Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.18111961948981e-125
Sklu_752.22001703795e-46
YBR217W (ATG12)1861683309e-39
Scas_686.181801713193e-37
KLLA0C05720g1891752986e-34
CAGL0K06765g181842933e-33
AAR160W1891672752e-30
Kwal_47.1764738578700.38
Scas_575.564537690.59
Scas_623.14262109670.75
Kwal_55.2176532056651.5
Sklu_2239.240998642.1
Sklu_2351.554137642.2
CAGL0G00330g31428632.6
AEL013C55963624.4
Scas_681.12117650624.7
Kwal_27.11747108747615.3
AFR304W101556606.5
ADL005C32551599.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.1811
         (194 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.1811                                                          350   e-125
Sklu_752.2 YBR217W, Contig c752 791-1393                              150   5e-46
YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated t...   131   9e-39
Scas_686.18                                                           127   3e-37
KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces c...   119   6e-34
CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces c...   117   3e-33
AAR160W [348] [Homologous to ScYBR217W (APG12) - SH] complement(...   110   2e-30
Kwal_47.17647                                                          32   0.38 
Scas_575.5                                                             31   0.59 
Scas_623.14                                                            30   0.75 
Kwal_55.21765                                                          30   1.5  
Sklu_2239.2 YPR041W, Contig c2239 3671-4900 reverse complement         29   2.1  
Sklu_2351.5 YGR009C, Contig c2351 9208-10833                           29   2.2  
CAGL0G00330g complement(34662..35606) some similarities with sp|...    29   2.6  
AEL013C [2493] [Homologous to ScYDL042C (SIR2) - SH; ScYOL068C (...    28   4.4  
Scas_681.12                                                            28   4.7  
Kwal_27.11747                                                          28   5.3  
AFR304W [3496] [Homologous to ScYGR125W - SH] complement(991651....    28   6.5  
ADL005C [1737] [Homologous to ScYEL005C (VAB2) - SH] (698226..69...    27   9.2  

>Kwal_14.1811
          Length = 196

 Score =  350 bits (898), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 174/194 (89%), Positives = 174/194 (89%)

Query: 1   MSQLLXXXXXXXXXXXXXXXXXXXXIPFTVRDELEQYSTRLNLLGLDSGEQITSSTQELR 60
           MSQLL                    IPFTVRDELEQYSTRLNLLGLDSGEQITSSTQELR
Sbjct: 1   MSQLLESESDAGSSSSTTESSKSQSIPFTVRDELEQYSTRLNLLGLDSGEQITSSTQELR 60

Query: 61  NLESSDDNDSSTVESNRAHTAPVSTSAILGHLSVAGDQALKKMAEREQELPTKIPIRFKP 120
           NLESSDDNDSSTVESNRAHTAPVSTSAILGHLSVAGDQALKKMAEREQELPTKIPIRFKP
Sbjct: 61  NLESSDDNDSSTVESNRAHTAPVSTSAILGHLSVAGDQALKKMAEREQELPTKIPIRFKP 120

Query: 121 IGSVPQVAPQLARISASQPFSVVVTFLTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFR 180
           IGSVPQVAPQLARISASQPFSVVVTFLTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFR
Sbjct: 121 IGSVPQVAPQLARISASQPFSVVVTFLTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFR 180

Query: 181 IKDELVVSYCSGVA 194
           IKDELVVSYCSGVA
Sbjct: 181 IKDELVVSYCSGVA 194

>Sklu_752.2 YBR217W, Contig c752 791-1393
          Length = 200

 Score =  150 bits (379), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 116/170 (68%), Gaps = 7/170 (4%)

Query: 28  FTVRDELEQYSTRLNLLGLDSGEQITSSTQELRNLESSDDNDSSTVESNRA--HTAPVST 85
           + V+ +LE YS RL+ L + S ++     ++  +  S  D    T+E         P++T
Sbjct: 33  YMVQSKLELYSKRLSQLRMQSDDE----EEDELSRPSQSDRSQGTIEDGPVPRQEIPLTT 88

Query: 86  SAILGHLSVAGDQALKKMAEREQ-ELPTKIPIRFKPIGSVPQVAPQLARISASQPFSVVV 144
           S IL +L    D+ +K++ ++E+ + P KI I+F+PIGS+ Q++PQ+ +IS +Q FS+V+
Sbjct: 89  SLILNNLPPRTDEVIKEVEQQEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVI 148

Query: 145 TFLTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFRIKDELVVSYCSGVA 194
           TFL ++LK++ VYCYINNSF+P PQQ+VGDLW  F+I++ELVVSYCS VA
Sbjct: 149 TFLRRKLKVSEVYCYINNSFAPTPQQNVGDLWTQFKIQEELVVSYCSSVA 198

>YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated to
           Apg5p, involved in autophagy and cytoplasm-to-vacuole
           protein targeting pathway [561 bp, 186 aa]
          Length = 186

 Score =  131 bits (330), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 106/168 (63%), Gaps = 23/168 (13%)

Query: 27  PFTVRDELEQYSTRLNLLGLDSGEQITSSTQELRNLESSDDNDSSTVESNRAHTAPVSTS 86
           P TV++ LE +S RL+ LGL S     S  Q++      +D+ S T E        + T+
Sbjct: 40  PHTVQNRLELFSRRLSQLGLASD---ISVDQQV------EDSSSGTYE----QEETIKTN 86

Query: 87  AILGHLSVAGDQALKKMAEREQELPTKIPIRFKPIGSVPQVAPQLARISASQPFSVVVTF 146
           A          Q  K+ + ++++   KI I+F+PIGS+ Q+ P + +IS SQ F++V+ F
Sbjct: 87  A----------QTSKQKSHKDEKNIQKIQIKFQPIGSIGQLKPSVCKISMSQSFAMVILF 136

Query: 147 LTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFRIKDELVVSYCSGVA 194
           L +RLK+++VYCYINNSF+P+PQQ++G+LW  F+  DEL+VSYC+ VA
Sbjct: 137 LKRRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYCASVA 184

>Scas_686.18
          Length = 180

 Score =  127 bits (319), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 70/171 (40%), Positives = 97/171 (56%), Gaps = 40/171 (23%)

Query: 28  FTVRDELEQYSTRLNLLGLDSGEQITSSTQELRNLESSDDNDSSTVESNRAHTAPVSTSA 87
             +R+ LE YS RL+ LGL+   QI   T          DN S                 
Sbjct: 44  LALRNRLELYSRRLSQLGLEETPQIPLET----------DNTS----------------- 76

Query: 88  ILGHLSVAGDQALKKMAEREQELPT----KIPIRFKPIGSVPQVAPQLARISASQPFSVV 143
               LS A  + +K      +E P     K+ I+F+PIGSVPQ+ P + +ISA+Q FS +
Sbjct: 77  ----LSQAEKEKIKN-----EEGPDVNSFKVKIKFQPIGSVPQIKPPVCKISATQSFSSI 127

Query: 144 VTFLTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFRIKDELVVSYCSGVA 194
           ++FL KRL++ NVYCY+N+SF+P PQQ+VGDLW  F++ DEL++SYC  VA
Sbjct: 128 ISFLRKRLRMENVYCYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAVA 178

>KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 component of the autophagic
           system singleton, start by similarity
          Length = 189

 Score =  119 bits (298), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 107/175 (61%), Gaps = 26/175 (14%)

Query: 29  TVRDELEQYSTRLNLL--------GLDSGEQITSSTQELRNLESSDDNDSSTVESNRAHT 80
           +++ +LE++S +LN L        G D  E ++  T+  R  ESS+++++ +    R+ +
Sbjct: 30  SIKGKLEEFSAKLNELRLADGNSDGGDEEESLSPDTKSQRE-ESSENSENVS----RSTS 84

Query: 81  APVSTSAILGHLSVAGDQALKKMAEREQ-ELPTKIPIRFKPIGSVPQVAPQLARISASQP 139
            P  TS+I+  +            EREQ +   K+ IR +PIG++PQ+ P++ +ISA Q 
Sbjct: 85  RPPLTSSIVSSV------------EREQLKSQVKVKIRLQPIGAIPQIQPRVCQISAHQQ 132

Query: 140 FSVVVTFLTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFRIKDELVVSYCSGVA 194
           F  +  FL KRLK  +++CYINN+F+P+  Q++GDLW  F++ DEL+VSYC  VA
Sbjct: 133 FLALTRFLCKRLKRKHIHCYINNAFAPSLDQNIGDLWTQFKVNDELIVSYCETVA 187

>CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 Autophagy protein, start by
           similarity
          Length = 181

 Score =  117 bits (293), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 66/84 (78%)

Query: 111 PTKIPIRFKPIGSVPQVAPQLARISASQPFSVVVTFLTKRLKLNNVYCYINNSFSPAPQQ 170
           P K+ I+F+ IGS+  + P + +IS ++PFSV+++FL ++LK+ N++CYINNSF+P P Q
Sbjct: 96  PQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKMENIHCYINNSFAPVPSQ 155

Query: 171 SVGDLWGHFRIKDELVVSYCSGVA 194
           +VGDLW  F++ DEL+VSYC  VA
Sbjct: 156 NVGDLWNQFKVNDELIVSYCGSVA 179

>AAR160W [348] [Homologous to ScYBR217W (APG12) - SH]
           complement(632807..633376) [570 bp, 189 aa]
          Length = 189

 Score =  110 bits (275), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 103/167 (61%), Gaps = 16/167 (9%)

Query: 29  TVRDELEQYSTRLNLLGLDSGEQITSSTQELRNLESSDDNDSSTVESNRAHTAPVSTSAI 88
           ++++ LE+Y  RL+ L L S     SS  E  ++E         V        P+STS  
Sbjct: 36  SLQNRLEEYHERLSRLQLPS-----SSDSECSDIEQESLELEQEV--------PLSTSVY 82

Query: 89  L-GHLSVAGDQALKKMAEREQELPTKIPIRFKPIGSVPQVAPQLARISASQPFSVVVTFL 147
           L G  S  G  +  +++E  +  P K+ IRF+PIGSV QV PQ+ RIS++Q F  V+ FL
Sbjct: 83  LAGARSAGGLPSSSELSETPE--PPKVAIRFQPIGSVGQVMPQVCRISSAQSFGAVLVFL 140

Query: 148 TKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFRIKDELVVSYCSGVA 194
            +RL+L+ V+CY++NSF+P PQQ+VG LW  F++ DELVVSYC+ VA
Sbjct: 141 RRRLRLDTVHCYVSNSFAPTPQQNVGQLWEQFKVNDELVVSYCATVA 187

>Kwal_47.17647
          Length = 385

 Score = 31.6 bits (70), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 6/78 (7%)

Query: 35  EQYSTRLNLLGLDSGE-QITSSTQELRNLESSDDNDSSTVESNRAHTAPVS-TSAILGHL 92
           E++  + NL G + G+ +I   TQE++ + + ++NDS  +     H   +  T  ++ + 
Sbjct: 65  EKWRHKANLNGQELGKVRINKKTQEIQMILNENENDSDQI----PHKYDLELTKKLVENE 120

Query: 93  SVAGDQALKKMAEREQEL 110
            +  +Q LKK  +RE+EL
Sbjct: 121 YIFTEQNLKKYQQREREL 138

>Scas_575.5
          Length = 645

 Score = 31.2 bits (69), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 25/37 (67%)

Query: 32  DELEQYSTRLNLLGLDSGEQITSSTQELRNLESSDDN 68
           D+++Q S RL  L + +GE++ S  + L+++E + DN
Sbjct: 593 DQVQQISGRLKKLAISTGEELDSQQERLKDVEENTDN 629

>Scas_623.14
          Length = 262

 Score = 30.4 bits (67), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 8/109 (7%)

Query: 48  SGEQITSSTQELRNLESSDDNDSSTVES---NRAHTAPVST-----SAILGHLSVAGDQA 99
           S + IT  T  L+  +S D   ++++ S    RA  +  +      +A L    V   Q 
Sbjct: 24  STDTITKPTIVLKAKDSGDSAATASINSIDMQRARNSAAAVDMPFFTAFLQDFEVKLAQY 83

Query: 100 LKKMAEREQELPTKIPIRFKPIGSVPQVAPQLARISASQPFSVVVTFLT 148
              M E +  LP  +   +  I  +P  A   A I+++ PF+   TF+T
Sbjct: 84  TSYMGEMKLTLPQAVADYYYHIAFLPSTADLEADIASTFPFTQFQTFIT 132

>Kwal_55.21765
          Length = 320

 Score = 29.6 bits (65), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 7/56 (12%)

Query: 58  ELRNLESSDDNDSSTVESNRAHTAPVSTSAILGHLSVAG---DQALKKMAEREQEL 110
           ELRN++  D  + + +E+NR +    S   I+ +  V G   DQ L+++  RE+++
Sbjct: 69  ELRNVQEKDFLEEAIIEANRDN----SVDGIMVYFPVFGNAQDQYLQQVVSREKDV 120

>Sklu_2239.2 YPR041W, Contig c2239 3671-4900 reverse complement
          Length = 409

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 7/98 (7%)

Query: 51  QITSSTQELRNLESSDD----NDSSTVESNRAHTAPVSTSAI---LGHLSVAGDQALKKM 103
           QI ++   L+N+E  DD    + S      RA      T A+   L  L   G+  LK+ 
Sbjct: 201 QINAAASTLKNIEVKDDEWTLDMSEEAIRARAKELQGGTGAVDPELSALEEFGEWVLKEA 260

Query: 104 AEREQELPTKIPIRFKPIGSVPQVAPQLARISASQPFS 141
            E +++LP+ + +  K +       P+LA + A   F 
Sbjct: 261 GEDKEDLPSDVELYKKAVEMELLQEPKLACVLAQVLFD 298

>Sklu_2351.5 YGR009C, Contig c2351 9208-10833
          Length = 541

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%)

Query: 32  DELEQYSTRLNLLGLDSGEQITSSTQELRNLESSDDN 68
           D++ Q S+RL  L + +GE+I S    ++++E   DN
Sbjct: 489 DKIGQVSSRLKKLAVATGEEINSQQDRIKSIEEDTDN 525

>CAGL0G00330g complement(34662..35606) some similarities with
           sp|P53333 Saccharomyces cerevisiae YGR278w, hypothetical
           start
          Length = 314

 Score = 28.9 bits (63), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%)

Query: 159 YIN-NSFSPAPQQSVGDLWGHFRIKDEL 185
           Y N N+F PA  + +G LWGH    D L
Sbjct: 96  YTNMNTFEPAQLRIIGKLWGHIFAADYL 123

>AEL013C [2493] [Homologous to ScYDL042C (SIR2) - SH; ScYOL068C
           (HST1) - SH] (611020..612699) [1680 bp, 559 aa]
          Length = 559

 Score = 28.5 bits (62), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 47  DSGEQITSSTQELRNLESSDDNDSSTVESN--RAHTAPVSTSAILGHLSVAGDQALKKMA 104
           D G+ + + TQ + NLES     +   + N  + H +  + S +  HL + G++  +++ 
Sbjct: 320 DKGKLLRNYTQNIDNLESY----AGIFKENIVQCHGSFATASCVTCHLKMPGERIFQQIK 375

Query: 105 ERE 107
           +RE
Sbjct: 376 DRE 378

>Scas_681.12
          Length = 1176

 Score = 28.5 bits (62), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%)

Query: 78  AHTAPVSTSAILGHLSVAGDQALKKMAEREQELPTKIPIRFKPIGSVPQV 127
           A    +S SA   H   A  Q  KKM E E+ +P    +++KP  + P +
Sbjct: 489 AEVENLSRSASQIHFDTAQKQKAKKMEEIEEGIPLAKFVKYKPKLTYPDL 538

>Kwal_27.11747
          Length = 1087

 Score = 28.1 bits (61), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 5/47 (10%)

Query: 30  VRDELEQYSTRLNLLGLDSG-----EQITSSTQELRNLESSDDNDSS 71
           VRDE++  ST++N  G ++      +Q+++ +  LRNL  S+ N SS
Sbjct: 691 VRDEVDTLSTKVNTRGAENSHILIVDQLSTISMILRNLSFSEANTSS 737

>AFR304W [3496] [Homologous to ScYGR125W - SH]
           complement(991651..994698) [3048 bp, 1015 aa]
          Length = 1015

 Score = 27.7 bits (60), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 63  ESSDDNDSSTVESNRAHTAPVSTSAILGHLSVAGDQALKKMAEREQELPTKIPIRF 118
           E+ DD+DS      R   +P++T  I  + ++  +Q+  + A R +  P+  P+R 
Sbjct: 163 EAVDDSDSDQEAGTRLFLSPITTDYIHSYGAINEEQSASETASRAETGPS--PLRL 216

>ADL005C [1737] [Homologous to ScYEL005C (VAB2) - SH]
           (698226..699203) [978 bp, 325 aa]
          Length = 325

 Score = 27.3 bits (59), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 92  LSVAGDQALKKMAEREQELPTKIPI-RFKPIGSVPQVAPQLARISASQPFS 141
           L ++G     K +   + +P +I + +F+ + S PQ AP L  I  + PFS
Sbjct: 265 LEISGSAHATKASSARENIPERILMPQFQKVAS-PQTAPTLENIEVTVPFS 314

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.129    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,283,148
Number of extensions: 203412
Number of successful extensions: 1116
Number of sequences better than 10.0: 43
Number of HSP's gapped: 1114
Number of HSP's successfully gapped: 43
Length of query: 194
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 98
Effective length of database: 13,272,781
Effective search space: 1300732538
Effective search space used: 1300732538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 59 (27.3 bits)