGY--NEDLYKKLQDEPIDIIPLFEQAITQVAKRIVLLSQDSDIDPETA 115

Query: 269 LDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNIC 328
           L         +   ++E    +R L+ + + K++ + G+++ S+ +          C  C
Sbjct: 116 LSNFPLCQLILNSSSMEIP--LRSLDSDHVSKIVRITGIIISSSVLTSRATQLSLMCRSC 173

Query: 329 DHTAVVEIDRGVIQE------PARCPRVACNQQNSMT---------LVHNRCSFADKQVI 373
            H   ++++            P  C     N+ +            +VH    F D+Q +
Sbjct: 174 KHMTTLKLNNFQNLNNNNVQLPRECLADRSNETDETAASCGPDPYLIVHESSQFIDQQFL 233

Query: 374 KLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIF-----RSIPIRASTTQRA 428
           KLQE P++VP G+ P ++ +     L +    G R+ I GI+     ++  I +S  +  
Sbjct: 234 KLQELPESVPIGELPRNLLMTCDRYLTNQVVPGTRVTIIGIYSIYQSKNKSINSSGNKAV 293

Query: 429 LKSLYKTYLDVVHVKKVTNDRLGADTSTV----EQELLQNEMNHSDVQEIPQITDEQIRK 484
             ++   Y+ V+ +K ++N+ L    S      EQE L+                     
Sbjct: 294 --AIRNPYVKVIGIKHLSNNPLNNSLSMFSESEEQEFLE--------------------- 330

Query: 485 LHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCG 544
              ++ R D+YE+ A S+APSI+   DIKK I+  L            R RGDIN+LL G
Sbjct: 331 ---LSQRPDLYELFANSIAPSIYGNTDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLG 387

Query: 545 DPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGV 604
           DP T+KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+VL+DGGV
Sbjct: 388 DPGTAKSQLLKFVEKVSPISVYTSGKGSSAAGLTASVQRDPTTREFYLEGGAMVLADGGV 447

Query: 605 CCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPV 664
            CIDEFDKM D  R  +HE MEQQTISIAKAGI T LN+RTS+LA+ANP+  RY+     
Sbjct: 448 VCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPVYGRYDDLKSP 507

Query: 665 TENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYL-----EDAPTNETDGDVLP 719
            ENID    +LSRFD++++V D  +E  D ++A H+ N++       D   N    + +P
Sbjct: 508 GENIDFQTTILSRFDMIFIVKDDHNEARDIQIANHVMNIHTGRTQQNDPNDNSNSNNEIP 567

Query: 720 VELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDS--RSDEK-RITATTRQLES 776
           +E +  Y++Y + + AP +  +A T+L   ++T+RK   +S   S+E+  I  T RQLE+
Sbjct: 568 IETMKRYVSYCRLKCAPRLSPEAATKLSSHFITIRKQLQESERHSNERSSIPITVRQLEA 627

Query: 777 MIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYAT-DP 816
           +IR+ E+ AK+ L+     + V EA+RL +++  D A+ DP
Sbjct: 628 IIRITESLAKLELNPVATEKHVDEAIRLFQASTMDAASQDP 668

>Scas_710.21
          Length = 874

 Score =  328 bits (841), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 220/664 (33%), Positives = 339/664 (51%), Gaps = 73/664 (10%)

Query: 191 FLNETDDE--ELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIM 248
           FL E  DE     Y  R+  + EM + +L ++ R+L   KA   L+  L   P+E++ I 
Sbjct: 216 FLLEYTDETGRSVYGARIRTLGEMNAESLEVNYRHLAESKAILALF--LAKCPEEMLKIF 273

Query: 249 DQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLV 308
           D      +V++            I S+ + +R  +  T   +REL  +++  L+ V G+V
Sbjct: 274 D------LVAMEATELHYPDYARIHSEIH-VRISDFPTIHSLRELRESNLSSLVRVTGVV 326

Query: 309 LRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVACNQQNSMTLVHNRCSFA 368
            R T + P +K   F C  C  T +    +   +E      V C  +   T+   +  + 
Sbjct: 327 TRRTGVFPQLKYVKFNCIKCG-TILGPFFQDSNEEIKISYCVNCKSKGPFTVNGEKTVYR 385

Query: 369 DKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRASTTQRA 428
           + Q I LQE+P TVP G+ P    + +  +LVD  + G+ +E+TGI+++     +   + 
Sbjct: 386 NYQRITLQESPGTVPAGRLPRHREVILLADLVDVSKPGEEVEVTGIYKN-NYDGNLNAKN 444

Query: 429 LKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRKLHAI 488
              ++ T L+   VK+    R G   +  E+ L           ++   T+E+ R+   I
Sbjct: 445 GFPVFATILEANSVKR----REGNSANEGEEGL-----------DVFGWTEEEEREFRKI 489

Query: 489 AARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPST 548
           +    + + +  S+APSI+   DIK  +   L              RGDIN+LL GDP T
Sbjct: 490 SRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGT 549

Query: 549 SKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCCID 608
           +KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  TK+  LE GALVL+D GVC ID
Sbjct: 550 AKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLID 609

Query: 609 EFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTENI 668
           EFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP G RYN  +P+ +N+
Sbjct: 610 EFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTIPLAQNV 669

Query: 669 DLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTN---------ETDGD--- 716
            L  P+LSRFD++ +V D VDE  D  LA  + + +L   P N         + DGD   
Sbjct: 670 SLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHLRSHPENIDGNLTGEGQPDGDENM 729

Query: 717 -----------------------------VLPVELLTLYINYAKQQYAPVIIEQAKTELV 747
                                         +P ELL  YI+YA+ +  P + +    ++ 
Sbjct: 730 DGNNEDGVEPLSARQRRLQSQKKKEEEISPIPQELLMKYIHYARTKIHPKLHQMDMDKVS 789

Query: 748 RAYVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKS 807
           R Y  +R+    + S       T R LES++R+AE+ AKMRLS+ V   D+  A++++  
Sbjct: 790 RVYADLRRESISTGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVD 845

Query: 808 AIKD 811
           +  D
Sbjct: 846 SFVD 849

>YBR202W (CDC47) [385] chr2 (625729..628266) Member of MCM/P1 family
           of proteins involved in DNA synthesis initiation [2538
           bp, 845 aa]
          Length = 845

 Score =  324 bits (831), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 213/564 (37%), Positives = 323/564 (57%), Gaps = 50/564 (8%)

Query: 290 MRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPR 349
           +R++  + + +LI+V+G++ R + + P ++V  + C+ C +    E++       + C  
Sbjct: 227 VRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTS 286

Query: 350 VAC--NQQNSMTLVHNRCS-FADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAG 406
             C  NQ      +  R S F+  Q  K+QE    VP G  P S+++ V   LV S   G
Sbjct: 287 EECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPG 346

Query: 407 DRIEITGIFRSIPIRASTTQRALKS--LYKTYLDVV----HVKKVTNDRLGADTSTVEQE 460
           D +++TGIF   P    T  +ALK+  L +TYL+      H KK  +  L   TS VE+ 
Sbjct: 347 DIVDVTGIFLPAPY---TGFKALKAGLLTETYLEAQFVRQHKKKFASFSL---TSDVEER 400

Query: 461 LLQNEMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQL 520
           +++                        +    DVY  LA+S+AP I+   D+KK +LL L
Sbjct: 401 VME------------------------LITSGDVYNRLAKSIAPEIYGNLDVKKALLLLL 436

Query: 521 XXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY 580
                       + RGDIN+ L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA 
Sbjct: 437 VGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAA 496

Query: 581 ITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITT 640
           + +D  T +++LE GALVL+D G+CCIDEFDKM +S R+ +HEVMEQQTISI+KA I T 
Sbjct: 497 VMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAVINTN 556

Query: 641 LNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHL 700
             ARTSILA+ANP+  R NP L   +NI+LP  LLSRFD+++L+LD    + D +LA+H+
Sbjct: 557 PGARTSILAAANPLYGRINPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHV 616

Query: 701 TNLYLEDAPTNETDGDVLPVELLTL--YINYAKQQYAPVIIEQAKTELVRAYVTMRKMGD 758
           T +++ +    + D D  PVE   +  YI YAK +  PV+ E     +V+AY+ +R+  D
Sbjct: 617 TYVHMHN---KQPDLDFTPVEPSKMREYIAYAKTK-RPVMSEAVNDYVVQAYIRLRQ--D 670

Query: 759 DSRSDEKRIT---ATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYATD 815
             R  + + +   AT R L  +IRL++A AK+RL+  V++ DV+EA+RL++ + +    +
Sbjct: 671 SKREMDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVSKESLYQE 730

Query: 816 PKTGKIDMNLVQTGKSVIQRKLQE 839
               K D +      ++I++ LQE
Sbjct: 731 TNKSKEDESPTTKIFTIIKKMLQE 754

>Sklu_2098.4 YBR202W, Contig c2098 6426-8966 reverse complement
          Length = 846

 Score =  323 bits (828), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 212/557 (38%), Positives = 315/557 (56%), Gaps = 44/557 (7%)

Query: 290 MRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPR 349
           +RE+    + +LI+V+G++ R + + P + V  + C+ C      E++         C  
Sbjct: 223 VREIKGRYLGQLITVRGIITRVSDVKPAVLVNAYTCDQCGFEVFQEVNSRTFTPLIECTS 282

Query: 350 VAC--NQQNSMTLVHNRCS-FADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAG 406
             C  NQ      +  R S F+  Q  K+QE    V  G  P ++++ V   LV S   G
Sbjct: 283 EQCSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVRIGHIPRTLTIHVNGSLVRSITPG 342

Query: 407 DRIEITGIFRSIPIRASTTQRALKS--LYKTYLDVVHVKKVTNDRLGADTSTVEQELLQN 464
           D +++TGI+   P    T  +ALK+  L +TYL + +V++                    
Sbjct: 343 DVVDVTGIYLPSPY---TGFKALKAGLLTETYLSMQYVRQ-------------------- 379

Query: 465 EMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXX 524
              H       +IT E    +  IA++ DVY  LA+S+AP I+   D+KK +LL L    
Sbjct: 380 ---HKKKFASFEITPEVESNVMEIASQGDVYNRLAKSIAPEIYGHLDVKKALLLLLVGGV 436

Query: 525 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRD 584
                   + RGDINI L GDP  +KSQ+L+ + KI+PR VYT+GKGSS VGLTA + RD
Sbjct: 437 DKKVGDGMKIRGDINICLMGDPGVAKSQLLKTICKISPRSVYTTGKGSSGVGLTAAVMRD 496

Query: 585 IDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR 644
             T ++VLE GALVL+D G+CCIDEFDKM +  R+ +HEVMEQQTISI+KAGI TTLNAR
Sbjct: 497 PVTDEMVLEGGALVLADNGICCIDEFDKMDEGDRTAIHEVMEQQTISISKAGINTTLNAR 556

Query: 645 TSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLY 704
            SILA+ANP+  RYNP L   +NI+LP  LLSRFD+++L+LD  +   D +LA+H+  ++
Sbjct: 557 ASILAAANPLYGRYNPRLSPLDNINLPAALLSRFDVMFLMLDTPNREDDEKLAEHVAYVH 616

Query: 705 LEDA-PTNETDGDVLPVE--LLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSR 761
           + +  PT     D  P+E   +  +I +AK +  P + ++    LV++Y+ MR+  D  R
Sbjct: 617 MHNKHPT----LDFTPIEPSRMREFIAFAKTK-RPTMGQEVNEYLVQSYIRMRQ--DSKR 669

Query: 762 SDEKRIT---ATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYATDPKT 818
             + + +   AT R L  +IRL++A AK+R S +VE  DV+EA+RLI+ + +    D   
Sbjct: 670 EMDSKFSFGQATPRTLLGVIRLSQALAKLRFSDSVEADDVEEALRLIQVSKESLYQDGNK 729

Query: 819 GKIDMNLVQTGKSVIQR 835
            K D N      ++I++
Sbjct: 730 RKNDENPTTKIYTIIKK 746

>YBL023C (MCM2) [172] chr2 complement(174885..177491) Member of the
           MCM/P1 family that acts as a complex at ARS sequences to
           initiate DNA replication [2607 bp, 868 aa]
          Length = 868

 Score =  320 bits (821), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 217/668 (32%), Positives = 337/668 (50%), Gaps = 81/668 (12%)

Query: 191 FLNETDDE--ELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIM 248
           FL E  DE     Y  R+  + EM S +L ++ R+L   KA   L+  L   P+E++ I 
Sbjct: 214 FLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALF--LAKCPEEMLKIF 271

Query: 249 DQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLV 308
           D      +V++            I S+ + +R  +  T   +REL  +++  L+ V G+V
Sbjct: 272 D------LVAMEATELHYPDYARIHSEIH-VRISDFPTIYSLRELRESNLSSLVRVTGVV 324

Query: 309 LRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVA----CNQQNSMTLVHNR 364
            R T + P +K   F C  C       I     Q+     R++    C  +    +   +
Sbjct: 325 TRRTGVFPQLKYVKFNCLKCG-----SILGPFFQDSNEEIRISFCTNCKSKGPFRVNGEK 379

Query: 365 CSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRAST 424
             + + Q + LQE P TVP G+ P    + +  +LVD  + G+ +E+TGI+++     + 
Sbjct: 380 TVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKN-NYDGNL 438

Query: 425 TQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRK 484
             +    ++ T ++   +K+    R G   +  E+ L           ++   T+E+ R+
Sbjct: 439 NAKNGFPVFATIIEANSIKR----REGNTANEGEEGL-----------DVFSWTEEEERE 483

Query: 485 LHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCG 544
              I+    + + +  S+APSI+   DIK  +   L              RGDIN+LL G
Sbjct: 484 FRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLG 543

Query: 545 DPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGV 604
           DP T+KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  TK+  LE GALVL+D GV
Sbjct: 544 DPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGV 603

Query: 605 CCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPV 664
           C IDEFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP G RYN  LP+
Sbjct: 604 CLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPL 663

Query: 665 TENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNETD--GDVL---- 718
            +N+ L  P+LSRFD++ +V D VDE  D  LA  + + ++   P N+ D  G+ L    
Sbjct: 664 AQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNG 723

Query: 719 -----------------------------------PVELLTLYINYAKQQYAPVIIEQAK 743
                                              P ELL  YI+YA+ +  P + +   
Sbjct: 724 ESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDM 783

Query: 744 TELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVR 803
            ++ R Y  +R+    + S       T R LES++R+AE+ AKMRLS+ V   D+  A++
Sbjct: 784 DKVSRVYADLRRESISTGS----FPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIK 839

Query: 804 LIKSAIKD 811
           ++  +  D
Sbjct: 840 VVVDSFVD 847

>YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/P1
           family, component of the MCM complex that binds at ARS
           elements to initiate DNA replication [2328 bp, 775 aa]
          Length = 775

 Score =  317 bits (812), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 222/730 (30%), Positives = 362/730 (49%), Gaps = 82/730 (11%)

Query: 165 ECATNFRNFLMSFKYKFRKTLDGNEDFLNETDDEELYYVKRLNQMREMGSLNLNLDARNL 224
           E   +F+NF++ F+                  D +  Y  +L     + + +L ++  +L
Sbjct: 26  EIIKSFKNFILEFRL-----------------DSQFIYRDQLRNNILVKNYSLTVNMEHL 68

Query: 225 LSFKATEKLYYQLMSYPQEIISIMDQTVKDCMVSLVV----------DNNLESGLDEIES 274
           + +   E +Y +L   P +II + +  +      + +          D + E+   + +S
Sbjct: 69  IGYN--EDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDS 126

Query: 275 KFYKIRPY------NIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNIC 328
                 P       +   Q  +R+L+   + K++ + G+++ ++ +          C  C
Sbjct: 127 LLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNC 186

Query: 329 DHTAVVEIDR------GVIQEPARCPRV------ACNQQN-------------SMTLVHN 363
            HT  + I+         +  P  C           N+ N                ++H 
Sbjct: 187 RHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHE 246

Query: 364 RCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRAS 423
              F D+Q +KLQE P+ VP G+ P ++++     L +    G R+ I GI+ SI   + 
Sbjct: 247 SSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIY-SI-YNSK 304

Query: 424 TTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIR 483
               + +S        V ++      LG   S VE   + N         +   T+E+  
Sbjct: 305 NGAGSGRSGGGNGGSGVAIRTPYIKILGIQ-SDVETSSIWNS--------VTMFTEEEEE 355

Query: 484 KLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLC 543
           +   ++    +YE+L  S+APSIF  +DIKK I+  L            R RGDIN+LL 
Sbjct: 356 EFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLL 415

Query: 544 GDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGG 603
           GDP T+KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+VL+DGG
Sbjct: 416 GDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGG 475

Query: 604 VCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLP 663
           V CIDEFDKM D  R  +HE MEQQTISIAKAGI T LN+RTS+LA+ANPI  RY+    
Sbjct: 476 VVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKS 535

Query: 664 VTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPT----NETDGDVLP 719
             +NID    +LSRFD++++V D  +E  D  +A H+ N++  +A       E +G  + 
Sbjct: 536 PGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEIS 595

Query: 720 VELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRK---MGDDSRSDEKRITATTRQLES 776
           +E +  YI Y + + AP +  QA  +L   +VT+RK   + +   ++   I  T RQLE+
Sbjct: 596 IEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEA 655

Query: 777 MIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVIQ-R 835
           +IR+ E+ AK+ LS   + + V EA+RL +++  D A+    G ++     +G S+ + R
Sbjct: 656 IIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQ---ASGTSLSEIR 712

Query: 836 KLQEDLAREV 845
           + +++L R +
Sbjct: 713 RFEQELKRRL 722

>CAGL0J04444g 417656..420295 highly similar to sp|P29469
           Saccharomyces cerevisiae YBL023c MCM2, start by
           similarity
          Length = 879

 Score =  317 bits (813), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 213/661 (32%), Positives = 339/661 (51%), Gaps = 74/661 (11%)

Query: 191 FLNETDDE--ELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIM 248
           FL E  DE     Y  R+  + EM S +L ++ R+L   KA   L+  L   P+E++ I 
Sbjct: 231 FLLEYTDETGRSVYGARIRVLGEMNSESLEVNFRHLAESKAILALF--LAKCPEEMLKIF 288

Query: 249 DQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLV 308
           D      +V++            I S+ + +R  +  T   +REL  +++  L+ V G+V
Sbjct: 289 D------LVAMEATELHYPDYSRIHSEIH-VRISDFPTIHNLRELRQSNLSTLVRVTGVV 341

Query: 309 LRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVA----CNQQNSMTLVHNR 364
            R T + P +K   F C  C       I     Q+     +++    C  +   ++   +
Sbjct: 342 TRRTGVFPQLKYVKFNCLKCG-----SILGPFFQDSNEEIKISFCTNCKSKGPFSINGEK 396

Query: 365 CSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRAST 424
             + + Q I LQE P TVP G+ P    + +  +LVD  + G+ IE+TGI+++     + 
Sbjct: 397 TVYRNYQRITLQEAPGTVPAGRLPRHREVILLADLVDVSKPGEEIEVTGIYKN-NYDGNL 455

Query: 425 TQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRK 484
             +    ++ T ++   V++    R G   +  E+ L            +   T+E+ R+
Sbjct: 456 NAKNGFPVFATIIEANAVRR----REGNLANENEEGL-----------NVFSWTEEEERE 500

Query: 485 LHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCG 544
              ++    + + +  S+APSI+   DIK  +   L              RGDIN+L+ G
Sbjct: 501 FRKLSKDRGIVDKIIASMAPSIYGHKDIKTAVACSLFSGVPKNINGKHAIRGDINVLVLG 560

Query: 545 DPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGV 604
           DP T+KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  TK+  LE GALVL+D GV
Sbjct: 561 DPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGV 620

Query: 605 CCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPV 664
           C IDEFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP G RYN  LP+
Sbjct: 621 CLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPL 680

Query: 665 TENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNET----------- 713
           ++N+ L  P+LSRFD++ +V D VDE +D  LA  + + ++   P  ++           
Sbjct: 681 SQNVSLTEPILSRFDILCVVRDVVDEESDERLASFVVDSHVRSHPGYDSIDDEEGKDGEQ 740

Query: 714 --DGDV---------------------LPVELLTLYINYAKQQYAPVIIEQAKTELVRAY 750
             D D+                     +P ELL  YI+YA+ +  P + +    ++ + Y
Sbjct: 741 KNDDDIQLSNRQKRAERQRKKEEEISPIPQELLIKYIHYARTKVYPRLHQMDMDKVSKVY 800

Query: 751 VTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAIK 810
             +R+    + S       T R LES++R+AE+ AKMRLS+ V   D+  A++++  +  
Sbjct: 801 ADLRRESITTGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDSFV 856

Query: 811 D 811
           D
Sbjct: 857 D 857

>KLLA0F12584g complement(1165710..1168343) similar to sp|P29469
           Saccharomyces cerevisiae YBL023c MCM2 member of the
           MCM2P, MCM3P, CDC46P family, start by similarity
          Length = 877

 Score =  316 bits (809), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 215/655 (32%), Positives = 333/655 (50%), Gaps = 71/655 (10%)

Query: 191 FLNETDDE--ELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIM 248
           FL E  DE  +  Y  R+  + EM S +L ++ R+L+  KA   L+  L   P+E++ I 
Sbjct: 224 FLLEYTDESGKSVYGARIRTLGEMNSESLEVNYRHLVESKAILALF--LAKSPEEMLKIF 281

Query: 249 DQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLV 308
           D    +       D         I S+ + +R  +  +   +R L    ++ L+ V G+V
Sbjct: 282 DTVAMEATQLHYPD------YTRIHSEIH-VRISDFPSILNLRALRETHLNSLVRVSGVV 334

Query: 309 LRSTPIIPDMKVAFFKCNICDHT-AVVEIDRGVIQEPARCPRVACNQQNSMTLVHNRCSF 367
            R T + P +K   F C  C  T      D     + + C    C  +    +   +  +
Sbjct: 335 TRRTGVFPQLKYVKFNCLKCGATLGPYYQDSNEEIKISFC--TNCRSKGPFRINMEKTLY 392

Query: 368 ADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRASTTQR 427
            + Q I +QE+P +VP G+ P    + +  +LVD  + G+ +E+TGI+++     +   +
Sbjct: 393 RNYQRITIQESPGSVPAGRLPRHREVILLWDLVDIAKPGEEVEVTGIYKNT-YDGNLNAK 451

Query: 428 ALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRKLHA 487
               ++ T L+   VK+    R G          L +   H  +       DE+ R+   
Sbjct: 452 NGFPVFATVLEANSVKR----REGG---------LHDGDEHEGLDAFSWTEDEE-REFRK 497

Query: 488 IAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPS 547
           ++    + + +  S+APSI+   DIK  I   L              RGDINILL GDP 
Sbjct: 498 MSRDRGIIDKIISSMAPSIYGHRDIKTAIACSLFGGVPKNINGKHSIRGDINILLLGDPG 557

Query: 548 TSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCCI 607
           T+KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  TK+  LE GALVL+D GVC I
Sbjct: 558 TAKSQILKYVEKTANRAVFATGQGASAVGLTASVRKDQITKEWTLEGGALVLADKGVCLI 617

Query: 608 DEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTEN 667
           DEFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SILA+ANPIG RYN  LP+++N
Sbjct: 618 DEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSILAAANPIGGRYNSTLPLSQN 677

Query: 668 IDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLE-------------DAPTNETD 714
           ++L  P+LSRFD++ +V D VDE +D  LA  + + ++              + PT   +
Sbjct: 678 VNLTEPILSRFDILCVVRDLVDEESDNRLASFVVDSHIRSHPDKDLDDFDDGNVPTENPN 737

Query: 715 G-----------------------DVLPV--ELLTLYINYAKQQYAPVIIEQAKTELVRA 749
           G                       ++ P+   +L  YI+YA+ +  P + +    ++ R 
Sbjct: 738 GEGDEETPLSAKQRRLQNLRKREEEISPISQHMLMKYIHYARTKVYPKLHQMDMDKVSRV 797

Query: 750 YVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRL 804
           Y  +R+    + S       T R LES++R+AEA AKMRLS+ V   D+  A+++
Sbjct: 798 YADLRRESVTTGS----FPITVRHLESILRIAEAFAKMRLSEFVSSWDLDRAIKV 848

>AFR178W [3370] [Homologous to ScYBL023C (MCM2) - SH]
           complement(763632..766289) [2658 bp, 885 aa]
          Length = 885

 Score =  316 bits (809), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 211/661 (31%), Positives = 334/661 (50%), Gaps = 85/661 (12%)

Query: 191 FLNETDDE--ELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIM 248
           FL E  DE  +  Y  R+  + E+ S +L ++ R+L   KA   L+  L   P+E++ I 
Sbjct: 233 FLLEYTDEYGKSVYGARIRTLGELNSESLEVNYRHLAESKAILALF--LARCPEEMLKIF 290

Query: 249 DQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLV 308
           D       V++            I S+ + +R  +  T   +REL   +++ L+ V G+V
Sbjct: 291 D------TVAMEATQLHYPEYTRIHSEIH-VRISDFPTIHNLRELREANLNSLVRVTGVV 343

Query: 309 LRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEP-----------ARCPRVACNQQNS 357
            R T + P +K   F C  C          G I  P           + C    C  +  
Sbjct: 344 TRRTGVFPQLKYVKFNCLKC----------GSILGPYYQDSNEEIKISFC--TNCRSKGP 391

Query: 358 MTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRS 417
                 +  + + Q + LQE+P TVP G+ P    + +  +LVD  + G+ +E+TGI+++
Sbjct: 392 FRTNMEKTLYRNYQRLTLQESPGTVPAGRLPRHREVILLWDLVDVAKPGEEVEVTGIYKN 451

Query: 418 IPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQI 477
                +   R    ++ T L+   +K+        D +  E              ++   
Sbjct: 452 T-YDGNLNARNGFPVFATVLEANSIKRREGGLHSGDDAGDEG------------LDVFGW 498

Query: 478 TDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGD 537
           T+E+ R+   ++    + + +  S+APSI+   DIK  +   L              RGD
Sbjct: 499 TEEEEREFRKMSRDRGIIDKIISSIAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGD 558

Query: 538 INILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGAL 597
           IN+LL GDP T+KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  TK+  LE GAL
Sbjct: 559 INVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGAL 618

Query: 598 VLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSR 657
           VL+D GVC IDEFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP G R
Sbjct: 619 VLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGR 678

Query: 658 YNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTN------ 711
           YN  LP+++N+DL  P+LSRFD++ +V D VDE +D  LA  + + ++   P +      
Sbjct: 679 YNSTLPLSQNVDLTEPILSRFDILCVVRDLVDEESDERLATFVVDSHIRSHPESDIHQEP 738

Query: 712 --------------------------ETDGDVLPV--ELLTLYINYAKQQYAPVIIEQAK 743
                                     + +G++ P+  E+L  YI+YA+ +  P + +   
Sbjct: 739 ADEDMEEADAGTAALSNRQKKLKRHRDKEGEISPIPQEVLMKYIHYARTKVNPKLHQMDM 798

Query: 744 TELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVR 803
            ++ + Y  +R+    + S       T R LES++R+AE+ AKMRLS+ V   D+  A++
Sbjct: 799 GKVSKVYADLRRESITTGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIK 854

Query: 804 L 804
           +
Sbjct: 855 V 855

>Sklu_1863.1 YEL032W, Contig c1863 2885-5749
          Length = 954

 Score =  317 bits (812), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 202/587 (34%), Positives = 309/587 (52%), Gaps = 90/587 (15%)

Query: 291 RELNPNDIDKLISVKGLVLRSTPIIPDM--------KVAFFKCNICDHTAVVEIDRGVIQ 342
           R LN + ++KLIS++G+V +++ + P +        K   F     D+          I 
Sbjct: 143 RTLNSHHLNKLISIEGIVTKTSLVRPKLIRSVHYADKTGRFHYR--DYRDATTTLTTQIP 200

Query: 343 EPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDS 402
            PA  P     + N +T  +   ++ D Q I +QE P+  P GQ P S+ + + ++LVD 
Sbjct: 201 TPAIYP-TEDPEGNKLTTEYGYSTYIDHQRITVQEMPEKAPPGQLPRSIDVILDEDLVDK 259

Query: 403 CRAGDRIEITGIFRSIPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELL 462
            + GDRI I G++              KS+    L+    K+ +N   G  T  +   + 
Sbjct: 260 TKPGDRINIVGVY--------------KSMGAGGLNGAATKEQSNALSGFRTLILGNTVY 305

Query: 463 QNEMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXX 522
                 + V     ++D  IR ++ ++ + D++E++++S+APSI+  + IKK ILL L  
Sbjct: 306 PLHARSTGVSAKQNLSDSDIRNINKLSKKSDIFEMMSQSLAPSIYGHEQIKKAILLMLLG 365

Query: 523 XXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYIT 582
                       RGDIN+L+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA +T
Sbjct: 366 GVEKNLENGSHLRGDINLLMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVT 425

Query: 583 RDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLN 642
            D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVMEQQT++IAKAGI TTLN
Sbjct: 426 MDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTTLN 485

Query: 643 ARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKH--- 699
           AR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D ++E  DR +++H   
Sbjct: 486 ARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRAISEHVLR 545

Query: 700 ----LTNLYLEDAPTNET------------------------------------------ 713
               L   YLE  P  E                                           
Sbjct: 546 THRYLPPGYLEGEPIREAINLSLAVGDDDIEQMQDDEDDDEEGGKVFEKFNPLLHAGAKL 605

Query: 714 -------DGDVLP----VELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRS 762
                   G  +P    +  L  Y+ YAK++ APV+ ++A   +V+ Y  +R   +DS +
Sbjct: 606 AKNRGNHHGSEIPQIVCIPFLRKYVQYAKERIAPVLTQEAIDVIVKTYSDLR---NDSNT 662

Query: 763 DEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
            +  ITA  R LE++IRL+ AHAK+RLS+ VE QD + A  L++ A+
Sbjct: 663 KKSPITA--RTLETLIRLSSAHAKVRLSKIVERQDSRVAANLLRFAL 707

>Kwal_27.10174
          Length = 945

 Score =  315 bits (806), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 203/591 (34%), Positives = 305/591 (51%), Gaps = 98/591 (16%)

Query: 291 RELNPNDIDKLISVKGLVLRSTPIIPDM--------KVAFFKCNICDHTAVVEIDRGVIQ 342
           R LN + ++KL+S++G+V + + + P +        K   F            I +  I 
Sbjct: 137 RTLNSHYLNKLLSIEGIVTKVSLVRPKLLRSVHYAEKTGRFHYRDYRDATTTLITQ--IP 194

Query: 343 EPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDS 402
            PA  P     + N +T  +   ++ D Q I +QE P+  P GQ P S+ + + ++LVD 
Sbjct: 195 TPAIYP-TEDPEGNKLTTEYGYSTYIDHQRITVQEMPEKAPPGQLPRSIDVIMDEDLVDK 253

Query: 403 CRAGDRIEITGIFRSIPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELL 462
            + GDRI I GI                  YK+          +++  G+  S     +L
Sbjct: 254 TKPGDRINIVGI------------------YKSLGGGGLSSSGSSNDQGSSLSGFRTMVL 295

Query: 463 QN-----EMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGIL 517
            N         + V     +TD  IR ++ ++ +DD++++L++S+APSI+  D IKK IL
Sbjct: 296 ANTAYPLHARSTGVAARQALTDSDIRNINKLSKKDDIFDLLSQSLAPSIYGHDHIKKAIL 355

Query: 518 LQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGL 577
           L L              RGDIN+L+ GDPST+KSQ+L++V   A   + T+G+GSS VGL
Sbjct: 356 LMLMGGVEKNLENGSHLRGDINLLMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGL 415

Query: 578 TAYITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGI 637
           TA +T D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVMEQQT++IAKAGI
Sbjct: 416 TAAVTMDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGI 475

Query: 638 ITTLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELA 697
            TTLNAR S++A+ANP+  +Y+ N     NI LP  LLSRFDL+++V D ++ENTDR ++
Sbjct: 476 HTTLNARCSVIAAANPVFGQYDLNKDPHYNIALPDSLLSRFDLLFVVTDDINENTDRAIS 535

Query: 698 KH-------LTNLYLEDAPTNET------------------------------------- 713
           +H       L   YLE  P  E                                      
Sbjct: 536 EHVLRTHRYLPPGYLEGEPIGEAINLSLSVGDDNGFANEEEDDDDDEGKVFEKFNPLLHA 595

Query: 714 -----------DGDVLP----VELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGD 758
                       G  LP    +  L  Y+ YAK++  P++ ++A   +VR Y  +R    
Sbjct: 596 GAKLARNKGNRQGTELPQIVSIPFLRKYVQYAKERVVPMLSQEAVNIVVRTYTELR---- 651

Query: 759 DSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
            +  + K+   T R LE++IRLA AHAK+RLS+TV+ +D + A  L++ A+
Sbjct: 652 -NDQNTKKSPITPRTLETLIRLASAHAKVRLSKTVDREDARVAAHLLRFAL 701

>KLLA0E22330g 1981275..1984070 similar to sp|P24279 Saccharomyces
           cerevisiae YEL032w MCM3 replication initiation protein,
           start by similarity
          Length = 931

 Score =  307 bits (787), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 197/584 (33%), Positives = 305/584 (52%), Gaps = 87/584 (14%)

Query: 291 RELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRV 350
           R LN   ++KLISV+G+V R++ + P +  +        H    +            P  
Sbjct: 148 RTLNSTHLNKLISVEGIVTRTSLVRPKLLRSVHYAQTTGHHHYRDYRDATTTLTTSVPTP 207

Query: 351 AC-----NQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRA 405
           A       + N +   +  C + D Q I +QE P+  P GQ P S+ + + D+LVD  + 
Sbjct: 208 AIYPEEDQEGNKLVTEYGFCHYMDHQRITVQEMPEKAPPGQLPRSIDVILDDDLVDKTKP 267

Query: 406 GDRIEITGIFRSIPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNE 465
           GDRI I G+++S+     T                      ND+     S     ++ N 
Sbjct: 268 GDRINIVGVYKSLGAGGLTG-----------------GSNNNDKGNGALSGFRTVVIGNT 310

Query: 466 M-----NHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQL 520
           +       + V  +  ++D  IR ++ ++  D++++ L++S+APSI+  + IKK ILL L
Sbjct: 311 VYPLHARSTGVSAVETLSDNDIRNINKLSMHDNIFDTLSQSLAPSIYGHEHIKKAILLML 370

Query: 521 XXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY 580
                         RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA 
Sbjct: 371 MGGVEKNLPNGSHLRGDINILMVGDPSTAKSQMLRFVLNTAALAIATTGRGSSGVGLTAA 430

Query: 581 ITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITT 640
           +T D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVMEQQT++IAKAGI TT
Sbjct: 431 VTTDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTT 490

Query: 641 LNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKH- 699
           LNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +++  DR +++H 
Sbjct: 491 LNARCSVIAAANPVFGQYDVNKDPHKNIALPDSLLSRFDLLFVVTDDINDIRDRAISEHV 550

Query: 700 ------LTNLYLEDAPTNE----------------------------------------- 712
                 L   YLE  P  E                                         
Sbjct: 551 LRTHRYLPPGYLEGEPVREQINLSLAVGEDIENEEEDDDEDVVFEKFNPLLHAGAKLAKN 610

Query: 713 ---TDGDVLP----VELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRSDEK 765
              ++G  LP    +  +  YI YAK++  P + ++A   ++++Y  +R   +D  + + 
Sbjct: 611 RGDSNGSELPQIVAIPFIRKYIQYAKERIIPQLTQEAVDVIIKSYSNLR---NDQNTKKS 667

Query: 766 RITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
            ITA  R LE++IRL+ AHAK+RLS+ VEL+D + A +L++ A+
Sbjct: 668 PITA--RTLETLIRLSSAHAKVRLSKKVELEDAKVATQLLRFAL 709

>Kwal_14.2090
          Length = 860

 Score =  305 bits (780), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 208/664 (31%), Positives = 324/664 (48%), Gaps = 90/664 (13%)

Query: 191 FLNETDDE--ELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIM 248
           FL E  DE     Y  R+  + E+ S +L ++ R+L   KA   L+  L   P+E++ I 
Sbjct: 204 FLLEYTDEWGRSVYGARIRTLGELNSESLEVNYRHLAESKAILALF--LAKCPEEMLKIF 261

Query: 249 DQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLV 308
           D    D       D         I ++ + +R  +  T   +REL  ++++ L+ V G+V
Sbjct: 262 DIVAMDATQLHYPD------YARIHAEIH-VRISDFPTVLNLRELRESNLNSLVRVTGVV 314

Query: 309 LRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEP-----------ARCPRVACNQQNS 357
            R T + P +K   F C  C          G +  P           + C    C  +  
Sbjct: 315 TRRTGVFPQLKYVKFNCLKC----------GAVLGPYFQDSNEEIKISFC--TNCRSKGP 362

Query: 358 MTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRS 417
                 +  + + Q + LQE P TVP G+ P    + +  +LVD  + G+ IE+TGI+++
Sbjct: 363 FRTNAEKTLYRNYQRLTLQEAPGTVPAGRLPRHREVILLWDLVDIAKPGEEIEVTGIYKN 422

Query: 418 IPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQI 477
                       ++ +  +  ++    V     G  +   E+ L           ++   
Sbjct: 423 ----TYDGNLNARNGFPVFATIIEANAVRRREGGRRSGDDEEGL-----------DVFGW 467

Query: 478 TDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGD 537
           T+E+ R+   ++    + + +  S+APSI+   DIK  +   L              RGD
Sbjct: 468 TEEEEREFRKLSRDRGIIDKVISSIAPSIYGHKDIKTAVACALFSGVPKNVNGKHSIRGD 527

Query: 538 INILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGAL 597
           IN+LL GDP T+KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  T++  LE GAL
Sbjct: 528 INVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITREWTLEGGAL 587

Query: 598 VLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSR 657
           VL+D GVC IDEFDKM+D  R+ +HE MEQQ ISI+KAGI+T+L AR SI+A+ANP G R
Sbjct: 588 VLADKGVCLIDEFDKMNDQDRTSIHEAMEQQNISISKAGIVTSLQARCSIIAAANPNGGR 647

Query: 658 YNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTN------ 711
           YN  LP+ +N+DL  P+LSRFD++ +V D VDE  D  LA+ + + +L   P +      
Sbjct: 648 YNSALPLAQNVDLTEPILSRFDILCVVRDLVDEVKDERLARFVVDSHLRSHPLHDRLDDG 707

Query: 712 -------------------------------ETDGDVLPVELLTLYINYAKQQYAPVIIE 740
                                          E +   +P E L  YI YA+ +  P + +
Sbjct: 708 DDDDGDNDAMNEDANEPLSARQRRQQKDREREEEISPIPQETLMKYIQYARTRVFPKLHQ 767

Query: 741 QAKTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQE 800
               ++ R Y  +R+    + S       T R LES++R++E+ AKMRLS+ V   D+  
Sbjct: 768 MDMDKVSRVYADLRRESITTGS----FPITVRHLESILRISESFAKMRLSEFVSSWDLDR 823

Query: 801 AVRL 804
           A+++
Sbjct: 824 AIKV 827

>Sklu_2087.4 YBL023C, Contig c2087 7202-9856
          Length = 884

 Score =  305 bits (780), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 210/662 (31%), Positives = 336/662 (50%), Gaps = 79/662 (11%)

Query: 191 FLNETDDE--ELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIM 248
           FL E  DE  +  Y  R+  + E+ S +L ++ R+L   KA   L+  L   P+E++ I 
Sbjct: 222 FLLEYTDESGKSVYGARIRTLGEVNSESLEVNYRHLAESKAILALF--LAKCPEEMLKIF 279

Query: 249 DQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGLV 308
           D      +V++            I S+ + +R  +  T   +REL  ++++ L+ V G+V
Sbjct: 280 D------LVAMEATELHYPDYSRIHSEIH-VRISDFPTVHNLRELRESNLNSLVRVTGVV 332

Query: 309 LRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVA----CNQQNSMTLVHNR 364
            R T + P +K   F C  C       I     Q+     +++    C  +        +
Sbjct: 333 TRRTGVFPQLKYVKFNCLKCG-----SILGPFFQDSNEEVKISFCTNCRSKGPFRTNAEK 387

Query: 365 CSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRAST 424
             + + Q I LQE P TVP G+ P    + +  +LVD  + G+ +E+TG++++     + 
Sbjct: 388 TLYRNYQRITLQEAPGTVPAGRLPRHREVILLWDLVDVAKPGEEVEVTGVYKNT-YDGNL 446

Query: 425 TQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRK 484
             +    ++ T ++   +K+    R+ ++ S  ++E L            P    E+  +
Sbjct: 447 NAKNGFPVFATVIEANSIKRREGGRI-SNESIEDEEGLD-----------PFSWTEEEER 494

Query: 485 LHAIAARD-DVYEVLARSVAPSIFELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLC 543
                +RD  + + +  S+APSI+   DIK  +   L              RGDIN+LL 
Sbjct: 495 EFRRMSRDRAIIDKIISSMAPSIYGHKDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLL 554

Query: 544 GDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGG 603
           GDP T+KSQIL+Y+ K A R V+ +G+G+SAVGLTA + +D  T++  LE GALVL+D G
Sbjct: 555 GDPGTAKSQILKYIEKTAHRAVFATGQGASAVGLTASVRKDPITREWTLEGGALVLADKG 614

Query: 604 VCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLP 663
           VC IDEFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP G RYN  LP
Sbjct: 615 VCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLP 674

Query: 664 VTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTN------------ 711
           + +N+DL  P+LSRFD++ +V D VDE  D  LA  + + ++   P +            
Sbjct: 675 LAQNVDLTEPILSRFDILCVVRDLVDEEADERLATFVVSSHVRSHPDSDRLREDPQDDDL 734

Query: 712 ---------------------------ETDGDVLPVELLTL--YINYAKQQYAPVIIEQA 742
                                      E +G++ P+   TL  YI+YA+ +  P + +  
Sbjct: 735 DQQTEDEREDDEPAPMSARQKRLQRQREKEGEISPIPQDTLMKYIHYARIKIYPKLHQMD 794

Query: 743 KTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAV 802
             ++ R Y  +R+    + S       T R LES++R+AE+ AKMRLS+ V   D+  A+
Sbjct: 795 MDKVSRVYADLRRESITTGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAI 850

Query: 803 RL 804
           ++
Sbjct: 851 KV 852

>YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1
           family, part of the MCM complex that assembles at ARS
           elements to initiate replication [2916 bp, 971 aa]
          Length = 971

 Score =  298 bits (763), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 200/593 (33%), Positives = 301/593 (50%), Gaps = 98/593 (16%)

Query: 291 RELNPNDIDKLISVKGLVLRSTPIIPDM------KVAFFKCNICDHTAVVEIDRGVIQEP 344
           R L    ++KL+SV+G+V +++ + P +           + +  D+T         I  P
Sbjct: 169 RTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTP 228

Query: 345 ARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCR 404
           A  P     + N +T  +   +F D Q I +QE P+  P GQ P S+ + + D+LVD  +
Sbjct: 229 AIYP-TEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTK 287

Query: 405 AGDRIEITGIFRSIPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQN 464
            GDR+ + G+F+S+                           +N  +G  T  +   +   
Sbjct: 288 PGDRVNVVGVFKSLGAGGMNQSN------------------SNTLIGFKTLILGNTVYPL 329

Query: 465 EMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLXXXX 524
               + V     +TD  IR ++ ++ + D++++L++S+APSI+  D IKK ILL L    
Sbjct: 330 HARSTGVAARQMLTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGV 389

Query: 525 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRD 584
                     RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA +T D
Sbjct: 390 EKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTD 449

Query: 585 IDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR 644
            +T +  LE+GA+VL+D GV CIDEFDKM+D  R  +HEVMEQQT++IAKAGI TTLNAR
Sbjct: 450 RETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNAR 509

Query: 645 TSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKH----- 699
            S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D ++E  DR +++H     
Sbjct: 510 CSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTH 569

Query: 700 --LTNLYLEDAPTNE---------TDGDVLPVE--------------------------- 721
             L   YLE  P  E          D D+ P E                           
Sbjct: 570 RYLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLL 629

Query: 722 -------------------------LLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKM 756
                                     L  Y+ YAK++  P + ++A   +V+ Y  +R  
Sbjct: 630 QAGAKLAKNKGNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRN- 688

Query: 757 GDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
            DD   + K+   T R LE++IRLA AHAK+RLS+TV   D + A  L++ A+
Sbjct: 689 -DD---NTKKSPITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFAL 737

>Scas_499.2
          Length = 985

 Score =  295 bits (755), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 203/593 (34%), Positives = 301/593 (50%), Gaps = 98/593 (16%)

Query: 291 RELNPNDIDKLISVKGLVLRSTPIIPDM--------KVAFFKCNICDHTAVVEIDRGVIQ 342
           R LN   ++KLIS++G+V R++ + P +        K   F     D+T         I 
Sbjct: 177 RTLNSQFLNKLISIEGIVTRTSLVRPKLIRSVHYAEKTGRFHYR--DYTDATTTLTTKIP 234

Query: 343 EPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDS 402
            PA  P       N +   +   +F D Q I +QE P+  P GQ P S+ + + D+LVD 
Sbjct: 235 TPAIYP-TEDTDGNKLITEYGYSTFVDHQRITIQEMPEMAPAGQLPRSIDVILDDDLVDK 293

Query: 403 CRAGDRIEITGIFRSIPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELL 462
            + GDR+ + G+F+S+                                GA  S     ++
Sbjct: 294 TKPGDRVNVIGVFKSLGAGGLNNGGNGGGADS----------------GASMSGFRTLII 337

Query: 463 QNEM-----NHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGIL 517
            N +       + V     +TD  IR ++ ++ + D+++VLA+S+APSI+  + IK+ IL
Sbjct: 338 GNTVYPLHARSTGVSARQTLTDFDIRNINKLSKKKDIFDVLAQSLAPSIYGHEHIKRAIL 397

Query: 518 LQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGL 577
           L L              RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGL
Sbjct: 398 LMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGL 457

Query: 578 TAYITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGI 637
           TA +T D +T +  LE+GA+VL+D GV CIDEFDKM+D  R  +HEVMEQQT++IAKAGI
Sbjct: 458 TAAVTNDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGI 517

Query: 638 ITTLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELA 697
            TTLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D ++E  DR ++
Sbjct: 518 HTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSIS 577

Query: 698 KH-------LTNLYLEDAPTNET------------------------------------- 713
           +H       L   YLE  P  E                                      
Sbjct: 578 EHVLRTHRYLPPGYLEGEPIRERLNLSLAVGVDDNINEENKDGGEEDEEDQVFEKFNPLL 637

Query: 714 -------------DGDVLP----VELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKM 756
                        +G  +P    +  L  Y+ YAK++  P + +QA   +V+ Y  +R  
Sbjct: 638 QAGAKLAKNKGNHNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQQAIDVIVKNYADLR-- 695

Query: 757 GDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
            +D  + +  ITA  R LE++IRLA AHAK+RLS+TV  +D   A  L++ A+
Sbjct: 696 -NDENTKKSPITA--RTLETLIRLATAHAKVRLSKTVNKRDANVAAGLLRYAL 745

>AFR355C [3547] [Homologous to ScYEL032W (MCM3) - SH]
           (1082128..1084959) [2832 bp, 943 aa]
          Length = 943

 Score =  291 bits (744), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 199/588 (33%), Positives = 305/588 (51%), Gaps = 93/588 (15%)

Query: 291 RELNPNDIDKLISVKGLVLRSTPIIPDM-KVAFFKCNICDH----------TAVVEIDRG 339
           R L    +++L+S++G+V R++ + P + +      N   H          T V E+   
Sbjct: 138 RTLMATHLNQLVSIEGIVTRTSIVRPKLLRSVHLSKNTGAHYYRDYRDATTTLVTEV--- 194

Query: 340 VIQEPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDEL 399
               PA  P  A  + N +   +   ++ D Q + +QE P+  P GQ P SV + + D+L
Sbjct: 195 --PTPAIYPE-ADPEGNPLNTEYGYSTYMDHQRVTVQEMPEKAPPGQLPRSVDVILDDDL 251

Query: 400 VDSCRAGDRIEITGIFRSIPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQ 459
           VD  + GDR+ I G+F+SI     +   +                  N   G  T  +  
Sbjct: 252 VDKTKPGDRVNIVGVFKSIGAGGMSGGSS-------------SDHGNNGLAGFKTLIIGN 298

Query: 460 ELLQNEMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQ 519
            +       + V    +++D  IR ++ +A   DV+++LA+S+APSI+  + IKK +LL 
Sbjct: 299 TVYPLHARSTGVAASERLSDTDIRNINKLAKSADVFDLLAQSLAPSIYGHEHIKKAVLLM 358

Query: 520 LXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTA 579
           L              RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA
Sbjct: 359 LMGGVEKNLENGSHLRGDINILMVGDPSTAKSQMLRFVLNTAALAIATTGRGSSGVGLTA 418

Query: 580 YITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIIT 639
            +T D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVMEQQT++IAKAGI T
Sbjct: 419 AVTMDRETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHT 478

Query: 640 TLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKH 699
           TLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +++  DR +++H
Sbjct: 479 TLNARCSVIAAANPVFGQYDVNKDPHKNIALPDSLLSRFDLLFVVTDDINDVRDRAISEH 538

Query: 700 -------LTNLYLEDAPTNE---------TDG---------------------------- 715
                  L   Y+E  P  E         TDG                            
Sbjct: 539 VLRTHRYLPPGYMEGEPIREAINLSLSVGTDGVSIDPDADDDTTDKVFEKYDPLLHAGAK 598

Query: 716 --------------DVLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSR 761
                          V+ +  +  Y+ YAK++  PV+ + A   +V+ Y  +R   +D  
Sbjct: 599 LAKNRGDHRGAELPKVVSIPFIRKYVQYAKERIVPVLTQDAVNIIVKTYCDLR---NDQN 655

Query: 762 SDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
           + +  ITA  R LE++IRL+ AHAK+RLS+ VE +D   A +L++ A+
Sbjct: 656 TKKSPITA--RTLETLIRLSNAHAKVRLSKLVEARDANVAAQLLRFAL 701

>CAGL0L01397g 152718..155555 highly similar to sp|P24279
           Saccharomyces cerevisiae YEL032w MCM3 replication
           initiation protein, hypothetical start
          Length = 945

 Score =  278 bits (712), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 201/651 (30%), Positives = 331/651 (50%), Gaps = 103/651 (15%)

Query: 232 KLYYQLMSYPQEIISIMDQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQK--G 289
           K +  +++ P   I   ++ + +   +L  D++  + +D + +K    RP+ +  +   G
Sbjct: 102 KFWRGVLNEPAYYIPPAERALSEIATAL--DDSPRNTVDAVSAK----RPWRLSFKGSFG 155

Query: 290 MRELNPNDID-----KLISVKGLVLRSTPIIPD-MKVAFF-----KCNICDHTAVVEIDR 338
              L+P  ++     KL+S++G+V +++ + P  M+   +     + +  D+T       
Sbjct: 156 SHTLSPGTLNAMYLNKLVSIEGIVTKTSLVRPKLMRSVHYAEKTGRFHYRDYTDSTTSLT 215

Query: 339 GVIQEPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDE 398
             +  PA  P       N +T  +   ++ D Q I +QE P+    G  P SV + + D+
Sbjct: 216 TRVPTPAIYP-TEDPDGNKLTTEYGFSTYIDHQRITVQEMPEMAQVGPVPRSVDIILDDD 274

Query: 399 LVDSCRAGDRIEITGIFRSIPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVE 458
           LVD  + GDRI + G+F+S+                        +  +N   G  T  + 
Sbjct: 275 LVDKTKPGDRINVVGVFKSVGAGGLN------------------QGESNTLNGFRTLIIG 316

Query: 459 QELLQNEMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILL 518
             +       + V     + D  IR ++ ++ R D++E+LA+S+APSI+  ++IK+ +LL
Sbjct: 317 NSVYPLHARSTGVSAKETLNDLDIRNINKLSKRGDIFEILAQSLAPSIYGHENIKRAVLL 376

Query: 519 QLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLT 578
            L              RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLT
Sbjct: 377 MLFGGVEKNLENGSHLRGDINILMVGDPSTAKSQMLRFVLNTASLAIATTGRGSSGVGLT 436

Query: 579 AYITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGII 638
           A +T D +T +  LE+GA+VL+D G+ CIDEFDKM+D  R  +HEVMEQQT++IAKAGI 
Sbjct: 437 AAVTTDRETGERRLEAGAMVLADRGIVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIH 496

Query: 639 TTLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELA- 697
           TTLN+R S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D ++E  DR ++ 
Sbjct: 497 TTLNSRCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEARDRSISE 556

Query: 698 ------KHLTNLYLEDAP------------TNETD------------------------- 714
                 ++L+   +E  P            T+E D                         
Sbjct: 557 HVLRTHRYLSPGMVEGEPVRDRLNLSLAVGTDEDDENANDNTNQDEEDQVFEKFNPLLQA 616

Query: 715 ------------GDVLP----VELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGD 758
                       G  +P    +  L  Y+ YAK++  P +  +A   +V+ Y  +R   +
Sbjct: 617 GAMLAKNRGNYNGTEIPKLVKISFLRKYVQYAKERVVPQLTTEAVDVIVKNYTDLR---N 673

Query: 759 DSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAI 809
           D  + +  ITA  R LE++IRLA AHAK+RLS+TV+  D   A  L++ ++
Sbjct: 674 DENTKKSPITA--RTLETLIRLATAHAKVRLSRTVDKVDATVAANLLRFSL 722

>KLLA0E14278g complement(1260247..1261668) similar to sp|P43635
           Saccharomyces cerevisiae YPR001w CIT3 citrate
           (si)-synthase, mitochondrial, start by similarity
          Length = 473

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 15/121 (12%)

Query: 764 EKRITATTRQLESMIRLAEAHAKMRLSQ---------TVELQDVQEAVRLIKSAIKDYAT 814
           EK +T+  R +  M +LA A A M             ++   D  E V   +  +   A 
Sbjct: 144 EKLLTSLPRDMHPMTQLAIALASMNKGSIFAEKYQEGSIGKMDYWEYV--YEDVLNLIAA 201

Query: 815 DPK-TGKIDMNLVQTGKSVIQRKLQEDLAREVVSILGARSNLTISYNELLRSINEQSQDK 873
            PK TGKI  N+V  G+ +    +++D +  + S+LG   + +++ + L +   E+S D 
Sbjct: 202 LPKITGKIYSNIVNDGEPLGHYNVEKDWSYNIASLLGMTVSDSVNMHSLTQ---ERSNDF 258

Query: 874 V 874
           V
Sbjct: 259 V 259

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,023,540
Number of extensions: 1101991
Number of successful extensions: 4303
Number of sequences better than 10.0: 60
Number of HSP's gapped: 4345
Number of HSP's successfully gapped: 77
Length of query: 897
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 786
Effective length of database: 12,753,511
Effective search space: 10024259646
Effective search space used: 10024259646
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)