Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.181754754019890.0
AAR158W5711934753e-52
YBR215W (HPC2)6232114492e-48
KLLA0C05676g511623333e-33
CAGL0K06721g4381783083e-30
Scas_686.20515622991e-28
CAGL0G06776g18233645.6
Sklu_2029.335147648.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.1817
         (540 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.1817                                                          770   0.0  
AAR158W [346] [Homologous to ScYBR215W (HPC2) - SH] complement(6...   187   3e-52
YBR215W (HPC2) [396] chr2 (653403..655274) Protein required for ...   177   2e-48
KLLA0C05676g 506539..508074 weakly similar to sp|Q01448 Saccharo...   132   3e-33
CAGL0K06721g 654788..656104 some similarities with sp|Q01448 Sac...   123   3e-30
Scas_686.20                                                           119   1e-28
CAGL0G06776g 647706..648254 similar to sp|P25348 Saccharomyces c...    29   5.6  
Sklu_2029.3 YPL118W, Contig c2029 4306-5361                            29   8.1  

>Kwal_14.1817
          Length = 547

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/540 (76%), Positives = 414/540 (76%)

Query: 1   MELAKNRTSVRNLSPSPHSNSSIPLVSLLSGDPASVKVDPEIRQATMANISRVKVSSLLS 60
           MELAKNRTSVRNLSPSPHSNSSIPLVSLLSGDPASVKVDPEIRQATMANISRVKVSSLLS
Sbjct: 1   MELAKNRTSVRNLSPSPHSNSSIPLVSLLSGDPASVKVDPEIRQATMANISRVKVSSLLS 60

Query: 61  SDSTDEHEHETKVAQKIILPTQKVVAKAASDPVPGILVARTSSPVSALPKTNNTALNRSQ 120
           SDSTDEHEHETKVAQKIILPTQKVVAKAASDPVPGILVARTSSPVSALPKTNNTALNRSQ
Sbjct: 61  SDSTDEHEHETKVAQKIILPTQKVVAKAASDPVPGILVARTSSPVSALPKTNNTALNRSQ 120

Query: 121 STLSPLNSIKTASGEGKTAALAGKTASLSSISSKPAVKRTAAKKENGXXXXXXXXXXXXX 180
           STLSPLNSIKTASGEGKTAALAGKTASLSSISSKPAVKRTAAKKENG             
Sbjct: 121 STLSPLNSIKTASGEGKTAALAGKTASLSSISSKPAVKRTAAKKENGSVKKTKPESSKKK 180

Query: 181 DAIQTETKPVAKATSARKPAKPXXXXXXXXXXXXXXXXXXXXDMQNSKKAPEEAPVTVAG 240
           DAIQTETKPVAKATSARKPAKP                    DMQNSKKAPEEAPVTVAG
Sbjct: 181 DAIQTETKPVAKATSARKPAKPRESRAKKSEKETKASKIIIEDMQNSKKAPEEAPVTVAG 240

Query: 241 EETKVEVKVADLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSEAKKDAVATPKLKE 300
           EETKVEVKVADL                                PSEAKKDAVATPKLKE
Sbjct: 241 EETKVEVKVADLKKAGKASENKKEAKSSEAKKISKSNDIKKDLKPSEAKKDAVATPKLKE 300

Query: 301 IKVKEVKSIPKEDPKVEXXXXXXXXXXXXXXXXXPQPQKKATVDSKPIQGSPRKLLPTAP 360
           IKVKEVKSIPKEDPKVE                 PQPQKKATVDSKPIQGSPRKLLPTAP
Sbjct: 301 IKVKEVKSIPKEDPKVETKTTKKSATGSKKKDSTPQPQKKATVDSKPIQGSPRKLLPTAP 360

Query: 361 LKMPSLLDSLDETKNPDDQEEPVILIDVPLYPAESNNYLDENGQVVFNFYKLVNDKFGQP 420
           LKMPSLLDSLDETKNPDDQEEPVILIDVPLYPAESNNYLDENGQVVFNFYKLVNDKFGQP
Sbjct: 361 LKMPSLLDSLDETKNPDDQEEPVILIDVPLYPAESNNYLDENGQVVFNFYKLVNDKFGQP 420

Query: 421 AKAKRNLITELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNXXXXXXXXXXXXXXHP 480
           AKAKRNLITELH                              KN              HP
Sbjct: 421 AKAKRNLITELHGGEEEEDDVVEVEDDDGVEEEEDDDVDLDEKNSSTAAASSSSKKKSHP 480

Query: 481 MKGRSLIGKYDTEDPFIDDSELLWEEQRVATKDGFFVYFGPLIEKGQYASFERVNGTMKR 540
           MKGRSLIGKYDTEDPFIDDSELLWEEQRVATKDGFFVYFGPLIEKGQYASFERVNGTMKR
Sbjct: 481 MKGRSLIGKYDTEDPFIDDSELLWEEQRVATKDGFFVYFGPLIEKGQYASFERVNGTMKR 540

>AAR158W [346] [Homologous to ScYBR215W (HPC2) - SH]
           complement(628892..628910,628995..630691) [1716 bp, 571
           aa]
          Length = 571

 Score =  187 bits (475), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 116/193 (60%), Gaps = 3/193 (1%)

Query: 351 SPRKLLPTAPLKMPSLLDSLDE---TKNPDDQEEPVILIDVPLYPAESNNYLDENGQVVF 407
           +P+ L P  P+K PS++D LD+        ++++PVI++DVPLY  ++N+YLDENGQVVF
Sbjct: 372 TPKVLAPAQPIKSPSVMDVLDQKFIGTQAAEEDDPVIVVDVPLYQVDTNDYLDENGQVVF 431

Query: 408 NFYKLVNDKFGQPAKAKRNLITELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNXXX 467
           NFY LV++KF     ++    +                                  +   
Sbjct: 432 NFYNLVHEKFNTQQNSQSRTTSSATKDRLEQGDDIAMADDDDDDDEDDEDDDDPSASGAA 491

Query: 468 XXXXXXXXXXXHPMKGRSLIGKYDTEDPFIDDSELLWEEQRVATKDGFFVYFGPLIEKGQ 527
                      +PMKG+S +GKYD EDPFIDDSELLWEEQR ATKDGFFVYFGPLI+KGQ
Sbjct: 492 GASPSKSKKKSNPMKGKSRVGKYDIEDPFIDDSELLWEEQRAATKDGFFVYFGPLIQKGQ 551

Query: 528 YASFERVNGTMKR 540
           YA+FERV+GTMK+
Sbjct: 552 YATFERVDGTMKK 564

>YBR215W (HPC2) [396] chr2 (653403..655274) Protein required for
           regulation of histone gene transcription throughout the
           cell cycle [1872 bp, 623 aa]
          Length = 623

 Score =  177 bits (449), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 116/211 (54%), Gaps = 16/211 (7%)

Query: 341 ATVDSKPIQGSPRKLLPTAPLKMPSLLDSLDETKNPDDQEEPVILIDVPLYPAESNNYLD 400
           + V  +P   SP++L+    +  P +L +  ETK     +EP ILIDVPLY A++N+YLD
Sbjct: 412 SNVRKEPTAKSPKRLVAAPTVSPPKILQTA-ETK----AKEPSILIDVPLYQADTNDYLD 466

Query: 401 ENGQVVFNFYKLVNDKF-------GQPAKAKRNLITELHXXXXXXXXXXXXXXXXXXXXX 453
           ENGQV+FN   L+ +K+        Q   +KRNL+ +L                      
Sbjct: 467 ENGQVIFNLSTLIKEKYHPKSKELAQLKDSKRNLLMQLSDHSNGSLEKEKDEEGDVIELD 526

Query: 454 XXXXXXXXXKNXXXXXXXXXX----XXXXHPMKGRSLIGKYDTEDPFIDDSELLWEEQRV 509
                                        HPMKG++LIGKYD EDPFIDDSELLWEEQR 
Sbjct: 527 DDEDMEEDEGEIDTETNTVTTTISPKKKSHPMKGKNLIGKYDVEDPFIDDSELLWEEQRA 586

Query: 510 ATKDGFFVYFGPLIEKGQYASFERVNGTMKR 540
           ATKDGFFVYFGPLIEKG YAS ER NGTMKR
Sbjct: 587 ATKDGFFVYFGPLIEKGHYASLERANGTMKR 617

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 5/36 (13%)

Query: 76  KIILPTQKVVAKAASDP-----VPGILVARTSSPVS 106
           K+ILPTQ +    A DP      PGIL+A+TSSPV+
Sbjct: 231 KVILPTQNMDGTIAKDPHLGDNTPGILIAKTSSPVN 266

>KLLA0C05676g 506539..508074 weakly similar to sp|Q01448
           Saccharomyces cerevisiae YBR215w HPC2 cell cycle
           regulatory protein singleton, start by similarity
          Length = 511

 Score =  132 bits (333), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%)

Query: 479 HPMKGRSLIGKYDTEDPFIDDSELLWEEQRVATKDGFFVYFGPLIEKGQYASFERVNGTM 538
           HP+KG+S IGKYD EDPFIDDSELLWEEQR AT+DGFFVYFGPLIEKGQYASF+RV+GTM
Sbjct: 443 HPLKGKSRIGKYDIEDPFIDDSELLWEEQRAATRDGFFVYFGPLIEKGQYASFQRVDGTM 502

Query: 539 KR 540
           K+
Sbjct: 503 KK 504

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 54/83 (65%), Gaps = 8/83 (9%)

Query: 351 SPRKLLPTAPLKMPSLLDSLDETKNPDDQEEPVILIDVPLYPAESNNYLDENGQVVFNFY 410
           +PRKL+P   +K P +       K       P++++D+PL+   SN+YLDENGQVVFN Y
Sbjct: 308 TPRKLVPAPSIKSPKVTSMEVNGK-------PIVVLDIPLHDVSSNDYLDENGQVVFNVY 360

Query: 411 KLVNDKFG-QPAKAKRNLITELH 432
            L+ +K+G Q  KAKRNL+ +L+
Sbjct: 361 NLIQEKYGSQLNKAKRNLMVDLN 383

>CAGL0K06721g 654788..656104 some similarities with sp|Q01448
           Saccharomyces cerevisiae YBR215w Histone promoter
           control 2 protein, hypothetical start
          Length = 438

 Score =  123 bits (308), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 95/178 (53%), Gaps = 7/178 (3%)

Query: 351 SPRKLLPTAPLKMPSLLDSLDETK-NPDDQEEPVILIDVPLYPAESNNYLDENGQVVFNF 409
           SP++ LPT   K P+++  L++ K +      P I+IDVPL   +SN YL E+ QV+FNF
Sbjct: 241 SPKRALPTT--KSPNIMSVLEKGKTDIKTLSRPDIIIDVPLSLDDSNAYLSEDNQVIFNF 298

Query: 410 YKLVNDKFGQPAKAK---RNLITELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNXX 466
            KL+++K+G   KAK   +NL   L                                +  
Sbjct: 299 QKLIDEKYGISKKAKVPKKNLTMNL-LQNLSNNRSGSTLDDEINLSDDEDDFEEEESHIP 357

Query: 467 XXXXXXXXXXXXHPMKGRSLIGKYDTEDPFIDDSELLWEEQRVATKDGFFVYFGPLIE 524
                       HP KG++LIGKYD EDPFIDDSEL WEE R AT+DGFFV+FGPL+E
Sbjct: 358 VKPAVPVNGKKPHPSKGKNLIGKYDIEDPFIDDSELQWEEYRAATRDGFFVFFGPLVE 415

>Scas_686.20
          Length = 515

 Score =  119 bits (299), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (88%)

Query: 479 HPMKGRSLIGKYDTEDPFIDDSELLWEEQRVATKDGFFVYFGPLIEKGQYASFERVNGTM 538
           HPMKG+S+IGKYD EDPFIDDSELLWEEQ+ +TK+GFFVYFGPLIEKGQ AS E+V+   
Sbjct: 447 HPMKGKSMIGKYDIEDPFIDDSELLWEEQQASTKEGFFVYFGPLIEKGQLASIEKVSSNT 506

Query: 539 KR 540
           KR
Sbjct: 507 KR 508

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 53/87 (60%), Gaps = 10/87 (11%)

Query: 354 KLLPTAPLKMPSLLDS-LDETKNPDDQEEPVILIDVPLYPAESNNYLDENGQVVFNFYKL 412
           KL+   P++ PSLL    DET N DD  E  +++++PLY  ++N YLDENG VVFN +KL
Sbjct: 297 KLVAPPPVEPPSLLKQPTDETANNDD--EKAVILNIPLYSTQNNEYLDENGSVVFNVFKL 354

Query: 413 V-------NDKFGQPAKAKRNLITELH 432
           +       ++      K KRNL T+L+
Sbjct: 355 IQEDKKVNSNDLQNLKKMKRNLFTQLN 381

>CAGL0G06776g 647706..648254 similar to sp|P25348 Saccharomyces
           cerevisiae YCR003w MRPL32, hypothetical start
          Length = 182

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 3/33 (9%)

Query: 288 AKKDAVATPKLKE---IKVKEVKSIPKEDPKVE 317
            K D V   KLK+     V+ ++++PKEDPKVE
Sbjct: 149 GKMDTVYEEKLKDKDSYLVRRMRTLPKEDPKVE 181

>Sklu_2029.3 YPL118W, Contig c2029 4306-5361
          Length = 351

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 16  SPHSNSSIPLVSLLSGDPASVKVDPEIRQATMANISRVKVSSLLSSD 62
           S  SN  +PL SLL+ DP S + D E + + + ++ +V    LLS D
Sbjct: 114 SSSSNQLVPLSSLLNIDPTSSRTDVEKKLSQVKSLRKVFKKWLLSKD 160

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.125    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,118,546
Number of extensions: 490443
Number of successful extensions: 1893
Number of sequences better than 10.0: 57
Number of HSP's gapped: 1916
Number of HSP's successfully gapped: 76
Length of query: 540
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 434
Effective length of database: 12,926,601
Effective search space: 5610144834
Effective search space used: 5610144834
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 64 (29.3 bits)