Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.181268467432780.0
Scas_563.1066668610511e-134
YGL060W (YBP2)6416589531e-120
Scas_686.196636559411e-117
YBR216C (YBP1)6746728911e-110
KLLA0C05698g7024738821e-108
CAGL0K06743g6556387857e-95
AAR159C6134967233e-86
CAGL0F06985g6305055091e-55
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.1812
         (674 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.1812                                                         1267   0.0  
Scas_563.10                                                           409   e-134
YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in ...   371   e-120
Scas_686.19                                                           367   e-117
YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein wit...   347   e-110
KLLA0C05698g complement(508204..510312) weakly similar to sp|P38...   344   e-108
CAGL0K06743g complement(656238..658205) similar to sp|P38315 Sac...   306   7e-95
AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH] (63...   283   3e-86
CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces c...   200   1e-55

>Kwal_14.1812
          Length = 684

 Score = 1267 bits (3278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/674 (92%), Positives = 624/674 (92%)

Query: 1   MKSSSSLLDKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDH 60
           MKSSSSLLDKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDH
Sbjct: 1   MKSSSSLLDKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDH 60

Query: 61  HLIQQVGWDLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKXXXXXXXX 120
           HLIQQVGWDLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAK        
Sbjct: 61  HLIQQVGWDLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKECFLTGCE 120

Query: 121 XXXXXXXHPSEKXXXXXXXXXXXXXXXXXXXIKSTPEEANGPKMNAQTSSRTVVRPLSRD 180
                  HPSEK                   IKSTPEEANGPKMNAQTSSRTVVRPLSRD
Sbjct: 121 LLGELELHPSEKVQEEHEEDATEAVEVEAQAIKSTPEEANGPKMNAQTSSRTVVRPLSRD 180

Query: 181 PEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFVLRR 240
           PEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFVLRR
Sbjct: 181 PEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFVLRR 240

Query: 241 VYTFARNFIPPQSNAEAYKDMSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRPRVLNI 300
           VYTFARNFIPPQSNAEAYKDMSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRPRVLNI
Sbjct: 241 VYTFARNFIPPQSNAEAYKDMSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRPRVLNI 300

Query: 301 ATEYFFRLKNKYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKDSSAIYQS 360
           ATEYFFRLKNKYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKDSSAIYQS
Sbjct: 301 ATEYFFRLKNKYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKDSSAIYQS 360

Query: 361 LPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVLATQHYLETGQIL 420
           LPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVLATQHYLETGQIL
Sbjct: 361 LPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVLATQHYLETGQIL 420

Query: 421 DSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEALQNIPS 480
           DSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEALQNIPS
Sbjct: 421 DSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEALQNIPS 480

Query: 481 YLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCPFIDLKC 540
           YLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCPFIDLKC
Sbjct: 481 YLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCPFIDLKC 540

Query: 541 CMLGILKDLMLNSKIPVSNLATXXXXXXXXXXXXXXXXPPLPSRPFIMINEDRMATIHSL 600
           CMLGILKDLMLNSKIPVSNLAT                PPLPSRPFIMINEDRMATIHSL
Sbjct: 541 CMLGILKDLMLNSKIPVSNLATELSELKLSEDEKSHSKPPLPSRPFIMINEDRMATIHSL 600

Query: 601 ALLSFEDTIENADKGNLRLSLTYINFFVGLRLKWDKHLLAEVEGAASKIVNSVTKDNSTE 660
           ALLSFEDTIENADKGNLRLSLTYINFFVGLRLKWDKHLLAEVEGAASKIVNSVTKDNSTE
Sbjct: 601 ALLSFEDTIENADKGNLRLSLTYINFFVGLRLKWDKHLLAEVEGAASKIVNSVTKDNSTE 660

Query: 661 LGFIEIALDNLKAF 674
           LGFIEIALDNLKAF
Sbjct: 661 LGFIEIALDNLKAF 674

>Scas_563.10
          Length = 666

 Score =  409 bits (1051), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 246/686 (35%), Positives = 384/686 (55%), Gaps = 48/686 (6%)

Query: 4   SSSLLDKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDHHLI 63
           + S+  KL  AF+E KEDP++L+TIID+Y  E+N+    +EK ++LE L   + D+ H++
Sbjct: 9   TESIYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHIL 68

Query: 64  QQVGWDLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKXXXXXXXXXXX 123
           +++ WDLPK L+ F++  N+D++ RL  + +V+  +KCFNEIA++GN K           
Sbjct: 69  REISWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKECLLAACELLS 128

Query: 124 XXXXHPSEKXXXXXXXXXXXXXXXXXXXIKSTPEEANGPKMNAQTSSRTVVRPLS----- 178
                P                      +++  EE  G K N +T        L+     
Sbjct: 129 ELTVEP---------------------VMENETEEEEGGKDNKKTDGDETPTDLNSSDYI 167

Query: 179 -RDPEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFV 237
            RD  E +  +K++ + +L+NSTL RI T YPS+FL MA+S+I  F+ +N  DI D TF+
Sbjct: 168 ERDLTEFIPSLKVYAIFQLLNSTLGRIITLYPSKFLNMAISAIMKFMATNINDIADVTFL 227

Query: 238 LRRVYTFARNF--IPPQSNAEAYKDMSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRP 295
           LRR++ F  N+    P        D++ EEI K+ DDE  LQ KL++ L   ++   ++ 
Sbjct: 228 LRRIHEFCNNYDVHAPDRKLIDGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKN 287

Query: 296 RVLNIATEYFFRLKNKYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKDSS 355
           +      +YF  L ++     ++E   +   I ++Y  L   + ID+KEEFL QC+++S 
Sbjct: 288 QPTTFDVKYFESLTHQ-----KFEESEHYAVIRTQYLGLVNKYKIDIKEEFL-QCLQESR 341

Query: 356 AIYQSLPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVLATQHYLE 415
            IY+SLP+D +  ++  ++ + Q++YQLSY Y +Q+  N+  L +D   +++L+  +Y E
Sbjct: 342 QIYESLPSDIDESDEKKKSALNQVIYQLSYRYQMQKISNQDTLEIDFNSIILLSGSYYAE 401

Query: 416 TGQILDSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEAL 475
           TG  L   I    A+Y+YLR  T  +Y+    N        +WLWVA+T+S  K+ ++ L
Sbjct: 402 TGLHLLPQISIQDAVYLYLRCSTISLYSDTFSNEAVKGVTRYWLWVAITQSPIKEIEQNL 461

Query: 476 QNIPSYLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCPF 535
             IPS+ +  FLQ+LLL + NE     RM +FTLLTR+LCLMPE+ +F+F  DTLL+CP+
Sbjct: 462 LKIPSHFNTVFLQMLLLNNCNEKDGKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPY 521

Query: 536 IDLKCCMLGILKDLMLN----SKIPVSNLATXXXXXXXXXXXXXXXXPPLPSRPFIMINE 591
              K  +L ILKDLML     SK     L+T                P LP RP+I+INE
Sbjct: 522 NSAKSSVLAILKDLMLKDNQISKPLEEELST------LDISSEKNKGPTLPPRPYILINE 575

Query: 592 DRMATIHSLALLSFED--TIENADK-GNLRLSLTYINFFVGLRLKWDKHLLAEVEGAASK 648
           DRMA++HS+A +   +   ++N +K   L L L Y+NFF+ LR KW+ +LL  +      
Sbjct: 576 DRMASLHSVASMCISNLKLLDNPNKRTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDA 635

Query: 649 IVNSVTKDNSTELGFIEIALDNLKAF 674
            +  V  + + ELGFI+IA + L  +
Sbjct: 636 KLAGVEDEAAPELGFIKIANETLSKY 661

>YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in
           stress resistance [1926 bp, 641 aa]
          Length = 641

 Score =  371 bits (953), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 224/658 (34%), Positives = 361/658 (54%), Gaps = 39/658 (5%)

Query: 31  LYASEVNKKEGGEEKAQFLEILLKRIQDDHHLIQQVGWDLPKVLIRFINTRNVDLNTRLL 90
           +Y  +VN  +  +EK ++L+ LLK ++D+   ++++GWDLPK L++F + +N+++N  L+
Sbjct: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60

Query: 91  YNGVVATSLKCFNEIALHGNAKXXXXXXXXXXXXXXXHPSEKXXXXXXXXXXXXXXXXXX 150
           ++ +V++ ++CFNE+A++GN K                 +E                   
Sbjct: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGDSDEENEDL-------- 112

Query: 151 XIKSTPEEANGPKMNAQTSSRTVVRP-----LSRDPEELVLEVKLHMLLELINSTLRRIR 205
                  ++N    +  T   +V+ P     ++++  E +  +K+++L E ++  L+R+ 
Sbjct: 113 ------NDSNRNDASNITDELSVITPEIGHYMAKNTVEFIPNLKIYVLFEFMSLLLKRVD 166

Query: 206 TCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFVLRRVYTFARNFIPPQSNAEAYKDMSTEE 265
           T YPS+FLAM  S+I  +V +N   +DD  F+LR VY F  N+ P Q +A     +ST +
Sbjct: 167 TLYPSKFLAMVTSAIIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLTDGISTND 226

Query: 266 ILKVRDDEEALQRKLLRCLLTFSIGQLVRPRVLNIATEYFFRLKNKYTTDFEYEMRVNLK 325
           + K+ DDE ALQ+KLL  L  F I   ++    NI   YF  L +K T   E E+  ++ 
Sbjct: 227 LEKIHDDESALQKKLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTD--ENEIDASVL 284

Query: 326 HILSRYYQLAYSFDIDVKEEFLKQCVKDSSAIYQSLPNDSELINDAA-----RNGITQLV 380
            I  +YY+   S D+ +KE  L++C+ +S +IY SL     L+N AA     +  I QLV
Sbjct: 285 QICHQYYEYVTSLDVHMKE-LLEKCLVESRSIYNSL-----LMNPAASTPEFKEEINQLV 338

Query: 381 YQLSYSYGLQRSINEKNLSLDPAGLLVLATQHYLETGQILDSTIRADCAIYMYLRFVTPE 440
           Y++SY+Y +++  +EKNL LD  G+++L+  HY + G  L   I    AIY+YLR  T  
Sbjct: 339 YEVSYAYQIKKLADEKNLELDQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTAS 398

Query: 441 MYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEALQNIPSYLSLTFLQILLLKSFNETLE 500
           +++   +N +      +WLWV+ T++S +  K ALQ +P +++  FLQ+LL+K+ NE+  
Sbjct: 399 LFSEIYENKFLESSVRYWLWVSTTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNN 458

Query: 501 HARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCPFIDLKCCMLGILKDLMLNSKIPVS-- 558
             ++   TLL RLL LMPE T+F F  +TLL CP+I  K  +L IL+D+M+ S    +  
Sbjct: 459 DTKLTEITLLRRLLYLMPESTSFTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRD 518

Query: 559 -NLATXXXXXXXXXXXXXXXXPPLPSRPFIMINEDRMATIHSLALLSFEDTIENA-DKGN 616
             +                  P LP RP+I INEDRMA+IHS+AL+ F    +    +G+
Sbjct: 519 ETVGLIEQQNPGNTANSVPIMPTLPPRPYITINEDRMASIHSIALICFSAAKQKKRTQGD 578

Query: 617 LRLSLTYINFFVGLRLKWDKHLLAEVEGAASKIVNSVTKDNSTELGFIEIALDNLKAF 674
           L L LTY+ FFV LR KWD  LL  +     +I  S   +   EL FI I+ + L  +
Sbjct: 579 LLLVLTYMKFFVSLRNKWDLGLLTLIN---KEISESFQGEGEPELAFINISNNTLGEY 633

>Scas_686.19
          Length = 663

 Score =  367 bits (941), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 218/655 (33%), Positives = 356/655 (54%), Gaps = 37/655 (5%)

Query: 1   MKSSSSLLDKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDH 60
           M + + ++  L +AFDE  +D +SL  I+++Y  ++N     ++K QFL  LL  ++D  
Sbjct: 1   MANVNDIIADLVNAFDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHP 60

Query: 61  HLIQQVGWDLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKXXXXXXXX 120
            ++ ++ WD PK +++F+ T NVD+  RL Y+ +++  +KCFNEIA              
Sbjct: 61  DVVARISWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSA----------- 109

Query: 121 XXXXXXXHPSEKXXXXXXXXXXXXXXXXXXXIKSTPEEANGPKMNAQTSSRTVVR-PLSR 179
                   P E                    ++    +    K     SS  + +    R
Sbjct: 110 -------EPKECLLTGCELLSNLSLENENIELEMEQGDHTNSKGQTHYSSAEIGKYHAER 162

Query: 180 DPEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFVLR 239
            P +  + VK+++L ELI +TL+RI T  PS++L +A S++  F+++N   I+D   V+R
Sbjct: 163 TPADFFVSVKMYILFELIGTTLQRIPTLNPSKYLGLATSAMIRFIKANCDGINDVRIVMR 222

Query: 240 RVYTFARNFIPPQSNAEAYKD--MSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRPRV 297
           R+++F RN++PP ++    KD  ++ E+++++ + E A QR++LR L T  +   ++   
Sbjct: 223 RIFSFCRNYVPPDTSLCVIKDRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAIN 282

Query: 298 LNIATEYFFRLKN-KYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKDSSA 356
                +YF+ L N ++T    Y+   ++  + SR++ LA SFDID+K+EFL +CVK S  
Sbjct: 283 GRTDVKYFYFLSNTEFTLAGFYK---DISEVNSRFFNLALSFDIDIKKEFL-ECVKTSHD 338

Query: 357 IYQSLPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVLATQHYLET 416
           IY+ LP DS + ++ A+  I Q VY+L+YSY LQR    KN+ LDP G+++L+  +Y+ET
Sbjct: 339 IYKGLPKDSSIGSEEAKKLIQQTVYKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMET 398

Query: 417 GQILDSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEALQ 476
            + L   I    AIY+YLR  TP +++   +N        +WLWV++T  S    ++ L+
Sbjct: 399 DKHLYPQITVKDAIYLYLRCTTPSLFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELE 458

Query: 477 NIPSYLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCPFI 536
            +PSYL  TFLQ  L K+  +  E  RMVSFTL TR+LCL+PE  TF+F  +TL +  + 
Sbjct: 459 ELPSYLLTTFLQTFLSKNCKQPNEEIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYP 518

Query: 537 DLKCCMLGILKDLMLNSK------IPVSNLATXXXXXXXXXXXXXXXXPPLPSRPFIMIN 590
            +K  +LGILKDLM   +         ++ A                   + S+ ++ ++
Sbjct: 519 HVKSSVLGILKDLMSKRRSCQDLCANDNDEALSNSLAKLKINSKKNEGAGVESQVYVEVS 578

Query: 591 EDRMATIHSLALL---SFEDTIENADKGNLRLSLTYINFFVGLRLKWDKHLLAEV 642
           E+RM  IH LAL    S E+  E   + N+ L L Y+ FF GL  +WDK LL  +
Sbjct: 579 EERMNEIHHLALRAINSLEE--EKTTRANIILILNYLEFFNGLHSEWDKSLLQSI 631

>YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein with
           moderate similarity to S. cerevisiae Ygl060p, which is
           involved in stress resistance [2025 bp, 674 aa]
          Length = 674

 Score =  347 bits (891), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 215/672 (31%), Positives = 346/672 (51%), Gaps = 37/672 (5%)

Query: 1   MKSSSSLLDKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDH 60
           M+    +L ++  AF   KED L L+T+ID+Y  +VN++   EEK +F+E L   ++D+ 
Sbjct: 1   MEPIDDILFEVTDAFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNP 60

Query: 61  HLIQQVGWDLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKX---XXXX 117
               ++GWDLPK L++F++  NVD+N RL  N +V   +KCF  I++ G  K        
Sbjct: 61  STTGEIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLE 120

Query: 118 XXXXXXXXXXHPSEKXXXXXXXXXXXXXXXXXXXIKSTPEEANGPKMNAQTSSRTVVRPL 177
                       S++                   I+++    + P      SS       
Sbjct: 121 LLSSLCSKDFSKSDQQNKEDFVDKKANTLPPEGVIENSSNRKDFPSYGESKSSN------ 174

Query: 178 SRDPEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFV 237
                E  L++K ++L E I ++L+RI T +PS++L  AVS+I  FV S++   +D  F+
Sbjct: 175 -----EFFLKLKSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFL 229

Query: 238 LRRVYTFARNFIPPQ--SNAEAYKDMSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRP 295
           LRRVYTF RN+IPP    + +  +D + E   KV ++E  LQ +LLR L TF I   ++ 
Sbjct: 230 LRRVYTFCRNYIPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKT 289

Query: 296 RVLNIATEYF-------FRLKNKYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKEEFLK 348
              N   +Y+       F L   YT   E         +  RYYQ+A+S D+D++ EF +
Sbjct: 290 VTTNADVKYYCALNQQKFELSAYYTEYLE---------LFCRYYQMAFSLDVDIEGEF-Q 339

Query: 349 QCVKDSSAIYQSLPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVL 408
             +K+   IY+S+P +   +ND A+  + ++VY+L+Y++ +Q++  EKN+ LD  G+++ 
Sbjct: 340 NVIKECRIIYKSVPQEISAVNDEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILF 399

Query: 409 ATQHYLETGQILDSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSC 468
           +  HYLET Q L   +    AIY+YLRF TP +Y+    N        +WLW A+T    
Sbjct: 400 SGIHYLETNQHLVKEMNITDAIYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPL 459

Query: 469 KDSKEALQNIPSYLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKD 528
           +D K+ L+N+  +++ T L +LL K+  +  +  RM++FTLLTRLLCL+PE+  FEF  D
Sbjct: 460 EDVKKELKNLSVFVTKTLLHVLLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILD 519

Query: 529 TLLSCPFIDLKCCMLGILKDL---MLNSKIPVSNLATXXXXXXXXXXXXXXXXPPLPSRP 585
            L + P    K  +L + KDL    +++K   S                         R 
Sbjct: 520 VLKTSPLPLAKTSVLCVFKDLSRRRISTKDNDSETDLIVEKLSKLKVNDSNKAQQSNIRH 579

Query: 586 FIMINEDRMATIHSLALLSFEDTI-ENADKGNLRLSLTYINFFVGLRLKWDKHLLAEVEG 644
           +I ++  +M  +H   L + +D+   +A K ++ L LTY+N F+ L+  WD+ LL  V  
Sbjct: 580 YIQLDSSKMKAVHDCCLQTIQDSFTADAKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCS 639

Query: 645 AASKIVNSVTKD 656
                + SV  D
Sbjct: 640 KIDSNLKSVEPD 651

>KLLA0C05698g complement(508204..510312) weakly similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, start by similarity
          Length = 702

 Score =  344 bits (882), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/473 (39%), Positives = 281/473 (59%), Gaps = 6/473 (1%)

Query: 178 SRDPEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFV 237
            R P+E++ E++ + ++EL+ STL+RI T +PS+FL+ AV +   F   N+ D+DD  F+
Sbjct: 202 GRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRFNLQNNEDVDDCLFI 261

Query: 238 LRRVYTFARNFIPPQSNAEAYKDMSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRPRV 297
           LRR+Y+F R +IPP    +A K +S EE+ +++  EE LQRKLL  +LT ++ QL++ R 
Sbjct: 262 LRRLYSFIRGYIPPSPPPDADKQVSAEELEEIKVSEEVLQRKLLCNILTSALHQLLKART 321

Query: 298 LNIATEYFFRLKNKYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKDSSAI 357
                 Y   L+   T     E    L  ILSRYYQLA SFDIDV  EF + CV +S  I
Sbjct: 322 CISLLNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLATSFDIDVSAEFKRLCVDESVRI 381

Query: 358 YQSLPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVL---ATQHYL 414
           Y+SLP DSE+ +D     IT  VYQL+Y+Y +++  N K + LDPAG+L+L   + + +L
Sbjct: 382 YRSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVKEILLDPAGILILRSFSNEDFL 441

Query: 415 ETGQILDSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEA 474
                 D+ I    AIYMYLRFVTP M++   +N  + D    W+  A+T +S  D  ++
Sbjct: 442 PPS---DAKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTWILFALTNNSTHDLMDS 498

Query: 475 LQNIPSYLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCP 534
           L+++PSY+   +LQ  L+++  +  ++ R   F++LTR+LCL+PE+  F F +DTLLSCP
Sbjct: 499 LKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCLLPEDFAFNFIRDTLLSCP 558

Query: 535 FIDLKCCMLGILKDLMLNSKIPVSNLATXXXXXXXXXXXXXXXXPPLPSRPFIMINEDRM 594
           +   KCC L ILKD+M + +                        PPLPSR ++++N+DR+
Sbjct: 559 YEQAKCCALAILKDMMQHERKVPQKSDEDDLAKDMEKLKIKNSPPPLPSRAYMLLNDDRI 618

Query: 595 ATIHSLALLSFEDTIENADKGNLRLSLTYINFFVGLRLKWDKHLLAEVEGAAS 647
           AT+HS+ LL+ +    + +   ++  LTY+NF      KWD   L E+  A +
Sbjct: 619 ATLHSITLLAIDSCAADPESKKVKTLLTYLNFLNAFLTKWDSVFLKEICDAVN 671

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 66/104 (63%)

Query: 9   DKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDHHLIQQVGW 68
           +KL  AF E K D ++L+TI+DLY+ EVN K   E+K ++L  +L  +Q +  ++ ++GW
Sbjct: 13  EKLLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVVYEIGW 72

Query: 69  DLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAK 112
           DLPK+LI+FI+  N +          +   +KCFNE+AL GN K
Sbjct: 73  DLPKILIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPK 116

>CAGL0K06743g complement(656238..658205) similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, hypothetical start
          Length = 655

 Score =  306 bits (785), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 202/638 (31%), Positives = 328/638 (51%), Gaps = 30/638 (4%)

Query: 9   DKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDHHLIQQVGW 68
           D L  +F + KED L+L+T+ID  + EV++    +EK QFLE+LL  ++ D  L+  VGW
Sbjct: 10  DALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKEKEQFLELLLNLLEADTELVSAVGW 69

Query: 69  DLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKXXXXXXXXXXXXXXXH 128
           DLP+ L+RF N +N+  + RL    VV   +  FN +ALH                    
Sbjct: 70  DLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAK------------------ 111

Query: 129 PSEKXXXXXXXXXXXXXXXXXXXIKSTPEEANGPKMNAQTSSRTVVRPLSRDPEELVLEV 188
           P E                         E+ +      + +         RD  E++  V
Sbjct: 112 PQECLVTTLELLSELNFKNIVEECHQLSEDGSDNNTAEEDNDAVEDYMKDRDQPEIIFGV 171

Query: 189 KLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFVLRRVYTFARNF 248
           K + L EL  S +RR+ T +PS++L  AV++I  +V +N+  ++D  F+LRRV+ F R +
Sbjct: 172 KSYALFELAGSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCRGY 231

Query: 249 IPPQSNAEAYKD--MSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRPRVLNIATE--Y 304
           IPP+   +   D  M+ EE  ++ + E  LQ +LLR L TFS+   V+   LN  TE  Y
Sbjct: 232 IPPEPPRQLIVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVK--FLNDKTEVVY 289

Query: 305 FFRLKNKYTTDFEY-EMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKDSSAIYQSLPN 363
           F +L NK   D +  E   ++  I+SRYYQ+A+SFDID+ +EF    ++++  IY+ +  
Sbjct: 290 FHKLINK---DLQLPEFYRSVHDIISRYYQIAFSFDIDLNDEF-NDILRETRGIYEDVIK 345

Query: 364 DSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVLATQHYLETGQILDST 423
                N+  +N  + ++ +  Y Y +Q++  EK ++ D  G+++L+  +Y+E G  L   
Sbjct: 346 RINETNNTDKNAKSDILLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENGDHLIDI 405

Query: 424 IRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEALQNIPSYLS 483
             AD A+Y+YLRF +  +++P   N        +W+W A+T +     KE L  +   + 
Sbjct: 406 DIAD-ALYLYLRFASESLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAELSPLVL 464

Query: 484 LTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCPFIDLKCCML 543
            + L +LL+K+ ++  E  RM++FTL+TR+LCL+PE  ++EF  D L +C  +  K C+L
Sbjct: 465 HSVLNLLLVKNCHQVNEEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVL 524

Query: 544 GILKDLMLNSKIPVSNLATXXXXXXXXXXXXXXXXPPLPSRPFIMINEDRMATIHSLALL 603
           GIL+DL++     VS+  T                     + FI ++  R   I  LA+ 
Sbjct: 525 GILRDLVIKVDHSVSSNNTDTEDLSESMAQLKINNEKRAKKTFITLDPKRAGEIEDLAIK 584

Query: 604 SFEDTIENADKGNLRLSLTYINFFVGLRLKWDKHLLAE 641
           + ++T ++  K  + L L YI FF     KW+K  L E
Sbjct: 585 TLKETKKSMKKDYILLVLNYIKFFSTFAHKWNKSKLNE 622

>AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH]
           (630860..632701) [1842 bp, 613 aa]
          Length = 613

 Score =  283 bits (723), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 173/496 (34%), Positives = 275/496 (55%), Gaps = 26/496 (5%)

Query: 180 DPEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFVLR 239
           D  E +  +K HML+E + +TL R  T YPSRFL   +  +   V  N+ ++ D   +LR
Sbjct: 137 DLREEMFALKFHMLMEFVTTTLGRTTTAYPSRFLGEIIGVLVKLVERNADELCDVHLLLR 196

Query: 240 RVYTFARNFIPPQSNAEAYKDMSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRPRVLN 299
           R+YTF R++  P S++E       EE+   R  E+ LQR L R  L +++ QL+R + + 
Sbjct: 197 RLYTFCRDYTAPVSSSE------DEEL---RAQEDYLQRTLFRSFLAYALAQLLRRQSVR 247

Query: 300 IATEYFFRLKNKYTTDFE-YEMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKDSSAIY 358
            A EYF      +  +F+ ++  V L+  L RY+QLA+SFDID++  F KQC+ +S  +Y
Sbjct: 248 WAPEYF---AKSHGLEFKLHDDHVELRETLGRYFQLAHSFDIDIEGAFQKQCILESRDVY 304

Query: 359 QSLPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVLATQHYLETGQ 418
             +  D++  + A      +++YQL+Y+Y L++    +++ +D  G+ VLA  H+ ETG+
Sbjct: 305 ACVSADADKADGA------EVIYQLAYTYELKKIAELQSMPIDARGIFVLAVLHHFETGK 358

Query: 419 ILDSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEALQNI 478
            +  ++R D AIYM+LRF TPE+Y+ +  N    D   +++ +A+  +S +++ + ++  
Sbjct: 359 PICLSLRLDDAIYMFLRFNTPEIYSKSFGNIAVTDASLYFVLLALEGNSHEENHKLVREF 418

Query: 479 PSYLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCPFIDL 538
           P  +   F+Q+LLL            ++ ++L R+L L  E T F+F  DTLL CP+   
Sbjct: 419 PQTVFAVFIQVLLLNMCRLPSREIGRMTHSILARVLFLASETTAFDFVIDTLLQCPYETA 478

Query: 539 KCCMLGILKDLMLNSKIPVSNLATXXXXXXXXXXXXXXXXPPLPSRPFIMINEDRMATIH 598
           K  +L I K +M      VS+  T                PPLP RPFI +N+DRMA  H
Sbjct: 479 KQIILEIAKIMM------VSDQYTICTRDVPSHTRTDTKAPPLPPRPFIKLNDDRMAAFH 532

Query: 599 SLALLSFEDTIENADKGNLRLSLTYINFFVGLRLKWDKHLLAEVEGAASKIVNSVTKDNS 658
           +LA++S +   E  D   L   L+Y+N    LR KWD+ LL E+  A S  +    K++ 
Sbjct: 533 TLAMMSAKFCTETEDPKQLTTLLSYLNLITVLRKKWDQVLLRELTVAVSNCIEP-RKEDI 591

Query: 659 TELGFIEIALDNLKAF 674
            E+GFI+IA D LK F
Sbjct: 592 PEIGFIKIANDGLKEF 607

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 53/104 (50%)

Query: 9   DKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDHHLIQQVGW 68
           + L   F E   D +SL   I+L A +          A FLE L +++++   L+  +GW
Sbjct: 10  ESLGVLFAEQAGDVISLAAGIELCAEQALASGNAGRVASFLEALWEQLREHPALVGDLGW 69

Query: 69  DLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAK 112
           D+PKVL+R I   N +LN  L  + V    + CF E+   GNA+
Sbjct: 70  DIPKVLVRCIRADNFNLNEGLGDDMVWRLLVGCFREVGREGNAR 113

>CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces
           cerevisiae YGL060w, hypothetical start
          Length = 630

 Score =  200 bits (509), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 151/505 (29%), Positives = 248/505 (49%), Gaps = 40/505 (7%)

Query: 186 LEVKLHMLLE-LINSTLRRIRTCYPSRFLAMAVSSIFSFVRSN---SIDIDDTTFVLRRV 241
            +V++ +LLE  I   L+ +    PS+FL++ VS++   + +N     +I+ +  +L  +
Sbjct: 138 FKVRVELLLEEFILPALKTLGQTNPSKFLSVIVSALVELISNNMQCGEEIEMSNILLDVI 197

Query: 242 YTFARNFIPPQSNAEAYKDMSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVR-----PR 296
             F  ++  P +       ++T +      DEE + +K+L    +FSIG+ ++     P 
Sbjct: 198 IRFYDSYELPSAK------VTTPDGAMANKDEEDIVQKILESFWSFSIGRCIKNQSCFPE 251

Query: 297 VL---NIATEYFFRLKNKYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKD 353
            +    I    F + +     DF  + R N+  I +   QL         ++ ++ C ++
Sbjct: 252 YILLSQIPRMDFVKQEIDVPDDFIIKSR-NIIRITNEKLQLDL-------QKMMEACFEE 303

Query: 354 SSAIYQSLPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKN-LSLDPAGLLVLATQH 412
           +  IY+ LP +   + D   N +T+ +YQ+SY  G+     +K  LSLD AG+L L+  +
Sbjct: 304 TRKIYELLPPNPT-VQDG--NDLTEEIYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLY 360

Query: 413 YLETGQILDSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDS- 471
           Y+     L+  I    A+ +YLRF +  +Y+P   NT+    C FWLW + T    +D  
Sbjct: 361 YIANDNKLNVKINLYDAVLLYLRFSSASLYSPIFDNTFVEGICRFWLW-SYTLGENRDKN 419

Query: 472 --KEALQNIPSYLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDT 529
             +  L ++P Y+   F Q+LLLK+ NE     + ++F LLT+LL     E  F+F  DT
Sbjct: 420 TLQSELMSVPDYVLKVFFQLLLLKTCNEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDT 479

Query: 530 LLSCPFIDLKCCMLGILKDLMLNSKIPVSNLATXXXXXXXXXXXXXXXXPPLPSRPFIMI 589
           +LSCP++D K  + GILKDLM        ++                  P LP RP I +
Sbjct: 480 ILSCPYLDAKIAIAGILKDLMAKKS---DDIHLKEARQVKNEPNNHNCPPKLPDRPPITV 536

Query: 590 NEDRMATIHSLALLSFEDTIE---NADKGNLRLSLTYINFFVGLRLKWDKHLLAEVEGAA 646
           +E R+A+IHSL  L  ED ++   N  +GNL L   YIN  + L  +WD  LL E+    
Sbjct: 537 DEHRIASIHSLVKLCIEDCLKPLNNKTQGNLILLQYYINILITLYKQWDGFLLKEINDEI 596

Query: 647 SKIVNSVTKDNSTELGFIEIALDNL 671
            K+ +   +    EL FI +A D L
Sbjct: 597 KKLFSQRQEQEFPELEFIRLANDTL 621

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 15/89 (16%)

Query: 4  SSSLLDKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDHHLI 63
          S+  + KL    +E +++    IT + L    +N   G E++A F + L       + L+
Sbjct: 2  STEAIRKLRQYAEENEKEEFDGITYLVLLEECINGLSGSEDQALFFDEL-------YGLL 54

Query: 64 QQVG--------WDLPKVLIRFINTRNVD 84
           Q G        W LPK LI+ I+++NV+
Sbjct: 55 DQFGTPLNDELLWGLPKALIKNISSKNVE 83

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,534,490
Number of extensions: 795988
Number of successful extensions: 2234
Number of sequences better than 10.0: 15
Number of HSP's gapped: 2259
Number of HSP's successfully gapped: 23
Length of query: 674
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 566
Effective length of database: 12,857,365
Effective search space: 7277268590
Effective search space used: 7277268590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)