Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.205773372238000.0
Sklu_2225.679775214310.0
KLLA0E09790g74675211971e-154
YER001W (MNN1)76271510971e-139
Kwal_23.29265685536928e-82
AAR183C6484595603e-62
KLLA0D13376g6636135561e-61
CAGL0C04048g6206885419e-60
Kwal_55.209846195785392e-59
YIL014W (MNT3)6305575365e-59
Scas_717.56395495349e-59
Kwal_55.222385843725047e-55
AEL345W6455084927e-53
CAGL0C04004g6325094891e-52
YGL257C (MNT2)5584604833e-52
CAGL0C03982g6295594821e-51
YNR059W (MNT4)5805084571e-48
Kwal_23.54545834304562e-48
CAGL0C03938g6374954573e-48
CAGL0H09240g6425104565e-48
ABR245C6414764557e-48
CAGL0C03916g6285344362e-45
Scas_643.196575004311e-44
CAGL0C03960g6236214282e-44
CAGL0H09262g6254434212e-43
CAGL0C04026g6365054025e-41
AFL235W3813813862e-40
CAGL0G04279g6605463682e-36
CAGL0C03894g6274623662e-36
ADR020C6045143282e-31
CAGL0B03003g3403142737e-26
KLLA0A11880g4232262697e-25
KLLA0A11891g2021941612e-12
CAGL0B02992g3753361442e-09
Kwal_27.1145649687890.012
KLLA0C16467g607290860.034
YBR015C (MNN2)597155810.12
CAGL0I04532g612140750.63
Scas_716.77608274750.72
CAGL0G09867g64437712.0
YJL186W (MNN5)586142675.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.2057
         (722 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.2057                                                         1468   0.0  
Sklu_2225.6 YER001W, Contig c2225 7299-9692                           555   0.0  
KLLA0E09790g 867899..870139 similar to sp|P39106 Saccharomyces c...   465   e-154
YER001W (MNN1) [1423] chr5 (153519..155807) Alpha-1,3-mannosyltr...   427   e-139
Kwal_23.2926                                                          271   8e-82
AAR183C [371] [Homologous to ScYIL014W (MNT3) - NSH] (672091..67...   220   3e-62
KLLA0D13376g 1150858..1152849 some similarities with sp|P40549 S...   218   1e-61
CAGL0C04048g complement(399734..401596) similar to sp|P40549 Sac...   213   9e-60
Kwal_55.20984                                                         212   2e-59
YIL014W (MNT3) [2651] chr9 (326101..327993) Mannosyltransferase ...   211   5e-59
Scas_717.5                                                            210   9e-59
Kwal_55.22238                                                         198   7e-55
AEL345W [2160] [Homologous to ScYIL014W (MNT3) - NSH] complement...   194   7e-53
CAGL0C04004g complement(394614..396512) similar to sp|P40549 Sac...   192   1e-52
YGL257C (MNT2) [1743] chr7 complement(12481..14157) Mannosyltran...   190   3e-52
CAGL0C03982g complement(391909..393798) similar to sp|P40549 Sac...   190   1e-51
YNR059W (MNT4) [4642] chr14 (736800..738542) Protein with strong...   180   1e-48
Kwal_23.5454                                                          180   2e-48
CAGL0C03938g complement(386673..388586) weakly similar to sp|P40...   180   3e-48
CAGL0H09240g complement(905670..907598) some similarities with s...   180   5e-48
ABR245C [839] [Homologous to ScYIL014W (MNT3) - NSH] (854585..85...   179   7e-48
CAGL0C03916g complement(383989..385875) weakly similar to sp|P40...   172   2e-45
Scas_643.19                                                           170   1e-44
CAGL0C03960g complement(389250..391121) similar to sp|P40549 Sac...   169   2e-44
CAGL0H09262g complement(908258..910135) similar to sp|P40549 Sac...   166   2e-43
CAGL0C04026g complement(397303..399213) weakly similar to sp|P40...   159   5e-41
AFL235W [2960] [Homologous to ScYIL014W (MNT3) - NSH; ScYER001W ...   153   2e-40
CAGL0G04279g complement(404144..406126) weakly similar to sp|P40...   146   2e-36
CAGL0C03894g complement(381514..383397) weakly similar to sp|P40...   145   2e-36
ADR020C [1761] [Homologous to ScYIL014W (MNT3) - SH] (740415..74...   130   2e-31
CAGL0B03003g 295997..297019 some similarities with sp|P40549 Sac...   109   7e-26
KLLA0A11880g 1026919..1028190 some similarities with ca|CA0854|I...   108   7e-25
KLLA0A11891g 1028064..1028672 similar to sp|P53059 Saccharomyces...    67   2e-12
CAGL0B02992g 294927..296054 some similarities with sp|P40549 Sac...    60   2e-09
Kwal_27.11456                                                          39   0.012
KLLA0C16467g 1442002..1443825 weakly similar to sp|P46982 Saccha...    38   0.034
YBR015C (MNN2) [208] chr2 complement(267672..269465) Mannosyltra...    36   0.12 
CAGL0I04532g 404659..406497 similar to sp|P38069 Saccharomyces c...    33   0.63 
Scas_716.77                                                            33   0.72 
CAGL0G09867g complement(942215..944149) similar to sp|Q06623 Sac...    32   2.0  
YJL186W (MNN5) [2738] chr10 (80153..81913) Mannosyltransferase r...    30   5.5  

>Kwal_14.2057
          Length = 733

 Score = 1468 bits (3800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 701/722 (97%), Positives = 701/722 (97%)

Query: 1   MSEVSASITALVRRALHSARVTKLPAVRLPSVRLIVRIVGPIVVIAAFVMLYVESTKYGQ 60
           MSEVSASITALVRRALHSARVTKLPAVRLPSVRLIVRIVGPIVVIAAFVMLYVESTKYGQ
Sbjct: 1   MSEVSASITALVRRALHSARVTKLPAVRLPSVRLIVRIVGPIVVIAAFVMLYVESTKYGQ 60

Query: 61  LAKIAKVAPELNGATYSEPSSSHDAYGFLKGELPHVTGIAFSPLERIKTYNENMEKKRKA 120
           LAKIAKVAPELNGATYSEPSSSHDAYGFLKGELPHVTGIAFSPLERIKTYNENMEKKRKA
Sbjct: 61  LAKIAKVAPELNGATYSEPSSSHDAYGFLKGELPHVTGIAFSPLERIKTYNENMEKKRKA 120

Query: 121 SWDFLGRNNRFKKFDDLSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVA 180
           SWDFLGRNNRFKKFDDLSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVA
Sbjct: 121 SWDFLGRNNRFKKFDDLSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVA 180

Query: 181 EDTKEAIRSRKRENDIALGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDF 240
           EDTKEAIRSRKRENDIALGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDF
Sbjct: 181 EDTKEAIRSRKRENDIALGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDF 240

Query: 241 EKRMWPFIREFDKKSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSF 300
           EKRMWPFIREFDKKSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSF
Sbjct: 241 EKRMWPFIREFDKKSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSF 300

Query: 301 MWNWNHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKAL 360
           MWNWNHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKAL
Sbjct: 301 MWNWNHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKAL 360

Query: 361 QKIAQSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEE 420
           QKIAQSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEE
Sbjct: 361 QKIAQSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEE 420

Query: 421 FILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYY 480
           FILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYY
Sbjct: 421 FILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYY 480

Query: 481 FGHYRMVDLDYIERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAM 540
           FGHYRMVDLDYIERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAM
Sbjct: 481 FGHYRMVDLDYIERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAM 540

Query: 541 LHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEIC 600
           LHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEIC
Sbjct: 541 LHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEIC 600

Query: 601 TIIIAHLSTEGNLLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXX 660
           TIIIAHLSTEGNLLWANGGAEYCKFEDAAEDDWKNEKLNMQ                   
Sbjct: 601 TIIIAHLSTEGNLLWANGGAEYCKFEDAAEDDWKNEKLNMQSKYSSLEELKSLYKSSVSV 660

Query: 661 XXGIVPMDKQGAWGSQDGRCRGYSYCARYERHIKPYSFNKMYEKGFLIDFHPDLTTKYDA 720
             GIVPMDKQGAWGSQDGRCRGYSYCARYERHIKPYSFNKMYEKGFLIDFHPDLTTKYDA
Sbjct: 661 KSGIVPMDKQGAWGSQDGRCRGYSYCARYERHIKPYSFNKMYEKGFLIDFHPDLTTKYDA 720

Query: 721 IN 722
           IN
Sbjct: 721 IN 722

>Sklu_2225.6 YER001W, Contig c2225 7299-9692
          Length = 797

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/752 (37%), Positives = 443/752 (58%), Gaps = 43/752 (5%)

Query: 10  ALVRRALHSARVTKLPAVRLPSVRLIVRIVGPIVVIAAFVMLYVESTKYGQLAKIAKVAP 69
           + + R LH  R      + +   + ++++V  +V++    + Y++ + YG    I K  P
Sbjct: 36  SAISRPLHFMRRNSQNKLAVFRSKRVIQLVVLLVLVVVAALPYLKQSGYGS-HPILKNVP 94

Query: 70  ELNGATYSEPSSSHDAYGFLKGELPHVTGIAFSPLERIKTYNENMEKKRKASWDFLGRNN 129
             +  T S  SS HD    L+  +  +  +  SPLE +  Y+ ++ + RKASW+F+ +N 
Sbjct: 95  SYSELTESIKSSHHDDISKLR--IKPIDQVPVSPLEVVPDYDLDVSRNRKASWNFINKNK 152

Query: 130 RFKKFDDLSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDE-EEERLSTVAED------ 182
           ++K F++L  +++C+FYF  LY +N KW N++  + F +N+E E E+L  +++       
Sbjct: 153 KYKHFNELDLQTRCHFYFRTLYNMNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLV 212

Query: 183 TKEAIRSRKRENDIALGLERMRMYETCFLDRKDADMSKMFSNIRN--------------- 227
            KE++   KR +DI+L LERMR+Y+ CF+     D   +F+N ++               
Sbjct: 213 NKESLGLHKRLHDISLALERMRIYDECFIQNDSVDFEGIFTNKKDDLGVDVDKVSKQKRS 272

Query: 228 --------------SGNS---FSSFTQWDFEKRMWPFIREFDKKSFSELIPHFTSPDGVA 270
                         SG+    + +F QWD E RM+PF++ +  ++F+ ++P  TSP+G  
Sbjct: 273 SINFNGGGGTNGELSGDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQ 332

Query: 271 LEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIVLSFGDGQLKHASR 330
           L  G  P     +   +   +++Y++ +SF WNWN +S   A++GIV+S G+GQ+ +  +
Sbjct: 333 LATGWFPIHNRKTGVAESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIK 392

Query: 331 LIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPETDYEGGQNVKQELWFVD 390
           L+A LR+ GNKLP+QV+HKGDLSE S++ L  +AQ+ +   P   ++   +VKQELWFVD
Sbjct: 393 LLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVD 452

Query: 391 VSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYVDLEQYFHSVEYQHTGTLF 450
           VS TL+P +   F RFKNKWLA  FNLF+EF+ IDVD + YV +E YF + EY+ +GT+F
Sbjct: 453 VSTTLNPSVINEFDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVF 512

Query: 451 FRDRYSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIERMCEKDLAPNTKVIKSY 510
           F+DR      +  C A+  TL P  LES YF  + M+D DY+   C K L P  K+ K++
Sbjct: 513 FKDRSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNF 572

Query: 511 FIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFA 570
           F +N +HQM+SGLVA++K  HI+PL++S +L+M+ K+G C +GDKEFFWLGF   GH ++
Sbjct: 573 FENNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYS 632

Query: 571 FSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAE 630
           F D+ A AVG   E+++ +   ++++SEIC I +AH+S + +LLW NGG++ CKF D AE
Sbjct: 633 FYDVEAAAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKF-DVAE 691

Query: 631 DDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMDKQGAWGSQDGRCRGYSYCARYE 690
           DDW NEK                          ++P +K G WG  DGRC+GY +CARY 
Sbjct: 692 DDWNNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYS 751

Query: 691 RHIKPYSFNKMYEKGFLIDFHPDLTTKYDAIN 722
            +IK Y+++     G L+ F  +     D++N
Sbjct: 752 SYIKEYTYSNRVNIGKLVKFDEEEKKYIDSLN 783

>KLLA0E09790g 867899..870139 similar to sp|P39106 Saccharomyces
           cerevisiae YER001w MNN1 alpha-1, 3-mannosyltransferase,
           start by similarity
          Length = 746

 Score =  465 bits (1197), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/752 (34%), Positives = 397/752 (52%), Gaps = 60/752 (7%)

Query: 11  LVRRALHSARVTKLPAVRLPSVRLIVRIVGPIVVIAAFVMLYVESTKYGQLAKIAKVAPE 70
           +VRR L ++R   +P+ R  S  +++ I G    +  ++  +  + K   L K+A     
Sbjct: 3   VVRRFLSASRYN-MPSFR--SRPVLLAIFGVCATVIWYLFFFQSNLKMADLKKVAT---- 55

Query: 71  LNGATYSEPSSSHDAYGFLKGELPHVTGIAFSPLERIKTYNENMEKKRKASWDFLGRNNR 130
            +     EPS S         ++  +     SPLE I     +  KK  ASWD L R  +
Sbjct: 56  -SRYLSQEPSLSELMSNV---KIKPIEETPVSPLELIPDIEISTRKKYDASWDLLFRGRK 111

Query: 131 FKKFDDLSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDT------- 183
           +K F+D    ++C FYF NLY +N  W NN   + F +ND +        +D+       
Sbjct: 112 YKSFNDYDLHTKCEFYFQNLYNLNEDWTNNIRTFTFDINDVDTSTKIDALKDSDGVQLVD 171

Query: 184 KEAIRSRKRENDIALGLERMRMYETCFLDRKDADMSKMFSNIRN-------------SGN 230
           ++AIR  KR +++AL  ER+R+Y+ CF++   ++  KM    R+             +GN
Sbjct: 172 EKAIRLYKRTHNVALATERLRLYDKCFVNSPGSNPLKMDHLFRSNKKSKTTALDDEVTGN 231

Query: 231 -------------------SFSSFTQWDFEKRMWPFIREFDKKSFSELIPHFT-SPDGVA 270
                              SF  + QWDFE RM+P I  F++ +F+ ++P FT S  G  
Sbjct: 232 RDTFTKTKKTSFLSDMDTSSFQKYDQWDFEHRMFPMIPYFEEHNFTNVMPIFTGSNGGEP 291

Query: 271 LEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIVLSFGDGQLKHASR 330
           L  G  P L   S  + +   + Y++ +S   NWN MSS   ++GI+L+ GDGQ+    R
Sbjct: 292 LPQGKFPVLDPKSGELLRVETFRYDKSKSLWKNWNDMSSASGKRGIILAAGDGQVDQCIR 351

Query: 331 LIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPETDYEGGQNVKQELWFVD 390
           LIA LR  GN LP+Q++H   L+E S+K L + A+S       T++  G+   Q LW V+
Sbjct: 352 LIATLRAQGNALPIQIIHNNQLNEKSVKLLSEAAKS-------TEFSSGR--AQSLWLVN 402

Query: 391 VSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYVDLEQYFHSVEYQHTGTLF 450
           V PTL+  M  +F RFKNKWL+  FN FEEFI ID D + Y+++  YF+  EY+ TGTLF
Sbjct: 403 VGPTLESSMKSNFGRFKNKWLSVIFNTFEEFIFIDTDAISYINMADYFNFKEYKSTGTLF 462

Query: 451 FRDRYSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIERMCEKDLAPNTKVIKSY 510
           F+DR  +   E+ C  + ETL P ILE YYF    M++ DY+E+ C   L P  KV K +
Sbjct: 463 FKDRSLAIGTEQKCGPLFETLEPRILEMYYFNTLPMINGDYVEQQCMGMLTPEEKVYKRF 522

Query: 511 FIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFA 570
           F    +H ++SGL+A+NK  HI+ L+ + +L++  K+G C +GDKEFFWLG    G  ++
Sbjct: 523 FEVGHQHNLESGLLAINKNEHIMGLVTATVLNIAPKVGGCGWGDKEFFWLGLLVAGQRYS 582

Query: 571 FSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAE 630
             D+ A A+G+ ++++++ +  +  +  IC++ +AH S +G+LLW NGG++YCK  +  E
Sbjct: 583 IYDIDASAIGVPQQKQSIANGDEFDEYRICSLQVAHTSYDGHLLWINGGSQYCKKPETFE 642

Query: 631 DDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMDKQGAWGSQDGRCRGYSYCARYE 690
            DW N K   +                      IVP  +   WG  D RC+GY +C ++ 
Sbjct: 643 GDWTNIKELRESYSDDKEKALKAYSDTVKVEAAIVPDSRSNGWGRDDQRCKGYFWCGKFT 702

Query: 691 RHIKPYSFNKMYEKGFLIDFHPDLTTKYDAIN 722
             +KPY++N +  KG LI F  +       IN
Sbjct: 703 SKLKPYTYNTVVTKGDLIRFGDEEIESISKIN 734

>YER001W (MNN1) [1423] chr5 (153519..155807)
           Alpha-1,3-mannosyltransferase, required for complex
           glycosylation of both N- and O-oligosaccharides [2289
           bp, 762 aa]
          Length = 762

 Score =  427 bits (1097), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 241/715 (33%), Positives = 382/715 (53%), Gaps = 34/715 (4%)

Query: 38  IVGPIVVIAAFVMLYVESTKYGQLAKIAKVAPELNGATYSEPSSSHDAYGFLKGELPHVT 97
           +VG +++I   V+  + + +   L + + V    N  T  +         F   E+  V 
Sbjct: 22  LVGALIII--LVLFQLVTHRNDALIRSSNVN-STNKKTLKDADPKVLIEAFGSPEVDPVD 78

Query: 98  GIAFSPLERIKTYNENMEKKRKASWDFLGRNNRFKKFDDLSEESQCYFYFHNLYEINPKW 157
            I  SPLE +  Y+++++ KR +SW  + +   +K F++LS   +C FYF  LY ++ +W
Sbjct: 79  TIPVSPLELVPFYDQSIDTKRSSSW-LINKKGYYKHFNELSLTDRCKFYFRTLYTLDDEW 137

Query: 158 ENNYSKWGFIVNDEE---EERLSTVAEDTKEAIRSRKRENDIALGLERMRMYETCFLDRK 214
            N+  K  + +ND E   E + +      +++ R  +R+ D+    ER+R Y+ CF+   
Sbjct: 138 TNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERLYRRKYDMFQAFERIRAYDRCFMQAN 197

Query: 215 DADMSKMF------------SNIRNSGNS---------FSSFTQWDFEKRMWPFIREFDK 253
             ++ ++F            S +  + N+         F  + Q++FE +M+PFI  F  
Sbjct: 198 PVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKKYDQFEFEHKMFPFINNFTT 257

Query: 254 KSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQ 313
           ++F E++P  TSP G  LE G LP   H +  +++  KYEY+  ++F  NW  MS+ VA 
Sbjct: 258 ETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDPSKTFWANWRDMSAKVAG 317

Query: 314 KGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGD-LSEGSIKALQKIAQSDDITFP 372
           +GIVLS G  Q   A + IA LR+ GN LP+QVV++GD LS+  +  L   A+S D    
Sbjct: 318 RGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELVDKLIYAARSPDFKPV 377

Query: 373 ETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYV 432
           E +Y+   NV QE+WF+DVS T+ P   G F  +K+KWL    NL +EF+ +D+D + Y 
Sbjct: 378 ENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDIDAISYE 437

Query: 433 DLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYI 492
            ++ YF + EYQ TGT+F+R+R   E V E C A  ETL P  LES  F +  ++D D+ 
Sbjct: 438 KIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLLPRNLESKNFQNSLLIDPDHA 497

Query: 493 ERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSY 552
              C+  L     + K++F    +HQ+++GL AV+K  H +PL+L+AM+H+      C++
Sbjct: 498 LNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTH 557

Query: 553 GDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEG- 611
           GDKE FWLGF A GH +A   + +GA+G   ++ ++N   ++   EIC+  IAH+ST+  
Sbjct: 558 GDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKK 617

Query: 612 NLLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXG---IVPMD 668
            LLW NGG  +CK ++AA+DDWK +    +                         I+P  
Sbjct: 618 TLLWVNGGGTFCKHDNAAKDDWKKDGDFKKFKDQFKTFEEMEKYYYITPISSKYVILPDP 677

Query: 669 KQGAWG-SQDGRCRGYSYCARYERHIKPYSFNKMYEKGFLIDFHPDLTTKYDAIN 722
           K   W  +  G C GY +CA ++  +KPYS+N     G LI    +     DA+N
Sbjct: 678 KSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGELITLDEEQRLHIDAVN 732

>Kwal_23.2926
          Length = 568

 Score =  271 bits (692), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 184/553 (33%), Positives = 251/553 (45%), Gaps = 86/553 (15%)

Query: 143 CYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSRKRENDIALGLER 202
           C  YF  LY+  P W N+Y                  AE  +      + EN + L LER
Sbjct: 56  CGEYFQKLYKNEPSWWNDY------------------AEGQEHHTPDYENEN-LRLILER 96

Query: 203 MRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDKKSFSELIPH 262
           +RMYE+C       ++  + S I            +D +KRM+PF+R           P 
Sbjct: 97  LRMYESC------VELGALKSGI------------YDLDKRMYPFLRPGK-------TPK 131

Query: 263 FTSPD-GVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQ--KGIVLS 319
           F S D     E G LP +  S  +     KY+Y+   ++  NW  +SS   +  +GIVLS
Sbjct: 132 FQSGDLKTTYEGGILPSMADSGSF-----KYKYDYSDTWTSNWYRLSSQGREPTRGIVLS 186

Query: 320 FGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPETDYEGG 379
           F D  +    RL+  L +  N+LP+QV+HKGDLSE S   + +                 
Sbjct: 187 FPDSHVSLVIRLLKVLHHQKNELPIQVIHKGDLSEASKNLISEALSP------------- 233

Query: 380 QNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYVDLEQYFH 439
               Q LWFVDVS  L+      F+ +KNKWLA   N F E + ID D V  +  E YF 
Sbjct: 234 ---SQNLWFVDVSSMLNKRFVRDFSGYKNKWLAMILNTFSEAVFIDADAVSMMSFEDYFE 290

Query: 440 SVEYQHTGTLFFRDRYSSEKVE-EICPAMIETLPPNILESYYFGHY-RMVDLDYIERMCE 497
              Y  TG LFF+DR    K + + C  MI++L P   E+ YF H  R++DL   +    
Sbjct: 291 MGLYNQTGALFFKDRAFDHKFDYDFCVPMIKSLQPGKHETRYFQHRKRLIDL---QLRNT 347

Query: 498 KDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDKEF 557
           +D +    +IK +F    RHQMDSGLV + K  H+ PL+ +  L++  KL  C++GDKE 
Sbjct: 348 QDPSTEQTIIKDFFEGYQRHQMDSGLVLIEKGKHLTPLLAAVFLNLAPKLSKCTHGDKET 407

Query: 558 FWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLLWAN 617
           FWL F  M H F+F    A A+G   E             EIC++ + H S EG+LLW N
Sbjct: 408 FWLAFLLMNHEFSFHPEEASAIGKADE-----------NGEICSVQLGHTSAEGDLLWFN 456

Query: 618 GGAEYCKFEDAAEDDWKN-EKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMDKQGAW-GS 675
            G   CKF DA E DW    K ++                        +P      W G 
Sbjct: 457 SGFRTCKFADAIEFDWDGYPKEDLHSRFSSLEDARLFYESLAEIEAAALPNKHLNPWTGG 516

Query: 676 QDGRCRGYSYCAR 688
               C GY YCA+
Sbjct: 517 FGDHCLGYRYCAK 529

>AAR183C [371] [Homologous to ScYIL014W (MNT3) - NSH]
           (672091..674037) [1947 bp, 648 aa]
          Length = 648

 Score =  220 bits (560), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 150/459 (32%), Positives = 232/459 (50%), Gaps = 58/459 (12%)

Query: 188 RSRKRENDIALG---LERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRM 244
           RSR R  D ++    LER+R+++TCF+ + D  + ++F               +     +
Sbjct: 153 RSRGRMKDASVTAAMLERLRVFDTCFM-QGDIGLREVFGE---------DINLYSLHHEL 202

Query: 245 WPFIREFDKKSFSELIPHFTS-PDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWN 303
           +PF+++   + +SEL+P      DG     G+  P        ++A K + +     +  
Sbjct: 203 FPFLKKV--RDWSELLPQVLDLNDGSRYLLGNKLP--------EQAFKVDND-----LPF 247

Query: 304 WNHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKG-DLSEGSIKALQK 362
           W ++    + +GIV +  D  L    RL+  L  +GNKLP+++V+KG D S   IK L++
Sbjct: 248 WENLRRSSSGRGIVATVADIHLDQLKRLLHVLDELGNKLPIELVYKGNDFSRLPIKRLKR 307

Query: 363 IAQSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFI 422
             +              Q+ KQ +  VD S  L         RF NKWLAT FN FEE I
Sbjct: 308 YVR--------------QHTKQRVRLVDCSRVLRSTHIPKIKRFMNKWLATIFNSFEEII 353

Query: 423 LIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYYFG 482
           L+DVD V  V ++ YF    Y  TG LFF+DR   E +   C   I  LPP+  E+  +G
Sbjct: 354 LLDVDVVPLVPIDSYFKLPGYTKTGALFFKDRTLPEYLPVSCTKAILLLPPSSEENKLWG 413

Query: 483 H---YR--MVDLDYIERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLML 537
           H   YR  M     ++R    +    T+V+ +YFI+  RHQ+++GLV +N+K  +  L+ 
Sbjct: 414 HSMRYRTPMTKAGALDRTNSAE----TEVMYNYFIERYRHQVETGLVVLNRKQRLFSLVT 469

Query: 538 SAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVG-IQKEEKNVNHHLKQKK 596
           S M+H+  +   C +GDKE FWLG    G+ ++   MPA  +G +Q+ E+     L   +
Sbjct: 470 SFMIHLNLRFSECFHGDKEVFWLGQLLTGNEYSIHPMPAAIIGELQQGERK----LAATE 525

Query: 597 SEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAEDDWKN 635
             IC+  IAH  T+G +LW NGG   CK   AAE+D+ +
Sbjct: 526 YRICSTQIAHPDTDGTVLWINGGMWNCKDNKAAEEDFSD 564

>KLLA0D13376g 1150858..1152849 some similarities with sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3 alpha-1,
           3-mannosyltransferases responsible for adding the
           terminal mannose residues of O-linked oligosaccharides,
           hypothetical start
          Length = 663

 Score =  218 bits (556), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 174/613 (28%), Positives = 276/613 (45%), Gaps = 77/613 (12%)

Query: 93  LPHVTG---IAFSPLERIKTYNENMEKKRKASWDFLGRNNRFKK----FDDLSEESQCYF 145
           +PH  G   + +SP  R+ + + N+ K    +   L   N++ K    +  L  E +C F
Sbjct: 83  VPHFEGKRALIYSPFYRLAS-SLNLGKWLSLA---LHATNKYHKIGLDWPTLPLEQKCRF 138

Query: 146 YFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSRKRENDIALGLERMRM 205
           YF +  EINP W N++ K  F  ++  ++ L+                    L LER+RM
Sbjct: 139 YFESTLEINPTWNNDHIK-DFHNDNNLDDPLA-------------------ELMLERIRM 178

Query: 206 YETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDKKSFSELIPHFTS 265
           Y++CF+       SK+F       N        D E R++PF+ +  K  F  L P    
Sbjct: 179 YDSCFIS-GGLSTSKVFKRSVVKPN--------DLESRLFPFLSK--KTPFRHLWPKMIH 227

Query: 266 PDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIVLSFGDGQL 325
            +   L      PL    D       ++ ++  SF +NWN+ +     KGIVL+ G    
Sbjct: 228 VNPWTLIPSFSNPLLEGKD------TWKMDDNYSFFYNWNNFAE---GKGIVLTLGLRHG 278

Query: 326 KHASRLIAHLRYIGNKLPLQVVHKG-DLSEGSIKALQKIAQSDDITFPETDYEGGQNVKQ 384
               +L+  L  + N LP+QV+H G +L+E  I  +               +   + + Q
Sbjct: 279 DQFKKLLLTLENLNNTLPIQVIHNGSELTEAFIYDIHS-------------FLNAKKLSQ 325

Query: 385 ELWFVDVSPTLDPVMAGSFTR-FKNKWLATSFNLFEEFILIDVDTVHYVDLEQYFHSVEY 443
           +++FV++ P +D    G +   F NKW+A  FN F E IL+D D+V +  LE YF    Y
Sbjct: 326 QVYFVNIEPLIDASFVGQYVHYFINKWMALLFNTFSECILLDADSVSFASLESYFDFKGY 385

Query: 444 QHTGTLFFRDR-YSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIE--RMCEKDL 500
           Q TG L FRDR    EK    C   ++ L P++ E+++  H     L+ +E   +    L
Sbjct: 386 QDTGMLLFRDRNIIGEKTFIYCTDTLKKLFPSVEETHFMSHRSTFPLELVENDNINIDTL 445

Query: 501 APNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDKEFFWL 560
           +   ++   +F +   H +DSGLV V++   +  L++S M+++  KL  C YGDKE FWL
Sbjct: 446 SMEEQIYYKFFHNLQLHHIDSGLVVVDRVKKLSSLLISTMMNIDGKLQRCVYGDKEIFWL 505

Query: 561 GFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLLWANGGA 620
           G    G  ++        +G  K + +          EIC   +AH+STEG LLW+NGG 
Sbjct: 506 GQLLAGEKYSIYPTEGSIMGTVKNKPD-------DTFEICGTQMAHVSTEGTLLWSNGGL 558

Query: 621 EYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMDKQGAWGSQDGRC 680
           + CK +D A  D+ ++    Q                      I P   Q  W  +   C
Sbjct: 559 KKCKVQDCAVADFDHDPDYFQEKYGNPVALQQMYDSSLSISGYITPNVGQYPW-EKIKEC 617

Query: 681 RGYSYCARYERHI 693
             Y+YCA  + ++
Sbjct: 618 HQYTYCATAKENV 630

>CAGL0C04048g complement(399734..401596) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 620

 Score =  213 bits (541), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 188/688 (27%), Positives = 290/688 (42%), Gaps = 110/688 (15%)

Query: 34  LIVRIVGPIVVIAAFVMLYVESTKYGQLAKIAKVAPELNGATYSEPSSSHDAYGFLKGEL 93
           L+ R +  I+VI +   ++  +T       +  V   +N A         D   +  G L
Sbjct: 8   LLRRYILAIIVILSLTFVFYSNT-------LTTVVSTVNVA---------DTQDYTSG-L 50

Query: 94  PHVTGIAFSPLERIKTYNENMEKKRKAS----WDFLGR-NNRFKKFDDLSEESQCYFYFH 148
            H + +  SP   +  Y  N EK R ++      FL +  +    ++  S+  +C     
Sbjct: 51  KHASPV--SPFSYVNNYLLNSEKTRSSTVKKLLPFLNKPKDGLVDWNSSSKYQKCLLLVK 108

Query: 149 NLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSRKRENDIALGLERMRMYET 208
           ++Y+ +P W N      +  ++E  E L                  ++ L  ER+++Y+ 
Sbjct: 109 SMYKAHPHWSNRDIMTAY--DNESVEDL------------------NLQLAGERIKIYKQ 148

Query: 209 CFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDKKS---FSELIPHFTS 265
           CFLD  D +  + F  +     S      +DF+KRM+ F R+    +   F   I +  S
Sbjct: 149 CFLD-NDIEPIEFFKRL-----SIPDVDAYDFQKRMFYFFRDITASNTDYFHPAIKNVKS 202

Query: 266 PDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIVLSFGDGQL 325
            + V+     L P              EYN   + + NW  +S     KGIVL+     +
Sbjct: 203 GEVVSKPKTKLTP-------------QEYNA--NIIGNWRKLSR---GKGIVLTVSQSDV 244

Query: 326 KHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPETDYEGGQNVKQE 385
               +     + +GNKLP+QVVHKG  +E + +  QKI             E    ++Q+
Sbjct: 245 PLLRQQFRVWKELGNKLPIQVVHKG--TEINAELEQKIK------------EYAIEMEQD 290

Query: 386 LWFVDVSPTLDPVMA-GSFTRFKNKWLATSFNLFEEFILIDVDTVHYVDLEQYFHSVEYQ 444
           ++ VD+SP +DP  A  S   F NKW A  FN FEE ILID D + YV  E +  S  Y+
Sbjct: 291 VYVVDLSPVIDPDFAENSIQNFHNKWYAAIFNTFEELILIDADAIPYVPAEDFLKSKSYK 350

Query: 445 HTGTLFFRDR-YSSEKVEEICPAMIETLPPNILESYYFG---HYRMVDLDYIERMCEKDL 500
            TG   +RDR  + E+    C  M     P + E    G    YR+ D    +    KD 
Sbjct: 351 KTGLRLWRDRDITHERTLHFCVEMAPYFEPTLEEHNLIGTTLSYRLTDSGLKD---AKD- 406

Query: 501 APNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDKEFFWL 560
               + +  +F     H +DSGLV ++KK  I  L++S +LH   + G C+YGDKE F L
Sbjct: 407 -SEGRALYEFFQKMYLHHVDSGLVVIDKKDKIHSLIMSEILHSHTRFGRCTYGDKELFML 465

Query: 561 GFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLLWANGGA 620
           G Y +G ++      A  +G    EK  + H       IC   + H   +  LLW+NGG 
Sbjct: 466 GAYMVGESYTLEAQSAAIIGTVGYEKEFSRHY------ICATQMGHSDEDNRLLWSNGGL 519

Query: 621 EYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMDKQGAWGSQDGRC 680
             CKF D AE+D+  ++   +                      I+P      W  Q   C
Sbjct: 520 RTCKF-DCAEEDFNKDEEYYKKRYQNVDNLKAVYSSRLNIDGFIIPDTTVNKW-LQLSEC 577

Query: 681 RGYSYCARYERHIKPYSFNKMYEKGFLI 708
           R Y YCA  +        N+  +KG L+
Sbjct: 578 RQYMYCAHVDD-------NREKDKGTLV 598

>Kwal_55.20984
          Length = 619

 Score =  212 bits (539), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 158/578 (27%), Positives = 257/578 (44%), Gaps = 66/578 (11%)

Query: 115 EKKRKASWDFLGRNNRFKKFDDLSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDEEEE 174
           E   K +W F    + +++F   +   QC  YF   Y  NP W N+  +  + V+  ++ 
Sbjct: 64  EYTDKHNW-FSSHQSGWQEFRSQTLPEQCSRYFQATYAKNPDWTNDDLRLFWGVDARDDA 122

Query: 175 RLSTVAEDTKEAIRSRKRENDIALGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSS 234
           +LS +                    +ER+R+++ CF+ + D  ++++     N       
Sbjct: 123 KLSNI--------------------VERVRVFDDCFI-KSDLTLNQVLPESINIS----- 156

Query: 235 FTQWDFEKRMWPFIREFDKKSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKA-IKYE 293
               DF  RM+PF++  +  +  +L P  T      L +G +   G    Y K   + + 
Sbjct: 157 ----DFHHRMFPFLKVAEDAT--DLWPTITH-----LNSGQVVARGVRPHYSKDDDVPFS 205

Query: 294 YNEKRSFMWNWNHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKG-DL 352
            +  +SF  NWN  S     KG+V S G+  L    RL+  L    N LP+Q+V +  +L
Sbjct: 206 ADNSKSFWQNWNSFSK---GKGLVFSLGERHLDPFLRLLKILDQQNNSLPIQIVQQPHEL 262

Query: 353 SEGSIKALQKIAQSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLA 412
           S+  +  L +  QS                 QE++++D    LD       T F NKWLA
Sbjct: 263 SDAFLGNLTEFLQSS---------------HQEVYYIDCEALLDTTYKAYMTYFVNKWLA 307

Query: 413 TSFNLFEEFILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDR-YSSEKVEEICPAMIETL 471
           + FN F E +L+D D V +V +E +F   +Y+ TG L ++DR    E   + C    + L
Sbjct: 308 SIFNTFSEVVLMDADVVPFVPVESFFQEEQYKATGVLLYKDRDMPQETTFDYCITTFKLL 367

Query: 472 PPNILESYYFGHYRMVDLDYIERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSH 531
            P+  E     H    +   ++           KV   +F +   H +DSGLV ++K   
Sbjct: 368 EPSSQEVVLMNHRMKTNSSVVDPGAHIFANEKDKVYHRFFYNETLHNVDSGLVVLHKTER 427

Query: 532 IVPLMLSAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVG-IQKEEKNVNH 590
           +  L++S ++++  K  +C YGDKE FWLG    G+++A   +   AVG +      V+ 
Sbjct: 428 LSGLLISFIMNLDQKASNCIYGDKELFWLGQLFSGNDYAIDPLDGAAVGRVNLTHDKVSG 487

Query: 591 HLKQKKSEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXX 650
           H   +K EIC   + H S++G LLW NGG + CK + AA  D++ +  + +         
Sbjct: 488 H---QKYEICATQMGHGSSDGRLLWTNGGLKACKIKGAAHIDFERKPEHFEQHFGTEEKL 544

Query: 651 XXXXXXXXXXXXGIVPMDKQGAW-GSQDGRCRGYSYCA 687
                        I+P   + AW   QD  C  YSYCA
Sbjct: 545 QALYDLPLSIEGYIIPNISRNAWLKGQD--CLEYSYCA 580

>YIL014W (MNT3) [2651] chr9 (326101..327993) Mannosyltransferase
           that adds the final mannose to O-linked oligosaccharide
           chains [1893 bp, 630 aa]
          Length = 630

 Score =  211 bits (536), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 155/557 (27%), Positives = 254/557 (45%), Gaps = 68/557 (12%)

Query: 135 DDLSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSRKREN 194
           +++++  +C + F  LY+I+P W+N  +   + V+  +    S + E             
Sbjct: 100 NEIAKSDKCRYIFEVLYKIDPDWDNAQTAKFYNVDGVDNTLASLLGE------------- 146

Query: 195 DIALGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDKK 254
                  R+R Y+ CFL  +  D + +F+N        S+    D + RM+PF+++ +++
Sbjct: 147 -------RLRSYDYCFLSGQ-LDPTAIFAN--------STVNPHDLQNRMFPFLKKINEE 190

Query: 255 SFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQK 314
           S + + P  T  D    EA   P +   S           N   +F  NWN +S     +
Sbjct: 191 SKTVMWPIIT--DMTTGEAVPAPEVDMESS----------NFNGNFWSNWNRLSK---GR 235

Query: 315 GIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPET 374
           G VL+  +  +    + +  + +  N+LP Q+V  G+  E S +++ KI+          
Sbjct: 236 GFVLTIAEKDVPLFLKQLKVMEFSKNELPFQIVSTGN--ELSAESIAKIS---------- 283

Query: 375 DYEGGQNVKQELWFVDVSPTLDPVMAGSFTRF-KNKWLATSFNLFEEFILIDVDTVHYVD 433
             E  +  +Q ++ VD S  LD   A ++  F +NKW+AT FN FEE+IL+D D V +V 
Sbjct: 284 --ETAKETEQRVYLVDCSTVLDTNFANTYISFFQNKWVATLFNTFEEYILLDADVVPFVG 341

Query: 434 LEQYFHSVEYQHTGTLFFRDRY-SSEKVEEICPAMIETLPPNILESYYFGHYRMVD--LD 490
            + +F S  Y+ +G L F+DR   +E+  + C  M+  + P+  E  + G   + D  L 
Sbjct: 342 SDYFFDSPSYRESGILLFKDRVMENEQTFQYCIEMLNEVEPSAQERRFIGSRLVFDSSLP 401

Query: 491 YIERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSC 550
           +     E+       V  ++F     H +DSGLV VNK   +  L++S ML++  KL  C
Sbjct: 402 FSSETSEE-----ASVYYNFFKKLRLHHVDSGLVVVNKLEKLNGLLMSFMLNLDGKLQRC 456

Query: 551 SYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTE 610
            YGDKE FWLG    G +++ + +    +G   EE   +   K     IC+  IAH  ++
Sbjct: 457 VYGDKEIFWLGQLYAGQDYSINPVDGSIIGPVNEEPENDDGHKSGMYYICSTQIAHSDSK 516

Query: 611 GNLLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMDKQ 670
             LLW NGG + CK  ++AEDD+  E    +                      IVP    
Sbjct: 517 NRLLWVNGGLKTCKISNSAEDDFGREPEYFKSRYGDISKLKRIYDASLNVEGLIVPDVSV 576

Query: 671 GAWGSQDGRCRGYSYCA 687
             W  Q   C  Y YCA
Sbjct: 577 HPW-MQIKECSNYMYCA 592

>Scas_717.5
          Length = 639

 Score =  210 bits (534), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 161/549 (29%), Positives = 252/549 (45%), Gaps = 63/549 (11%)

Query: 142 QCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSRKRENDIALGLE 201
           QC +  +++Y+ +  W N      +  NDE ++ L                   +AL  E
Sbjct: 109 QCRYLVYSIYQQDANWSNE-GMCTYHSNDELDDSL-------------------LALMGE 148

Query: 202 RMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDKKSFSELIP 261
           R+R+Y+ CF+  K  ++  +F++     NS    T  DF+KRM+PF+R   ++S     P
Sbjct: 149 RLRIYDYCFITGK-LNVKDVFNDYLTENNSI---TASDFQKRMFPFLRSDSEESNELFWP 204

Query: 262 HFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIVLSFG 321
             T+     L+ G + P        +  +     E  S  W +   SS    KGIVL+ G
Sbjct: 205 IVTN-----LKTGEVQP--------RPKVSVSPKEFNSQFWKYWKQSS--HGKGIVLTMG 249

Query: 322 DGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPETDYEGGQN 381
           +  +    + +  L ++GNKLP+Q+V  G  SE S + L+ +          TD+    N
Sbjct: 250 ERDVDMFKKQLRVLDHLGNKLPIQLVTAG--SEYSPEFLKDL----------TDFLKTTN 297

Query: 382 VKQELWFVDVSPTLDPVMAGSF-TRFKNKWLATSFNLFEEFILIDVDTVHYVDLEQYFHS 440
             QE++ V+ SP LDP     +   F +KW+A   N FEE +LID D V +V L+ +F S
Sbjct: 298 --QEVYLVEASPILDPEFVSKYIVFFFHKWIAILLNTFEELVLIDADVVPFVPLKSFFKS 355

Query: 441 VEYQHTGTLFFRDR-YSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIERMCEKD 499
             Y+ TG L F+DR    E     C   ++ + P+  E+ Y     ++D    + +    
Sbjct: 356 EGYKTTGLLLFKDRNMKGEHTFTYCMESLKYMEPSRQETEYIQTNLLID--STKELPSPT 413

Query: 500 LAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDKEFFW 559
            +    V   +F D   H +DSGLV VNK   +  L++S MLH+  K+  C YGDKEFFW
Sbjct: 414 SSEEAAVYNHFFKDLRLHHVDSGLVTVNKNEKMNGLLMSFMLHLNGKIQRCVYGDKEFFW 473

Query: 560 LGFYAMGHNFAFSDMPAG-AVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLLWANG 618
           LG    G +++   M AG A GI +   N +     K+  IC+  I+H+     LLW NG
Sbjct: 474 LGQLFAGQDYSIHPMDAGVAGGIDRSNPNSS----PKEYFICSAQISHIDENQKLLWQNG 529

Query: 619 GAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMDKQGAWGSQDG 678
           G+ +C+  ++A  D++ +    +                      I+P      W  Q  
Sbjct: 530 GSNFCEVSNSATSDFEKDPSYFRGRYQSMESLKTLYDSPVKFDGVIIPDASANPW-LQLK 588

Query: 679 RCRGYSYCA 687
            C  Y YCA
Sbjct: 589 ECSNYMYCA 597

>Kwal_55.22238
          Length = 584

 Score =  198 bits (504), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 126/372 (33%), Positives = 188/372 (50%), Gaps = 32/372 (8%)

Query: 256 FSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKG 315
           FS   P F   DG+ +E    P L  SS  +      E   K SF   W H+   +  +G
Sbjct: 137 FSGDFPTFQRWDGLLVEG--YPKLVASSGKMT-TTNVEKGPKASF---WKHLKESMNGRG 190

Query: 316 IVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPETD 375
           IV+S G+G +    RL+  LR +GN+LP+Q+VHKGDLS  +++ +  I + D I     D
Sbjct: 191 IVISLGEGGVSDVKRLLRVLRTVGNRLPIQLVHKGDLSRAAMQEIINIGRGDVIV-EIGD 249

Query: 376 YEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYVDLE 435
                   Q++WFVD   +++   A  F RF NKW+A+ FN FEE IL+D D V +VD E
Sbjct: 250 VSQSIGNPQDIWFVDAGKSVNSSSAHLFKRFSNKWIASLFNSFEEIILMDCDAVPFVDPE 309

Query: 436 QYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIERM 495
             F++ EY+ +G LFF DR   E ++     + + L P   E   FG    +        
Sbjct: 310 LLFNTTEYKESGALFFVDRLIDEYIKTNDLKLYQKLFPLENEKSLFGLQHTLG------- 362

Query: 496 CEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDK 555
                      ++ ++    +H M+SG+V + ++ H+  L++S  L    +     YGDK
Sbjct: 363 -------GAVDLRGFYEFGYKHTMESGMVVMKREDHLPGLLISTCLQFWKETSEPFYGDK 415

Query: 556 EFFWLGFYAMGHN-FAFSDMPAGAVGI--QKEEKNVNHHLKQKKSEICTIIIAHLSTEGN 612
           E FWLG    G+  + F+  PAGA+G+  Q  ++N+N+        IC+   AH S +  
Sbjct: 416 ELFWLGQSISGNGEYRFNAYPAGAIGLLNQDTDENLNY--------ICSTQPAHFSKDLQ 467

Query: 613 LLWANGGAEYCK 624
           LLW NGGA  CK
Sbjct: 468 LLWLNGGARRCK 479

>AEL345W [2160] [Homologous to ScYIL014W (MNT3) - NSH]
           complement(1961..3898) [1938 bp, 645 aa]
          Length = 645

 Score =  194 bits (492), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 145/508 (28%), Positives = 240/508 (47%), Gaps = 79/508 (15%)

Query: 136 DLSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSRKREND 195
           DL E  +C  YF   Y   P W N      F+  D        +  D   + +       
Sbjct: 114 DLQE--RCKRYFELTYRKEPAWSNQVP---FLSRD--------IISDASYSAKL------ 154

Query: 196 IALGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDKKS 255
               +ER R++  CF++  +     + + +    + F      DF++RM+PF+ +   + 
Sbjct: 155 ----MERWRIFADCFIEGNEP----LSTTLDGRVDIF------DFQQRMYPFLTKV--RR 198

Query: 256 FSELIPHFTSPD-GVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQK 314
           + E+ P  T  + G   + GHL          K   +   ++  SF  NW   S     +
Sbjct: 199 WEEIWPMITDLNTGEQYQPGHL----------KDGQRLTIDDNLSFWKNWQLFSK---GR 245

Query: 315 GIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPET 374
           GI ++ G   ++   RL+  L +IGN LP+++++  DL   +I  + K  Q         
Sbjct: 246 GITITAGAEHVEMLPRLLNVLDHIGNTLPIELINAADLPPTTIDKIAKYVQ--------- 296

Query: 375 DYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYVDL 434
             +  Q V+     VD   TL+       T F++KWLA  FN FEE + ID+D V +VDL
Sbjct: 297 -MKSNQTVR----LVDCGKTLEHSYRSLITGFRHKWLAYIFNTFEEAVFIDLDAVPFVDL 351

Query: 435 EQYFHSVEYQHTGTLFFRDR-YSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIE 493
           E+ F    Y+  G L FRDR Y  EK ++ CP  +  + P+  E   + H      +Y +
Sbjct: 352 EKLFEVEGYKSEGILMFRDRSYDGEKPDD-CPKAMRIMMPSPKEHTMWQHGS----NYDK 406

Query: 494 RMCEKDLA--PNTKVIKSYFIDNLR----HQMDSGLVAVNKKSHIVPLMLSAMLHMTDKL 547
           ++ E +L   P      +++I  +     H  +SGL+ ++K   +  L++S MLHMT + 
Sbjct: 407 QVAEDELTKKPRDAGAATFYIKYMEGKSFHMAESGLIVMHKNKKLPSLLISLMLHMTFET 466

Query: 548 GSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHL 607
             CS+GDKE+ WLG    G N+     P   +G+ +    V++H +  + +IC+  IAH+
Sbjct: 467 HLCSHGDKEYLWLGQLVSGENYYVDPRPPAIIGVPQL---VSNHGQVDEYKICSAQIAHM 523

Query: 608 STEGNLLWANGGAEYCKFEDAAEDDWKN 635
             +G++LW NGG + CKF DA E D+++
Sbjct: 524 DDDGSILWVNGGLKNCKF-DAVERDFED 550

>CAGL0C04004g complement(394614..396512) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 632

 Score =  192 bits (489), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 138/509 (27%), Positives = 245/509 (48%), Gaps = 60/509 (11%)

Query: 188 RSRKRENDIALGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPF 247
           + R  E ++ + +ER+R+Y  CFL+    D++++   ++++G   SS+  +DF+ RM+ F
Sbjct: 142 KVRVDEINMQVSVERIRIYNYCFLE-GGLDVTEV---LKDAG--LSSYDAFDFQSRMFIF 195

Query: 248 IREF---DKKSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNW 304
           +++    D K    +I +  + + ++       P   +++               FM NW
Sbjct: 196 LKQVTKTDAKYLYPIIQNLNTEEIISEPTTTKSPQDFNAN---------------FMANW 240

Query: 305 NHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKG-DLSEGSIKALQKI 363
             +++    KGI ++     ++   RL   L+ +GN  P+QV+ KG +L+   I+ ++K 
Sbjct: 241 RQLAN---GKGIAITVNPDDVEFMIRLFRVLKELGNTYPIQVIQKGGELTSPLIEQIKKT 297

Query: 364 AQSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAG-SFTRFKNKWLATSFNLFEEFI 422
           A        ET+        Q +  VD+SP LD   A    T F NK+ A  FN FEE +
Sbjct: 298 A-------IETN--------QAVSIVDLSPILDEKFAREQITSFHNKFFAAMFNTFEEVL 342

Query: 423 LIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYYFG 482
           L+D D V YV L+++F+   Y+ TG  F+RDR       + C  +   L P++ E    G
Sbjct: 343 LLDADVVPYVSLDEFFNLKGYKDTGLQFWRDRNRGSDTHKFCSNLGVYLEPSLEEHNLLG 402

Query: 483 HYRMVDLDY-IERMCEKDLAPNTKVIKSYFIDNLR-HQMDSGLVAVNKKSHIVPLMLSAM 540
                +L + I  + +K +  + +     F + L+ H +DSG++ +NKK  +  L++  +
Sbjct: 403 ----TELKFRINSLAKKKVRSSEERAFHRFFNELKVHNIDSGIIVLNKKQKLHSLIMGEI 458

Query: 541 LHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEIC 600
            +   + G C+YGDKE F +G +A G +F      AG +G       + +++ Q+ + IC
Sbjct: 459 FYTNGRFGRCAYGDKEMFMMGAFATGADFIIDPRDAGIIG------PIGYNIDQRVNFIC 512

Query: 601 TIIIAHLSTEGNLLWANGGAEYCKFEDAAEDDW--KNEKLNMQXXXXXXXXXXXXXXXXX 658
           +  + HL     +LW+NGG  +CKF D A+ D+  KN+   +Q                 
Sbjct: 513 SAQMGHLDENNRVLWSNGGLRFCKFPDFAKKDYTPKNQDYFIQKYQSYDNMARIYKTKVE 572

Query: 659 XXXXGIVPMDKQGAWGSQDGRCRGYSYCA 687
                I+P  ++  W  Q   C+ Y YC 
Sbjct: 573 ITGF-IIPEVEKNEW-MQIPDCQSYMYCG 599

>YGL257C (MNT2) [1743] chr7 complement(12481..14157)
           Mannosyltransferase required for addition of terminal
           mannose residues to O-linked oligosaccharides [1677 bp,
           558 aa]
          Length = 558

 Score =  190 bits (483), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 139/460 (30%), Positives = 221/460 (48%), Gaps = 38/460 (8%)

Query: 239 DFEKRMWPFIR----EFDKKSFSELIPHFTSPDGVALEAGHLP--PLGHSSDYIKKAIKY 292
           D EK+++P+I     E D+ +F       T  +G    A  L   P  H      ++   
Sbjct: 100 DIEKKLFPYINFEKLETDESAFWHTT---TRWNGEVYHASMLEFDPKNHQ---FLRSKPI 153

Query: 293 EYNEKRSFMWNWNHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDL 352
            ++   SF  NW H  +    KGIV+S  D QL    RL+  LR+I N  P+Q+VH  DL
Sbjct: 154 NFDTGLSFWENWLHTVTQSGSKGIVISASDVQLNETIRLLKVLRFIKNDYPIQIVHNADL 213

Query: 353 SEGSIKALQKIAQS-DDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWL 411
           S+ S+K++ K A+S D   +P           QELWF++V   L+P  +  FT + NKWL
Sbjct: 214 SQDSMKSIIKYARSLDTAEYP----------AQELWFLNVHSLLNPKYSKKFTTYSNKWL 263

Query: 412 ATSFNLFEEFILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETL 471
           A +F+ FE  IL+D DTV +V +E+++   E+Q TG LFF+DR  S+        + E+ 
Sbjct: 264 ALTFSSFEIPILMDSDTVPFVSIEKFYELEEFQKTGVLFFKDRVISDD-------LFESS 316

Query: 472 PPNILESYYFGHYRMVDLDYIERMCEKDLAPNT-KVIKSYFIDNLRHQMDSGLVAVNKKS 530
              IL    +G   + DL+   ++ E+   P   +V+++ FI   +H ++SGLV ++K  
Sbjct: 317 ELKILREIVYGCIGL-DLEDESKIHEQVEDPVVAQVLENMFIKKYKHHLESGLVILHKGK 375

Query: 531 HIVPLMLSAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNH 590
           H+  ++ S  L  +  +    +GDK+FFWLG     + F F   P  A  I +    V+ 
Sbjct: 376 HLFSMLTSIALQFS-PIAEYFHGDKDFFWLGELLSNNRFTFH--PVDASNIGQLGNVVSK 432

Query: 591 HLKQKKSEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXX 650
               +  +IC++ ++H   +G+LLW NGG   CK      D    ++LN           
Sbjct: 433 ESTGEFYQICSVQLSHTDRDGSLLWLNGGLNICKKTSWEYDYEHRQRLN---DMFQNADE 489

Query: 651 XXXXXXXXXXXXGIVPMDKQGAWGSQDGRCRGYSYCARYE 690
                       GI+  D   +     G C  ++YC  ++
Sbjct: 490 LREYYASPVKLEGIIIPDTSISGWINSGECFLFNYCTLFK 529

>CAGL0C03982g complement(391909..393798) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 629

 Score =  190 bits (482), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 150/559 (26%), Positives = 243/559 (43%), Gaps = 83/559 (14%)

Query: 138 SEESQCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSRKRENDIA 197
           S + +C +   +LY  +P W+N                      D  E  ++ +  N   
Sbjct: 106 SRQDKCKWLISSLYS-DPNWDN---------------------RDIFEYSKNGQYNNTFK 143

Query: 198 LGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREF---DKK 254
           +  E +R+Y  CFL+  + +  + F ++     S      +DF+KRM  F+R+    D+ 
Sbjct: 144 VAAENLRIYNYCFLN-GNINPLQFFDDL-----SIPFTDAYDFQKRMVIFLRKTSSDDEA 197

Query: 255 SFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQK 314
               LI +  + + +A     L P              EYN   +FM +W   S     K
Sbjct: 198 YLYPLIKNVRNGEIIAKPPTKLSPR-------------EYNS--NFMGHWKRESK---GK 239

Query: 315 GIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPET 374
           GI L+   G +K    L   L+  GN+ P+Q++ KG      +++L K            
Sbjct: 240 GITLTIAPGDIKLLRSLFKVLQRQGNEYPVQIIQKGGEMTPKMESLIK------------ 287

Query: 375 DYEGGQNVKQELWFVDVSPTLDPVMA-GSFTRFKNKWLATSFNLFEEFILIDVDTVHYVD 433
             +     +Q+++ +D++P LDP  A    T+F+NKW A+ FN FEE +L+D D V Y +
Sbjct: 288 --KYALETEQDVYIIDLAPILDPAFAIQRITKFQNKWFASMFNTFEEALLLDADVVLYTE 345

Query: 434 LEQYFHSVEYQHTGTLFFRDR-YSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYI 492
            E +F    YQ TG L +RDR  ++ +  + C A+   L P++ E      Y ++     
Sbjct: 346 PEHFFKMKGYQDTGLLLWRDRELTALETPDRCAALAPHLEPSVEE------YSLLGTRQK 399

Query: 493 ERMCEKDLA----PNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLG 548
            R+ E  L     P  + +  YF   +   +DSG+V  NK+  +  LM +   H++ K  
Sbjct: 400 YRLTESSLKIHNEPEARTLYEYFHKKIVTIIDSGVVVYNKRQKLHALMTAEYFHISRKFA 459

Query: 549 SCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLS 608
            C YGDKE+F  G +A G ++      A A+G      ++ +H  + K  IC+  + H  
Sbjct: 460 GCVYGDKEYFEFGAFAAGEDYHIEKDKASAIG------SIEYHSAKDKYYICSAQMGHAD 513

Query: 609 TEGNLLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMD 668
              NLLW+NGG   CK   AA+D  +N K   +                      I+P  
Sbjct: 514 ENNNLLWSNGGLMNCKANSAADDFNENPKY-FKAKYGDVKTLEAHYSKPIDIQGFIIPDI 572

Query: 669 KQGAWGSQDGRCRGYSYCA 687
            +  W  Q   C+ Y YCA
Sbjct: 573 SKHNW-IQYPECKRYVYCA 590

>YNR059W (MNT4) [4642] chr14 (736800..738542) Protein with strong
           similarity to mannosyltransferases Mnn1p, Mnt2p and
           Mnt3p [1743 bp, 580 aa]
          Length = 580

 Score =  180 bits (457), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 139/508 (27%), Positives = 222/508 (43%), Gaps = 45/508 (8%)

Query: 188 RSRKRENDIALGLERMRMYETCFLD-RKDADMSKMFSNIRNSGNSFSSFTQWDFEK--RM 244
           RSRK    ++  L  + +Y+ C  + R D D+S +  +I      + +FT  + E+    
Sbjct: 86  RSRKDVKTVSRSLSNLDLYQKCSKEIRADQDIS-LLHSIETKLFPYINFTALNSEQSHNF 144

Query: 245 WPFIREFDKKSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNW 304
           WP    FD   +   +  F+S +   +    +                E+     F  NW
Sbjct: 145 WPVHTRFDGTKYRGQVLQFSSENNSFIGTSPI----------------EFKASEPFWENW 188

Query: 305 NHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIA 364
            + +     KG+V+S  +  +    RLI  LR + N LP+++VHK DL E S + L   A
Sbjct: 189 LNSALQRNSKGVVMSVSEYLVADTIRLIRVLRLLNNSLPIEIVHKSDLHESSQQLLIAAA 248

Query: 365 -QSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFIL 423
            +S  + +P           QELWF+DV   L+      F RF NKWLA +F  F+  I 
Sbjct: 249 RESGSLNYP----------PQELWFLDVKDMLNDEYLARFKRFSNKWLAITFCSFQIPIF 298

Query: 424 IDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYYFGH 483
           +D DTV +V L+  +    ++ TGTLFF+DR  S    ++ P  ++ L   I  S     
Sbjct: 299 LDSDTVPFVPLDTLYEIDGFKRTGTLFFKDR--SFPTSKLSPLQVKVLKQIINNSLDVSS 356

Query: 484 YRMVDLDYIERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHM 543
                 + ++     ++A +   I++      +H MDSGLV  +K+ H   L ++ ML  
Sbjct: 357 DSEQGFEILKHNLNDEMAIDA--IEALIFKKQKHYMDSGLVIFDKQKHFFCLPIAIMLQF 414

Query: 544 TDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTII 603
           +  +    +GDKE+FWL  +     F F  + A  VG  ++ + +      + S IC+  
Sbjct: 415 S-PIQEFFHGDKEWFWLSLFISKKEFTFYPIEASNVGRLEKPETL------ESSTICSTQ 467

Query: 604 IAHLSTEGNLLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXG 663
           ++H    GNLLW NGG   CK ++    D+   K  +                       
Sbjct: 468 LSHTDVYGNLLWLNGGLSVCK-KNCWNYDFTKRK-EIAAKYKSVDELRNYYQSPVKLEAV 525

Query: 664 IVPMDKQGAWGSQDGRCRGYSYCARYER 691
           I+P   +  W SQ   C  YSYC  Y +
Sbjct: 526 IIPDVSKSPW-SQQSECVMYSYCTHYRK 552

>Kwal_23.5454
          Length = 583

 Score =  180 bits (456), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 132/430 (30%), Positives = 204/430 (47%), Gaps = 53/430 (12%)

Query: 196 IALGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDKKS 255
           I   ++R+R+Y  CF+    A M+ +  NI             D E R++P         
Sbjct: 101 IISSVQRLRIYGRCFVS-GSAPMNDI--NIS------------DVESRLFPV-------- 137

Query: 256 FSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKG 315
           F+  +P F+  DG   E      L    DY    +K E   K ++   W  +    + KG
Sbjct: 138 FTREVPIFSRWDGSITEGFPEAKLSKK-DY---EVKEEIASKDAY---WKQVKERYSGKG 190

Query: 316 IVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPETD 375
           IV+S G+G +    RL+  LR + N LP+Q+VHKGD+S  S+  + + A    I   +  
Sbjct: 191 IVISIGEGGVDEVIRLLRVLRALKNTLPIQLVHKGDVSASSMNMIIQ-AGRGKIEDKQGI 249

Query: 376 YEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYVDLE 435
           Y       QE+WFV+ + ++       F RF NKW+A+ FN FEE IL+D D V +++ +
Sbjct: 250 YSDISEHPQEIWFVNAARSIKKGNLDLFQRFSNKWIASLFNSFEEMILMDSDVVPFLNPK 309

Query: 436 QYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIERM 495
           + F + EY+ TG  FF+DR   E +     +    L P+  E   F    + D  Y    
Sbjct: 310 ELFDATEYRETGAYFFKDRPIDEFLRSSDLSFYRKLLPSEWEYTAFEMQPLTDHTYGN-- 367

Query: 496 CEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDK 555
                         +     +H M+SG+V +N+++H+  L++SA + +  +     YGDK
Sbjct: 368 -------------GFLKHGYKHFMESGVVVLNRRNHMPGLLISATMQLWKETSQPIYGDK 414

Query: 556 EFFWLGFYAMGH-NFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLL 614
           E FWLG    G+ N+ F+   AGA+G +K   N N+        +C++  AH   E NLL
Sbjct: 415 ELFWLGQSIAGNENYRFNKNEAGAIG-KKGVYNSNNI-----EYVCSVQPAHFDNELNLL 468

Query: 615 WANGGAEYCK 624
           W NGG   CK
Sbjct: 469 WTNGGLRNCK 478

>CAGL0C03938g complement(386673..388586) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 637

 Score =  180 bits (457), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 145/495 (29%), Positives = 225/495 (45%), Gaps = 59/495 (11%)

Query: 201 ERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREF---DKKSFS 257
           ER+R+Y  CF++  + D  ++F  +     +      +DF+ RM+ F+++    DK    
Sbjct: 156 ERVRIYNYCFMN-GNIDPVEVFDEL-----NIPFADPYDFQSRMFMFLKKVNRNDKAYMY 209

Query: 258 ELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIV 317
            LI +  + D +A      P    S+         EYN   +FM +W    +    +GI 
Sbjct: 210 PLIKNVRNGDIIAK-----PRTKMSAK--------EYNA--NFMGHW---KAEARGRGIT 251

Query: 318 LSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPETDYE 377
           L+     +K    L   L  +GN+ P++VVHKG   E + K    I Q            
Sbjct: 252 LTVAPDDIKLLRSLFKVLEKLGNEYPVEVVHKG--GEMTPKMEDLIRQY----------- 298

Query: 378 GGQNVKQELWFVDVSPTLDPVMAG-SFTRFKNKWLATSFNLFEEFILIDVDTVHYVDLEQ 436
             +   QE++ +++SP LDP  A  +   FKNKW A  FN FEE IL+DVD V Y   E 
Sbjct: 299 -AEETNQEVYVINLSPILDPDFASQNIKSFKNKWFAAMFNTFEEAILLDVDVVLYASPEY 357

Query: 437 YFHSVEYQHTGTLFFRDR-YSSEKVEEICPAMIETLPPNILESYYFG---HYRMVDLDYI 492
           +F    Y+ TG + ++DR Y+  +  + C +M     P+  E    G    YR+   D +
Sbjct: 358 FFELDGYKKTGLMLWKDREYTEVETSDRCASMAPYFEPSEEEHELLGTIQKYRLTGPD-L 416

Query: 493 ERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSY 552
           E   E +       +  +F + L   +DSG+V +NKK  +  L+L+A  HM+   G C+Y
Sbjct: 417 ETHNESE----ATTLNDFFNNKLATIIDSGVVLINKKQKLNALLLAAYYHMSKYFGGCTY 472

Query: 553 GDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGN 612
           GDKE F +   A G ++      AGA+G       + +H  ++K  +C+  + H     N
Sbjct: 473 GDKELFEIAALAAGEDYYVDPNKAGAIG------PIGYHPPREKYYVCSAQMGHPDENNN 526

Query: 613 LLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMDKQGA 672
           LLW+NGG + CK  D+AE D+K      +                      IVP   +  
Sbjct: 527 LLWSNGGLKNCKL-DSAEADFKKLPKYFKAKYGSLDTVKLYYKGRSEIQGFIVPDIVKQK 585

Query: 673 WGSQDGRCRGYSYCA 687
           W  Q   C+ Y YCA
Sbjct: 586 W-IQYPDCQHYLYCA 599

>CAGL0H09240g complement(905670..907598) some similarities with
           sp|P40549 Saccharomyces cerevisiae YIL014w MNT3,
           hypothetical start
          Length = 642

 Score =  180 bits (456), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 139/510 (27%), Positives = 226/510 (44%), Gaps = 56/510 (10%)

Query: 201 ERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDKKSFSELI 260
           E MR+Y  CF +  D +  ++F  +        +   +DF+KRM+ F++   ++    L 
Sbjct: 152 ECMRIYNYCFFE-GDVNPRELFKKL-----DLQATDAYDFQKRMFFFLKNVTQEDSDYLY 205

Query: 261 PHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIVLSF 320
           P  T  +    E    P    S          E+N   +F  NW  ++S    +GIVLS 
Sbjct: 206 P--TIKNVRTGEVVSKPKTKQSPQ--------EFNS--NFFANWRKIAS---GRGIVLSA 250

Query: 321 GDGQLKHASRLIAHLRYIGNKLPLQVVHKG-DLSEGSIKALQKIAQSDDITFPETDYEGG 379
               +    + ++  + +GNK P+QVVHKG +L+  +  +L++ A+       ETD    
Sbjct: 251 KPDDIDMLRQQLSVWKELGNKYPIQVVHKGGELTRDNEISLKQFAE-------ETD---- 299

Query: 380 QNVKQELWFVDVSPTLDPVMAGS-FTRFKNKWLATSFNLFEEFILIDVDTVHYVDLEQYF 438
               Q ++ VD  P LD   A    T+F NKW+   FN FEE+I++D DTV ++  E +F
Sbjct: 300 ----QNIYIVDAGPVLDKNFADEHITKFHNKWVGVLFNTFEEYIMVDADTVPFISAEDFF 355

Query: 439 HSVEYQHTGTLFFRDR-YSSEKVEEICPAMIETLPPNILESYYFG---HYRMVDLDYIER 494
            S  ++ +G   +RDR  ++  + E CP +   L P++ E    G    ++++D D  + 
Sbjct: 356 ESENFKKSGMRMWRDRTLTNRHIREHCPDLALKLEPSLEEHRILGTTLRFKLLDPDLKQE 415

Query: 495 MCEKDLAPNTKVIKSYFIDNLR-HQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYG 553
              ++ A N          NL  H +DSGLV +NKK  +  L+LS           CSYG
Sbjct: 416 KTSEERAFNQ------MRTNLALHHVDSGLVVINKKEKLHSLLLSEFFQNHALFRRCSYG 469

Query: 554 DKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNL 613
           DKE FW   ++   ++      A  +G       + +  K ++  IC I +AH  +   L
Sbjct: 470 DKELFWYAAFSANTDYVIEPEDAATIG------KLEYSEKDRRYSICAIQMAHTDSNDQL 523

Query: 614 LWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMDKQGAW 673
           LW N G   CK  + A+ D+      M                       ++P  ++  W
Sbjct: 524 LWTNTGLRNCKIPEVAKKDFDENPKMMTEKYGSLEVMKISYHAPLQIDGYLIPDPEEHEW 583

Query: 674 GSQDGRCRGYSYCARYERHIKPYSFNKMYE 703
             Q   C  Y+YC   +     YS  K++E
Sbjct: 584 -QQTHVCADYTYCGFVDELNIGYSKAKVHE 612

>ABR245C [839] [Homologous to ScYIL014W (MNT3) - NSH]
           (854585..856510) [1926 bp, 641 aa]
          Length = 641

 Score =  179 bits (455), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 131/476 (27%), Positives = 212/476 (44%), Gaps = 46/476 (9%)

Query: 239 DFEKRMWPFIREFDKKSFSELIPHFTSPD-GVALEAGHLPPLGHSSDYIKKAIKYEYNEK 297
           DF +RM+PF+ +  K+ + ++ P  T  + G+  E G           + +  + E ++ 
Sbjct: 184 DFHQRMFPFLAK--KREWRDMWPVITDINTGMTFEGGA----------VWEGRQSEIDDG 231

Query: 298 RSFMWNWNHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKG-DLSEGS 356
            SF  NW   S     KGI +S GDG L+   R++  L Y+GN+LP+++V KG +LS+  
Sbjct: 232 ASFWKNWRSFSH---GKGITMSVGDGHLEMLLRMLTVLDYLGNELPIEIVEKGGELSQQF 288

Query: 357 IKALQKIAQSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFN 416
              L +  ++                KQ++  +  + TLD   A     F  KW+A  FN
Sbjct: 289 RDKLTEFVRNKS--------------KQKVRIISCARTLDETHARLIFGFSCKWVALMFN 334

Query: 417 LFEEFILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNIL 476
            FEE I +DVD V Y+  EQ+F    Y+ TG + FRDR   + V + CP  +  + P   
Sbjct: 335 TFEEAIFLDVDAVPYILPEQFFDMEGYKSTGIMLFRDRLIDQHVSKECPDAVRQMIPTQE 394

Query: 477 ESYYFGHYRMVDLDYIERMCEKDLAPNTK------VIKSYFIDNLRHQMDSGLVAVNKKS 530
           E+  + H       +      K+   NTK      V   +F D+  H ++SG+V  NKK+
Sbjct: 395 ETSIWNH----KAKFSGPAANKEAYDNTKDEGAAAVYDRFFRDHYYHVVESGVVVFNKKN 450

Query: 531 HIVPLMLSAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNH 590
            +  ++ S ML++      C YGDKE  W+G      ++     P   +G  +E +   +
Sbjct: 451 KLQSIVNSFMLNLNFYYVGCFYGDKELMWVGQLLSAEDYYIHPAPPAILGSAEEFEREGN 510

Query: 591 HLKQKKSEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXX 650
            +  +   +C   I H+  +G+LLW NGG   CKF D AE D+                 
Sbjct: 511 TVSYR---VCGAQIGHMELDGSLLWTNGGLRTCKFTDTAEQDFSKSPEYFNPKYSSPQQL 567

Query: 651 XXXXXXXXXXXXGIVPMDKQGAWGSQDGRCRGYSYCARYERHIK-PYSFNKMYEKG 705
                         +P      W  +   C+GY++C+    + + P  F  +  KG
Sbjct: 568 QEHYSKPLEIQLIFIPELTYSVW-EKSVECQGYTWCSTVTLNPENPSEFKSIVMKG 622

>CAGL0C03916g complement(383989..385875) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 628

 Score =  172 bits (436), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 146/534 (27%), Positives = 231/534 (43%), Gaps = 59/534 (11%)

Query: 193 ENDIALGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFD 252
           +N   L  ER+R++  CF+  +  D  +MF+ +     + SS   +DF+ RM+ F+R   
Sbjct: 139 KNKFHLSSERIRIHNYCFMKER-IDPVQMFNEL-----NISSTDAYDFQGRMFMFLRNVT 192

Query: 253 KKSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVA 312
               + + P   +     +  G +    H+     K    +YN   +FM  W   S    
Sbjct: 193 STDEAYIYPIIKN-----VRNGQVTTKPHT-----KLSPMQYNS--NFMAYWKQESK--- 237

Query: 313 QKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFP 372
            +GI L+     +K    L      +GN  P+Q+V KG     ++++L K          
Sbjct: 238 GRGIALTAAPKDVKLLRSLFKVFEKLGNTYPIQIVQKGGEMSPTMESLIK---------- 287

Query: 373 ETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTR-FKNKWLATSFNLFEEFILIDVDTVHY 431
             DY    N  Q ++ VD+SP LDP  A    R F+NKW A+ FN FEE +LID D V Y
Sbjct: 288 --DYAIETN--QNVFIVDLSPVLDPDFATDHIRKFQNKWFASIFNTFEEVMLIDADVVIY 343

Query: 432 VDLEQYFHSVEYQHTGTLFFRDR-YSSEKVEEICPAMIETLPPNILESYYFG---HYRMV 487
            + E +F+   Y++TG L +RDR     K  E C  M     P + E    G    YR+ 
Sbjct: 344 TEPESFFNLDGYKNTGLLLWRDREIVDAKTHERCTDMAPYFEPALEEHRLLGTVQKYRLT 403

Query: 488 DLDYIERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKL 547
                    E    P  + +  +F   +   +DSG+V  NKK  +  L+L+   H + + 
Sbjct: 404 GPS-----LETHDEPEAETLFDFFHRRIVTIIDSGVVIYNKKQKLHGLILAEYFHNSKQF 458

Query: 548 GSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHL 607
             C YGDKE+F  G    G ++      A A+G       V +H  ++K  +C+  + H+
Sbjct: 459 AGCVYGDKEYFEFGALVAGEDYHVEAEKAVAIGA------VGYHPPREKYYVCSGQMGHV 512

Query: 608 STEGNLLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPM 667
               NLLW+NGG + CK  D AE D++      +                      ++P 
Sbjct: 513 DRNNNLLWSNGGLKNCK-SDCAEADFEKMPKYFKAKYGTLKAVKEYYNGLMDIQGFVLPD 571

Query: 668 DKQGAWGSQDGRCRGYSYCARYERHIKPYSFNKMYEKGFLIDFHPDLTTKYDAI 721
            ++  W  Q   C+ + YCA      +P +      KG L+ F  +   +Y+ I
Sbjct: 572 VQKQKW-VQYPDCQQFLYCAFITDPPEPDN------KGKLVRFSDEEKMRYNEI 618

>Scas_643.19
          Length = 657

 Score =  170 bits (431), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 131/500 (26%), Positives = 230/500 (46%), Gaps = 73/500 (14%)

Query: 142 QCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSRKRENDIALGLE 201
           QC F   ++Y  +  W N+      I+  +++E+    A               I L  E
Sbjct: 121 QCRFLIRSMYNADMDWNNSN-----ILEFKDDEKADNTA---------------IVLMSE 160

Query: 202 RMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDKKSFSELIP 261
           R+R+Y+ CF+  K  ++ ++F    N     +     DF+ RM+PF+++ +       IP
Sbjct: 161 RIRLYDYCFISGK-LNLKQVF----NEKLGVNVADVADFQHRMFPFMKKLNIDEMGT-IP 214

Query: 262 HFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIVLSFG 321
             T+ +            G     I K +K   NE  +F  +WN +S     KGIV++  
Sbjct: 215 KITNLNN-----------GKDETPIFKDVK-TVNE--NFFAHWNEVSK---GKGIVINMK 257

Query: 322 DGQLKHASRLIAHLRYIGNKLPLQVVHKG-DLSEGSIKALQKIAQSDDITFPETDYEGGQ 380
           + +      LIA L+ + N LP+Q++  G D  + + +++ +  Q+ D            
Sbjct: 258 ETEKDLFMSLIATLQEVKNTLPIQIITTGQDFEKETFESMNRFLQTTD------------ 305

Query: 381 NVKQELWFVDVSPTLDP-VMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYVDLEQYFH 439
              Q++  +D S  LD   +        +KW  T FN FEE +++D D+V +V  E +F 
Sbjct: 306 ---QQVSLIDCSSILDADFVKEHIASHLHKWFGTLFNTFEEVVILDADSVPFVAPETFFK 362

Query: 440 SVEYQHTGTLFFRDR-YSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIERM-CE 497
           + EY+  G+ FFRD+   +E+  + C  MIE + P+  ES          L +      E
Sbjct: 363 NKEYKDAGSFFFRDKTLGNERTYQYCIEMIEAMEPSKAESGLIN----TKLKFTSNNPPE 418

Query: 498 KDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDKEF 557
            + +P   V  ++F       +DSG+V + KK  +  L++  M+++  K+  C  G+KE 
Sbjct: 419 DNSSPAASVYNTFFGKYKHKNLDSGVVVLKKKEKLTSLLMGFMMNLDAKMKQCVSGEKEL 478

Query: 558 FWLGFYAMGHNFAFSD---MPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLL 614
           FWLG    G ++A        AG VG   + K+      +    IC+  +AH++ + ++L
Sbjct: 479 FWLGHLIAGQDYAIDQWFGTIAGTVGSMNDGKDG----AESTLYICSTQVAHVNKDDDIL 534

Query: 615 WANGGAEYCKFEDAAEDDWK 634
           W NGG   CKF++ A  +++
Sbjct: 535 WINGGLNTCKFKNIASKEFE 554

>CAGL0C03960g complement(389250..391121) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 623

 Score =  169 bits (428), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 163/621 (26%), Positives = 261/621 (42%), Gaps = 90/621 (14%)

Query: 84  DAYGFLKGELPHVTGIAFSPLERIKTYNENMEKKRKASWD----FLGRNNR-FKKFDDLS 138
           D Y + +G L      AF+ +      N+N  + +++  D    F  R+++  K +D+ S
Sbjct: 45  DQYPYAEGLLRSGHNSAFTLIS--NEMNKNQSRDKQSLSDGLTRFFDRDSKVLKNWDNSS 102

Query: 139 EESQCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSRKRENDIAL 198
            + +C +    +Y  +  W N                      D  E       +N   +
Sbjct: 103 RKDKCKWLIRGIY-TDSNWTN---------------------IDILEWTNDATDKNKFQV 140

Query: 199 GLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREF---DKKS 255
             ER+R+Y  CF++  + D  ++F  +     +      +DF+ RM+ F+++    DK  
Sbjct: 141 CSERVRIYNYCFMN-GNIDPVEVFDEL-----NIPFADPYDFQSRMFMFLKKVNRNDKAY 194

Query: 256 FSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKG 315
              LI +  + D +A      P    S+         EYN   +FM +W    +    +G
Sbjct: 195 MYPLIKNVRNGDIIAK-----PRTKMSAK--------EYNA--NFMGHW---KAEARGRG 236

Query: 316 IVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPETD 375
           I L+     +K    L   L  +GN+ P++VVHKG   E + K    I Q          
Sbjct: 237 ITLTVAPDDIKLLRSLFKVLEKLGNEYPVEVVHKG--GEMTPKMEDLIRQY--------- 285

Query: 376 YEGGQNVKQELWFVDVSPTLDPVMAG-SFTRFKNKWLATSFNLFEEFILIDVDTVHYVDL 434
               +   QE++ +++SP LDP  A  +  RF NKWLA  FN FEE +L+D D V Y   
Sbjct: 286 ---AEETNQEVYVINLSPILDPDFAEENIKRFSNKWLAAMFNTFEEVMLLDADVVLYNHP 342

Query: 435 EQYFHSVEYQHTGTLFFRDR-YSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIE 493
           + +F    YQ TG + ++DR  +   V + C AM     P++ E    G  +        
Sbjct: 343 DHFFELKGYQDTGLMLWKDREITDTDVYDKCTAMAPFFEPSLEEHKLLGTTQKY------ 396

Query: 494 RMCEKDLAPNTKVIKSYFIDNLRHQ----MDSGLVAVNKKSHIVPLMLSAMLHMTDKLGS 549
           R+    L  + +   +  ID  R +    +DSG+V  NKK  +  L+LS   H+  K   
Sbjct: 397 RLTGPSLEAHNESEATTLIDYFRKKRLNVIDSGVVIFNKKQKLHALVLSNYYHINRKFLG 456

Query: 550 CSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLST 609
           C +GDKEFF  G  A G ++  +   A A+G       +  H  ++K  +C+  + H   
Sbjct: 457 CVHGDKEFFEFGVLAAGEDYHIAPQRAAALG------PIGFHPGRQKYYVCSTQMGHPDE 510

Query: 610 EGNLLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMDK 669
             N+LW+NGG + CK  D AE D+K      +                      I+P  K
Sbjct: 511 NNNILWSNGGLKNCKL-DKAEADFKRHPEYFKAKYGNVATAKVYYTYRVEIQGFIIPDVK 569

Query: 670 QGAWGSQDGRCRGYSYCARYE 690
           +  W  Q   C  Y YCA  E
Sbjct: 570 KQEW-FQYPDCAHYWYCAFLE 589

>CAGL0H09262g complement(908258..910135) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 625

 Score =  166 bits (421), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 128/443 (28%), Positives = 204/443 (46%), Gaps = 49/443 (11%)

Query: 198 LGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDKKSFS 257
           +  ER+R+Y  CFL +   D+++MF   R    S       D+++RM+PF+R+       
Sbjct: 141 MSAERVRLYNHCFL-QNSYDINEMFEKYRMYYTS-----PHDYQRRMFPFLRKVTAMDGY 194

Query: 258 ELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIV 317
            + P  T+     ++ G +  + +           E+N   +F+ +W + +     +GIV
Sbjct: 195 YIYPTITNLRTGEVQTGPIADMSYQ----------EFNS--NFIAHWKNEAK---GRGIV 239

Query: 318 LSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPETDYE 377
           ++      +         + +GN  P+QVV KG   E   + + KI             E
Sbjct: 240 VTASVNDCRFLRSQFFVWKELGNTYPIQVVTKG--KEMPPELIAKIK------------E 285

Query: 378 GGQNVKQELWFVDVSPTLDPVMAGSFTR-FKNKWLATSFNLFEEFILIDVDTVHYVDLEQ 436
                 QE++ VD+   LDP  A  +   F NKW A  FN FEE IL+D D V YV  ++
Sbjct: 286 YATEADQEVYIVDLQNVLDPNYAEKYIENFHNKWYAAMFNTFEEAILVDADVVSYVHPDE 345

Query: 437 YFHSVEYQHTGTLFFRDRYSSE-KVEEICPAMIETLPPNILESYYFGHYRMVDLDY-IER 494
           YF S +++ TG   +RDR   +  V   C  M     P+  E    G      L Y +E 
Sbjct: 346 YFESADFKKTGLKLWRDRDIPDIHVHIYCLNMAPYFLPSKEEHRTLG----TTLKYRLEE 401

Query: 495 MCEKDLAPN-TKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYG 553
              KD   +    +  +F +     +DSGLV  NKK  +  L++S   H   K   C+YG
Sbjct: 402 ESLKDAGTSEADGLHKFFFEKSGSIVDSGLVVFNKKKKLHSLIISEFFHTDAKFKPCTYG 461

Query: 554 DKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNL 613
           DKE F LG Y+ G +++     A  +G  +E  N      +K + IC+  + H +  G L
Sbjct: 462 DKEIFMLGAYSAGVDYSLDPEAAVIIGPIRESTN------KKFNSICSAQMGHTNGRGKL 515

Query: 614 LWANGGAEYCKFEDAAEDDWKNE 636
           LW+NGG + CK  + A+DD++ +
Sbjct: 516 LWSNGGLQVCKNPNFAKDDFEKD 538

>CAGL0C04026g complement(397303..399213) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 636

 Score =  159 bits (402), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 137/505 (27%), Positives = 217/505 (42%), Gaps = 74/505 (14%)

Query: 134 FDDLSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSRKRE 193
           +D  S+  QC       Y ++PKW+N       I+ + EE          KE  R     
Sbjct: 113 WDKASKADQCALLLQGFY-LDPKWDN-----ADILTEREE----------KEDYR----- 151

Query: 194 NDIALGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDK 253
            ++ L +ERMR Y+ CF+D +D D+   F         FS    + F+K+++ F+++ D 
Sbjct: 152 -NMQLAIERMRTYKYCFMD-EDIDILDTFK-----AAGFSPNEAYVFQKKLFMFLKQTDG 204

Query: 254 KSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQ 313
            +   L P   +     +       L  S          EYN K  F+  W +M+     
Sbjct: 205 STTEYLYPRIENLRTGVITEEPTTDLSVS----------EYNAK--FIPTWRNMAK---G 249

Query: 314 KGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPE 373
           KGI +S    +++    L A L   GNKLP+Q++ KG+    + K L K           
Sbjct: 250 KGIAVSVSPKEIRMLHSLFAVLNQQGNKLPIQIIDKGETLTLADKELIK----------- 298

Query: 374 TDYEGGQNVKQELWFVDVSPTLDPVMAG-SFTRFKNKWLATSFNLFEEFILIDVDTVHYV 432
             Y    N  Q++  VD+SP +D   A  +     NKW A  FN FEE +L+DVD + +V
Sbjct: 299 -SYAVKTN--QDVSVVDLSPIIDAEYADENIIGMHNKWFAAMFNTFEEVLLLDVDVIPFV 355

Query: 433 DLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYI 492
             E++F    Y     LF+R+R   +K  + CP     L P   E      ++++  D  
Sbjct: 356 GTEKFFQLEPYTSRHILFWRNRDIKKKNPKYCPEAAIFLEPTTEE------HQVLKTDLH 409

Query: 493 ERMCEKDLA-PNT---KVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLG 548
            ++  K +  P T   K +  +      + +D GL+  NKK       ++ +LH  D   
Sbjct: 410 HKLFTKQVRNPATSEDKALSEFCFQRKSNHVDPGLIVFNKKLRFQTFAITELLHQHDTFR 469

Query: 549 SCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLS 608
           +C     +   LG +A G  F      AG VG      ++++    K + +C   IAH  
Sbjct: 470 ACVGTGADALILGAFAAGETFRLDPRDAGIVG------SISYSEADKMNFVCGTQIAHND 523

Query: 609 TEGNLLWANGGAEYCKFEDAAEDDW 633
            + NLLW +GG   CK  D   +D+
Sbjct: 524 DKDNLLWISGGGRTCKNPDLLVEDF 548

>AFL235W [2960] [Homologous to ScYIL014W (MNT3) - NSH; ScYER001W
           (MNN1) - NSH] complement(2..1147) [1146 bp, 381 aa]
          Length = 381

 Score =  153 bits (386), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 111/381 (29%), Positives = 172/381 (45%), Gaps = 30/381 (7%)

Query: 331 LIAHLRYIGNKLPLQVVHKGDLSEG-SIKALQKIAQSDDITFPETDYEGGQNVKQELWFV 389
           L+A L + GN LP+++V    L+E  S + +QKIA           +      KQ L  V
Sbjct: 1   LLAVLDHHGNTLPIELV----LTESPSHERIQKIA-----------HYLRDKTKQSLRIV 45

Query: 390 DVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYVDLEQYFHSVEYQHTGTL 449
           D    L+P        F+ KWLA   N  EE + ID+D V +V ++++F    Y+ TG L
Sbjct: 46  DCKKILEPSYRPLIFDFRYKWLAYLLNSSEEVVFIDLDVVPFVSIDKFFEMEGYKSTGIL 105

Query: 450 FFRDRYSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIERMCEK--DLAPNTKVI 507
            F+DR  +      C   I  + P+  E   + H      +  +   +   D A    V 
Sbjct: 106 MFQDRVFNSIKNSKCRTAIHHILPSHAEQTLWKHQAKYTKEKAKHRLKNFPDDAGAASVY 165

Query: 508 KSYFIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDKEFFWLGFYAMGH 567
             Y   +  H ++SGLV V+K+  I  L++S MLHM   +  CSYGDKE+ WLG    G 
Sbjct: 166 DRYLEGDRMHMVESGLVVVDKRKKISSLIISLMLHMN--IAECSYGDKEYLWLGQLVSGE 223

Query: 568 NFAFSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLLWANGGAEYCKFED 627
           ++    +P   +G+ +E K    H  +KK E+C+  IAH+  +G++LW NGG + CKF +
Sbjct: 224 DYYIHPLPPAILGMPQEVK----HDNKKKYEVCSTQIAHMDHDGSILWVNGGMQNCKFPE 279

Query: 628 AAEDDWKNEKLNMQXXXXXXXXXXXXXXXXXXXXXGIVPMDKQGAWGSQDGRCRGYSYCA 687
            A+ + ++                             +P      W +    C  Y++CA
Sbjct: 280 FADSEVESNNEYFSSQHSDKEVLRKFYESPINIQMAFIPNLVDSNWHAI-ATCNSYTWCA 338

Query: 688 RYERHIKPYSFNKMYEKGFLI 708
                IKP  F +   +G  I
Sbjct: 339 E----IKP-DFTESSSRGNFI 354

>CAGL0G04279g complement(404144..406126) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 660

 Score =  146 bits (368), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 132/546 (24%), Positives = 237/546 (43%), Gaps = 82/546 (15%)

Query: 108 KTYNENMEKKRKASWDFLG----------RNNRFKKFDDLSEESQCYFYFHNLYEINPKW 157
           K Y    E  R+  W  L             N    ++  S+  +C      LY+ +PKW
Sbjct: 81  KAYKMEQENNRQQQWKNLLFWKPLTVEQLEYNTLPYWNAASDLDRCSLLVKALYDGDPKW 140

Query: 158 ENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSRKRENDIALGLERMRMYETCFLDRKDAD 217
            N+                  +  +   A++    +  +   +ER+RMY  CFLD K  D
Sbjct: 141 NNS----------------EILVWNKDMAMK----KYSLLHPVERIRMYNHCFLD-KGVD 179

Query: 218 MSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIREFDKKSFSELIPHFTSPDGVALEAGHLP 277
           + ++F  +             +F  RM+P  +  +  S   L P  T      L  G + 
Sbjct: 180 VIQVFKKL-----GLDEHNATEFNHRMFPMFQFVNVTSDQYLYPKLTD-----LRTGKVI 229

Query: 278 PLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRY 337
               +    ++A++Y  N    F+ NW + +     KG+V++     L    +L   L+ 
Sbjct: 230 TKPKTK---QRALEYNLN----FLRNWRNEAK---GKGLVITIESNNLHILRKLFKFLKE 279

Query: 338 IGNKLPLQVVHKGDLSEGSIK-ALQKIAQSDDITFPETDYEGGQNVKQELWFVDVSPTLD 396
            GN LP+Q+V K +++    K A+   A+  D               Q +  +++   +D
Sbjct: 280 NGNTLPIQLVFKRNVTLARFKDAIISYAEESD---------------QHVTIIEIEALID 324

Query: 397 PVM-AGSFTRFKNKWLATSFNLFEEFILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRY 455
                G+F  + +K+LA+ FN FE+ +++D++ + YV+ E+   + EY+++G   +RD+Y
Sbjct: 325 DSFNKGTFVGYDDKFLASIFNTFEDVVMMDIEVIPYVNPEELLENEEYKNSGLYMWRDKY 384

Query: 456 SSEKVEE-ICPAMIETLPPNILESYYFGHYRMVDLDYIERMCEKDLA----PNTKVIKSY 510
               +   IC  ++++L P++ E      Y+ +   +  RM +  L     P   ++  Y
Sbjct: 385 LGALLHAYICTDVMKSLEPSMDE------YKTIGSKFPLRMNDPRLTDTSDPMGAILHGY 438

Query: 511 FIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFA 570
           +   L HQ+D G++ +NKK  +  L++  +++M      CS G KE FW G Y  G  FA
Sbjct: 439 YNLYLMHQVDGGVILLNKKQKLGGLIMGMVMNMHRDYAHCSTGTKEAFWFGPYVAGMEFA 498

Query: 571 FSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAE 630
              + AG +G  +    +   L     EIC+  + H+  E  LLW  G    C+ +   E
Sbjct: 499 VGTIDAGIIGPIRRS-TIEDRLGV--PEICSNQVIHVDHEDKLLWGKGTFYECESDKLQE 555

Query: 631 DDWKNE 636
            D ++E
Sbjct: 556 IDIESE 561

>CAGL0C03894g complement(381514..383397) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 627

 Score =  145 bits (366), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 126/462 (27%), Positives = 212/462 (45%), Gaps = 85/462 (18%)

Query: 196 IALGLERMRMYETCFLDRKDADMSKMFSNIRNSG-----NSFSSFTQWDFE-KRMWPFIR 249
           +A   E +R+Y  CF+D  + +  +++    N+G     N F  F +   + + MWP + 
Sbjct: 130 VAAMAESIRLYNFCFID-GNINSFELYGQENNAGATVLLNDFFPFLKAHTDGEHMWPEVT 188

Query: 250 EFDKKSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSS 309
             +K     ++P+F       LEA                    +N   +F  NW   + 
Sbjct: 189 HLNKDKI--ILPNFD------LEAVD-----------------TFNA--NFWINWKKHAR 221

Query: 310 LVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGD-LSEGSIKALQKIAQSDD 368
               +GIV++F + +     +LIA L ++ N+LP+Q+V +G+     +I+ L++ A    
Sbjct: 222 ---GRGIVVTFKEEEANMMMKLIAVLGHLKNRLPIQIVIQGNKFGSRTIEMLKEKAIEK- 277

Query: 369 ITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTR-FKNKWLATSFNLFEEFILIDVD 427
                         KQ+++ VD +  L    A    + + NKW+A+ FN FEEFIL+DVD
Sbjct: 278 --------------KQQIYIVDATKLLMEKYAEVHIQGYTNKWIASIFNTFEEFILLDVD 323

Query: 428 TVHYVDLEQYFHSVEYQHTGTLFFRDR-YSSEKVEEICPAMI----------ETLPPNIL 476
           TV +++ +++F    Y+ TG   ++DR   +EK+   C  +I            L    L
Sbjct: 324 TVPFINPKKFFEKKGYRTTGFYMYQDRNLVNEKLGRKCVDIISGAQLSGYEARVLNTGFL 383

Query: 477 ESYYFGHYRMVDLDYIERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLM 536
            S YF      + DY           + +     F +   HQ +S LV +NKK  +  L+
Sbjct: 384 YSPYFAR----EDDYT--------TASARAYYKLFNNWTLHQAESVLVVINKKQKLGGLL 431

Query: 537 LSAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVG--IQKEEKNVNHHLKQ 594
           +S ML+    L  C  GDKEFFW+G       +   + PA  VG      ++  N++   
Sbjct: 432 MSFMLNTQIALKQCFLGDKEFFWIGQLMNNSPYYIDERPATIVGPLSSPTDEQSNYY--- 488

Query: 595 KKSEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAEDDWKNE 636
              +IC+  + HL  +G L W NGG + CKF++AA  D+ ++
Sbjct: 489 ---KICSAQLGHLGEDGKLDWVNGGMQVCKFKNAAMKDFTDD 527

>ADR020C [1761] [Homologous to ScYIL014W (MNT3) - SH]
           (740415..742229) [1815 bp, 604 aa]
          Length = 604

 Score =  130 bits (328), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 121/514 (23%), Positives = 205/514 (39%), Gaps = 87/514 (16%)

Query: 131 FKKFDDLSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDEEEERLSTVAEDTKEAIRSR 190
           F  + + S   +C  YF   YE++  WEN       ++ +E++     VA          
Sbjct: 68  FGGWGERSLRMRCKTYFRQTYEVHNAWENR-----LLLRNEDQYFKDIVA---------- 112

Query: 191 KRENDIALGLERMRMYETCFLDRKDADMSKMFSNIRNSGNSFSSFTQWDFEKRMWPFIRE 250
                 +L +ER+R+Y+ CF+    A    M   +          T+ +   RM+PF+  
Sbjct: 113 ------SLAMERLRVYDECFISGGLAVHDSMLEPL----------TRIELRTRMFPFLAP 156

Query: 251 FDKKSFSELIPHFTSPDGVALEAGHLPPLGHSSDYIKKAIKYEYNE------KRSFMWNW 304
             ++   +LI     P  +   +G          +I++ +K    E       RSF +NW
Sbjct: 157 SHRQ---DLI----WPTVINATSGR---------HIRRLLKISTGELHRIRPDRSFWYNW 200

Query: 305 NHMSSLVAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKG-DLSEGSIKALQKI 363
              ++    +GI ++  D        L+A L ++GN LP+Q  H G +LS+     L   
Sbjct: 201 REFAN---GRGIAVAVNDELADSFQALLAVLDHLGNTLPVQAAHNGGELSQRRFDELAAH 257

Query: 364 AQSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFIL 423
            Q+              + +Q+++FVD +PTL  +    F R     LA  FN F+EF+L
Sbjct: 258 IQA--------------HSRQQVFFVDCTPTLRNMWLRKFARVPPSRLAALFNSFDEFVL 303

Query: 424 IDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYYF-- 481
           +D   V +V   Q     E+  T  LFF+ R  + + +  C   +  L P+  E+  +  
Sbjct: 304 LDASAVPFVPPAQLLALPEFADTAALFFKGRAYTTQPQRSCLHSMARLLPSAEEARLWRG 363

Query: 482 ----GHYRMVDLDYIERMCEKDLAPNTKVIKSYFIDNLRHQMDSGLVAVNKKSHIVPLML 537
                                       ++++  +D L    D  LV V K   +  L+ 
Sbjct: 364 AAAFNASGAAAAFNASGAAAARDGAAAALVRAGLVDGL----DHALVLVRKPRALAALLA 419

Query: 538 SAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVNHHLKQKKS 597
           + +L +  +   C    +  F L  +AM   +A     AGA+G       ++        
Sbjct: 420 ALLLDLQPRAPGCRPHARSLFPLALHAMALPYAVHPGAAGALG------ELDPAAPADCP 473

Query: 598 EICTIIIAHLSTEGNLLWANGGAEYCKFEDAAED 631
            +C+  +AHL   G LLWA+GG   C   DA  D
Sbjct: 474 VLCSAQLAHLDAAGRLLWASGGLRRCHTSDARRD 507

>CAGL0B03003g 295997..297019 some similarities with sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 340

 Score =  109 bits (273), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 86/314 (27%), Positives = 140/314 (44%), Gaps = 20/314 (6%)

Query: 415 FNLFEEFILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSEKVE-EICPAMIETLPP 473
           FN FEE ++++ D   ++     F S +Y+++G  F++ R + +  +   C    + L P
Sbjct: 2   FNTFEEALVMEPDVSFFLSANTVFDSEDYKNSGFKFWKGRNTRKDAQFPHCKVFTQALEP 61

Query: 474 NILESYYFGHYRMVDLDYIERMCEKDL-APNT---KVIKSYFIDNLRHQMDSGLVAVNKK 529
           ++ E      + M+  + + R+    L +PNT   K + SY+     H  D+G+  +NKK
Sbjct: 62  SLEE------FNMIHSELVVRLDNPSLESPNTEQEKALSSYYTYGGLHYADNGVYVINKK 115

Query: 530 SHIVPLMLSAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFAFSDMPAGAVGIQKEEKNVN 589
                L+ +A L    K   CS G+ EF WLG + +G+NF    + AG +G  K E   +
Sbjct: 116 QAFEGLLGAATLLSHKKYRRCSDGENEFMWLGMFTVGNNFVSDSIDAGILGEIKLE---S 172

Query: 590 HHLKQKKSEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAEDDWKNEKLNMQXXXXXXXX 649
              ++  + +C   ++H    G L+W+  G   CKFE+AA +D+  +             
Sbjct: 173 EGPRRGYAYVCGTQVSHSDDVGRLVWSKDGLVTCKFENAAHEDFSRDSQYFTDRYLDEHN 232

Query: 650 XXXXXXXXXXXXXGIVPMDKQGAWGSQDGRCRGYSYCARYERHIKPYSFNKMYEKGFLID 709
                         IVP  ++  W  Q   CR   YCA Y  H+K    N   E G L  
Sbjct: 233 LDEIYKSKLNINGFIVPDTRKNPW-KQISECRATMYCA-YIPHLKS---NTDDEGGILAS 287

Query: 710 FHPD-LTTKYDAIN 722
           F    LT   D +N
Sbjct: 288 FGGGYLTHIKDVVN 301

>KLLA0A11880g 1026919..1028190 some similarities with
           ca|CA0854|IPF8854 Candida albicans, hypothetical start
          Length = 423

 Score =  108 bits (269), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 78/226 (34%), Positives = 113/226 (50%), Gaps = 24/226 (10%)

Query: 239 DFEKRMWPFIREFDKKSFSELIPHFTSPDGVALEAGHLPPLGH-SSDYIKKAIKYEYNEK 297
           D E R++P         F++ IP FT  DG + +    P L +   D I+ A + E +  
Sbjct: 130 DIETRLFPM--------FTKKIPVFTRWDGFSPD--EFPILSNLPKDNIEHASRIEGSPT 179

Query: 298 RSFMWNWNHMSSLVAQKGIVLSFGDG-QLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGS 356
            SF   W         +GIV+S  DG ++     L+  LR + N+LP+QVVHKGDLS+ S
Sbjct: 180 GSF---WRTAKERYNGRGIVISVSDGIRVNEVKSLMRTLRLLKNRLPIQVVHKGDLSDYS 236

Query: 357 IKALQKIAQSDDITFPETDYEGGQNVK----QELWFVDVSPTLDPVMAGSFTRFKNKWLA 412
           I  +    ++       T   GG+++     QE+WFV+    +       F RF NKW+A
Sbjct: 237 IGEIVNAGRAK-----LTIEIGGEDLDVEYPQEVWFVNAGNCITQESLRLFQRFNNKWIA 291

Query: 413 TSFNLFEEFILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRDRYSSE 458
           + FN FEE IL+D D    V+  + F + EY   G  FFRDR  +E
Sbjct: 292 SLFNSFEEMILMDTDVAPVVNPAELFETKEYLDNGAHFFRDRLLNE 337

>KLLA0A11891g 1028064..1028672 similar to sp|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 alpha-1, 3-mannosyltransferases
           responsible for adding the terminal mannose residues of
           O-linked oligosaccharides, hypothetical start
          Length = 202

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 83/194 (42%), Gaps = 20/194 (10%)

Query: 519 MDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDKEFFWLGFYAMGH-NFAFSDMPAG 577
           M+SG+V +N+  ++  L+++ +L +        +GDKE FWLG    G+ ++ F+     
Sbjct: 1   MESGVVTINRSKNLPGLLIATVLQLWQPTSEPFHGDKELFWLGQSISGNEDYQFNRYAGS 60

Query: 578 AVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAEDDWKNEK 637
            +G       + H+  +    +C+  I H      LLW NGG + CKF  +  D  KN+ 
Sbjct: 61  DIG------TLEHNDHEDSVHVCSTQIGHFDENFRLLWINGGLKTCKFPSSGYDYSKNKA 114

Query: 638 LNMQXXXXXXXXXXXXXXXXXXXXXGIVPM---DKQGAWGSQ-----DGRCRGYSYCARY 689
           L  +                      +VPM   D +   GS      D  C GY +CA  
Sbjct: 115 L--RRVFQSADDLKKHYESAIVIDGALVPMYPLDIKKVQGSMFKQNYDLGCLGYVWCASN 172

Query: 690 E---RHIKPYSFNK 700
                ++K  SFN+
Sbjct: 173 SPGTPNVKTVSFNE 186

>CAGL0B02992g 294927..296054 some similarities with sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, start by
           similarity
          Length = 375

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/336 (20%), Positives = 139/336 (41%), Gaps = 63/336 (18%)

Query: 43  VVIAAFVMLYVESTKYGQLAKIAKVA-PELNGATYSEPSSSH-DAYGFLKGELPHVTGIA 100
           VV    ++L+     +G++A    ++ P + G  Y+ P +S   A+ FL  +L H+  +A
Sbjct: 27  VVATVLLLLHTLKAYHGKVALRPVLSRPHVEGYEYTLPGASQKSAFRFL--DLAHLETLA 84

Query: 101 FSPLERIKTYNENMEKKRKASWDFLGRNNRFKKFDDLSEESQCYFYFHNLYEINPKWENN 160
                    + +  E +R  +         FK++  LS   QC      +Y  +P+W   
Sbjct: 85  AESSPGSGLFKKATEAQRDLA--------MFKEWASLSRMDQCRLLVKGIYVTDPQW--- 133

Query: 161 YSKWGFIVNDEEEERLSTVAEDTKEAIRSRKRENDIALGLERMRMYETCFLDRKDADMSK 220
                   + +E   + TV++D++          ++AL LER+R+Y  CF         +
Sbjct: 134 --------STKELFGIETVSDDSRA---------ELALALERLRIYNYCFKHESSVTPYE 176

Query: 221 MFSNI----------------RNSGNSFSSFTQWDFEKRMWPFIREFDKKSFSELIPHFT 264
           +F ++                R +    +     D+++RM+PF+++    SF +    + 
Sbjct: 177 LFHSMTLPREVMAKMDLPPYERMNKKQLALALAVDYQRRMFPFLKK-TGASFGK----YL 231

Query: 265 SPDGVALEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIVLSFGDGQ 324
            P  + L  G +     S+    K+  +EYN   +F+ +W   S     +GIV+      
Sbjct: 232 HPKLINLRTGKM-----SNQPTVKSALHEYNS--NFIQHWVRQS---YGRGIVIPMDYTD 281

Query: 325 LKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKAL 360
           LK     +   + + N LP+Q+V    +    ++ +
Sbjct: 282 LKELYHNLKVWQTLKNTLPIQLVFSNTVVTAEVQEI 317

>Kwal_27.11456
          Length = 496

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 435 EQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIER 494
           ++   + + ++  +LF ++ ++  +V  I     E++ PN+L+SY    + + +    E+
Sbjct: 33  QKILQNQQIEYARSLFSKNSHTPVRVSSIIVNNAESIRPNVLQSYL--DHTIGEATTFEQ 90

Query: 495 MCEKDLAPNTKVIKSYFIDNLRHQMDS 521
           +CE+    N K+I +  ++N    +DS
Sbjct: 91  LCEQSDILNMKLIANGLVNNSTQTIDS 117

>KLLA0C16467g 1442002..1443825 weakly similar to sp|P46982
           Saccharomyces cerevisiae YJL186w MNN5 putative
           mannosyltransferase, start by similarity
          Length = 607

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 117/290 (40%), Gaps = 59/290 (20%)

Query: 311 VAQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDIT 370
             ++GIV   G      +  +I  +R  G+KLP++VV               I   D+  
Sbjct: 160 ATKRGIVTVGGRRYSLLSYLMINMVRRSGSKLPIEVV---------------IPPDDE-- 202

Query: 371 FPETDYEGG--QNVKQELWFVDVSPTLDPVMAG-SFTRFKNKWLATSFNLFEEFILIDVD 427
            PET++     Q   + ++F D  PT   ++A  S   ++ K +A   + F+EF+LID D
Sbjct: 203 -PETEFCESILQFNARCIYFKDRLPT--SLLANLSVKSYQVKGIALLLSSFQEFVLIDSD 259

Query: 428 TVHYVDLEQYFHSVEYQHTGTLFFRD---RYSSEKVEEICPAMIETLPPNILESYYFGHY 484
            +   ++++ F    ++  G + + D   R +S +  ++    I+           F   
Sbjct: 260 NMPLKNIDEVFDYNVFRDHGMVIWPDIWRRMTSPQFYQLAEVPID-----------FTKR 308

Query: 485 RMVDLDYIERMCEKDLAPNT------KVIKSYFIDNLRH-QMDSGLVAVNKKSHIVPLML 537
                D +  +   D   NT      KV    F+  L     +SG + VNKK+H+  L+L
Sbjct: 309 VRNAGDELSPVSRYDKLENTVSENKAKVPMHDFLGTLPDPTTESGQMIVNKKTHLKMLLL 368

Query: 538 SAMLHMTD--------KLGSCSYGDKEFFWLG-------FYAMGHNFAFS 572
           +   +             G+   GDKE F +        FY +   F F+
Sbjct: 369 ALYYNQYGPEYYYQLFSQGTSGQGDKETFAMAAHILKEPFYQVKKTFGFA 418

>YBR015C (MNN2) [208] chr2 complement(267672..269465)
           Mannosyltransferase required for forming and extending
           the mannose branches of the outer chain mannans [1794
           bp, 597 aa]
          Length = 597

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 69/155 (44%), Gaps = 24/155 (15%)

Query: 306 HMSSLVAQKGI-----VLSFGDGQLK-HASRLIAHLRYIGNKLPLQV-VHKGDLSEGSIK 358
           H+++LV+ KG      + + G G+    A  +I  LR +G  LP++V +  GD  EG  +
Sbjct: 157 HIATLVSPKGTYKGSGIATVGGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPGD--EGETE 214

Query: 359 ALQKIAQSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLF 418
              KI        P+ +        + ++  D+ P  + +    F  ++ K LA   + F
Sbjct: 215 FCNKI-------LPKYN-------SKCIYVSDILPR-ETIEKFVFKGYQFKSLALIASSF 259

Query: 419 EEFILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRD 453
           E  +L+D D      L+  F+   Y  TG + + D
Sbjct: 260 ENLLLLDADNFPIKPLDNIFNEEPYVSTGLVMWPD 294

>CAGL0I04532g 404659..406497 similar to sp|P38069 Saccharomyces
           cerevisiae YBR015c TTP1 type II membrane protein, start
           by similarity
          Length = 612

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 58/140 (41%), Gaps = 17/140 (12%)

Query: 314 KGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPE 373
           +GIV   G      A  +I  LR +G  LP++V    D  E               TF E
Sbjct: 176 EGIVTVGGGKFTLMALTMIKALRTLGTTLPVEVFIPPDEGES--------------TFCE 221

Query: 374 TDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYVD 433
           +     Q   + ++  D+ P  D +   +F  ++ K LA   + FE  +L+D D +    
Sbjct: 222 SVLP--QYNAKCIYISDILPD-DMIQKFTFKGYQFKSLAMITSSFENLLLLDADNIPVKK 278

Query: 434 LEQYFHSVEYQHTGTLFFRD 453
           ++  F S  ++  G + + D
Sbjct: 279 IDHIFESQIFRSAGLILWPD 298

>Scas_716.77
          Length = 608

 Score = 33.5 bits (75), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 102/274 (37%), Gaps = 54/274 (19%)

Query: 315 GIVLSFGDGQLKHASRL-IAHLRYIGNKLPLQVVHKGDLSEGSIK-ALQKIAQSDDITFP 372
           GIVL  G G+    S L I  +R +G  LP++V    +  EG  +   Q I+  D     
Sbjct: 190 GIVL-VGGGKFSLLSYLVIKTIRNLGTTLPIEVFIPPNEVEGESEFCSQTISDLD----- 243

Query: 373 ETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYV 432
                      + ++  D+ P  D V    F  ++ K LA   + FE  +L+D D     
Sbjct: 244 ----------AKCIYISDILPK-DMVSKFEFKGYQFKSLAIIASSFENLLLLDADNTPIK 292

Query: 433 DLEQYFHSVEYQHTGTLFFRDRYSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYI 492
           +L   F    Y   G + + D +   +  +     I  +P N+ +          D+D  
Sbjct: 293 NLNTIFKQEPYASRGLVLWPDFW--RRTTQPIYYKIAGIPVNLQKRV------RNDID-- 342

Query: 493 ERMCEKDLAPNTKVIKSYFIDNLRHQM---------DSGLVAVNKKSHIVPLMLSAMLHM 543
                 DL P     K   +D   H           +SG + VNK  H+  ++L+   ++
Sbjct: 343 ------DLTPVGVYTKPDMVDIPFHDFEGTMPDVSTESGQLMVNKSKHLATVLLALYYNV 396

Query: 544 TD--------KLGSCSYGDKEFFWLG--FYAMGH 567
                        +   GDKE F  G  FY + +
Sbjct: 397 NGPNWYYPIFSQKAAGEGDKETFIAGANFYDLPY 430

>CAGL0G09867g complement(942215..944149) similar to sp|Q06623
           Saccharomyces cerevisiae YPR179c PLO1, start by
           similarity
          Length = 644

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 25/37 (67%)

Query: 408 NKWLATSFNLFEEFILIDVDTVHYVDLEQYFHSVEYQ 444
           N WL T+ +L+++ +   + ++HY D+ +YF + +Y+
Sbjct: 30  NYWLPTTMSLYQKELTDQIVSLHYSDILRYFETTDYK 66

>YJL186W (MNN5) [2738] chr10 (80153..81913) Mannosyltransferase
           required for forming and extending the mannose branches
           of the outer chain mannans [1761 bp, 586 aa]
          Length = 586

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 55/142 (38%), Gaps = 16/142 (11%)

Query: 312 AQKGIVLSFGDGQLKHASRLIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITF 371
             +GIV   G      A  +I  LR  G  LP++V          I   Q   + D    
Sbjct: 148 GSEGIVTIGGGKYSVLAYTMIKKLRDTGTTLPIEV----------IIPPQDEGEDDFCKN 197

Query: 372 PETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHY 431
               + G     + ++F D+ P+  P+     T F+ K      + F+  I +D D    
Sbjct: 198 WLPKFNG-----KCIYFSDIVPS-KPLSDLKLTHFQLKVFGLIISSFKRIIFLDADNYAV 251

Query: 432 VDLEQYFHSVEYQHTGTLFFRD 453
            +L+  F++  +  TG + + D
Sbjct: 252 KNLDLAFNTTSFNDTGLILWPD 273

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,521,660
Number of extensions: 1118332
Number of successful extensions: 3111
Number of sequences better than 10.0: 48
Number of HSP's gapped: 3057
Number of HSP's successfully gapped: 49
Length of query: 722
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 613
Effective length of database: 12,822,747
Effective search space: 7860343911
Effective search space used: 7860343911
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)