Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.180922322111531e-163
Scas_563.112162073341e-38
AAR161W2092023182e-36
YGL061C (DUO1)2472343152e-35
CAGL0F06963g2122132992e-33
KLLA0C05742g2081522817e-31
ACR205W107942681.0
AER377C1012101643.1
YBR235W112086624.8
YLR454W262838625.6
KLLA0E00660g184770609.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.1809
         (221 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.1809                                                          448   e-163
Scas_563.11                                                           133   1e-38
AAR161W [349] [Homologous to ScYGL061C (DUO1) - SH] complement(6...   127   2e-36
YGL061C (DUO1) [1918] chr7 complement(388969..389712) Protein co...   125   2e-35
CAGL0F06963g complement(683862..684500) similar to sp|P53168 Sac...   119   2e-33
KLLA0C05742g 511607..512233 some similarities with sp|P53168 Sac...   112   7e-31
ACR205W [1252] [Homologous to ScYOR127W (RGA1) - SH; ScYDR379W (...    31   1.0  
AER377C [2878] [Homologous to ScYIL128W (MET18) - SH] (1337499.....    29   3.1  
YBR235W (YBR235W) [414] chr2 (686858..690220) Member of the cati...    28   4.8  
YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unk...    28   5.6  
KLLA0E00660g 69141..74684 gi|5531274|emb|CAB50899.1 Kluyveromyce...    28   9.8  

>Kwal_14.1809
          Length = 223

 Score =  448 bits (1153), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 221/221 (100%), Positives = 221/221 (100%)

Query: 1   MNDETLDRSNINKLIPEIFDQMRSNLSIAPSTKGARPFLSQKATSSITTQSLLEESKSLD 60
           MNDETLDRSNINKLIPEIFDQMRSNLSIAPSTKGARPFLSQKATSSITTQSLLEESKSLD
Sbjct: 1   MNDETLDRSNINKLIPEIFDQMRSNLSIAPSTKGARPFLSQKATSSITTQSLLEESKSLD 60

Query: 61  KIIPVIQKLERSLSTSGPQHLRRIKKTCESSNKILDTWIKIQSQAGYAYELMSDESYLEY 120
           KIIPVIQKLERSLSTSGPQHLRRIKKTCESSNKILDTWIKIQSQAGYAYELMSDESYLEY
Sbjct: 61  KIIPVIQKLERSLSTSGPQHLRRIKKTCESSNKILDTWIKIQSQAGYAYELMSDESYLEY 120

Query: 121 VTAAQKDESLTPEAFIRRKQAHVDDLRQSLEKEQRLLEESNVEQDNRQTKEMASLQRVGR 180
           VTAAQKDESLTPEAFIRRKQAHVDDLRQSLEKEQRLLEESNVEQDNRQTKEMASLQRVGR
Sbjct: 121 VTAAQKDESLTPEAFIRRKQAHVDDLRQSLEKEQRLLEESNVEQDNRQTKEMASLQRVGR 180

Query: 181 GLGTKRVIRGGMKRPTGIPRSTTRITKAPVSRVPRSAAKRS 221
           GLGTKRVIRGGMKRPTGIPRSTTRITKAPVSRVPRSAAKRS
Sbjct: 181 GLGTKRVIRGGMKRPTGIPRSTTRITKAPVSRVPRSAAKRS 221

>Scas_563.11
          Length = 216

 Score =  133 bits (334), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/207 (40%), Positives = 122/207 (58%), Gaps = 16/207 (7%)

Query: 1   MNDETLDRSNINKLIPEIFDQMRSNLSIAPSTKGARPFLSQKATSSITTQSLLEESKSLD 60
           M+ E LD S INKLIP+IF QMRSN   A S+       +Q   S+ITTQSLL E +SLD
Sbjct: 1   MSKEQLDDSTINKLIPQIFAQMRSNFDTATSSSSITDS-NQVHRSNITTQSLLNELESLD 59

Query: 61  KIIPVIQKLERSLSTSGPQHLRRIKKTCESSNKILDTWIKIQSQAGYAYELMSDESYLEY 120
           KII ++Q L+++L  + P+H+ RI   C+S+N ILD+WI IQSQAGY   LMSD  YL++
Sbjct: 60  KIITMVQNLDKTLKNATPKHIDRIHHVCQSTNTILDSWINIQSQAGYINRLMSDPLYLKF 119

Query: 121 -----VTAAQKDESLTPEAFIRRKQAHVDDLRQSLEKE-QRLLEESNVEQDNRQT--KEM 172
                VT     ++ T + ++  +Q  V+ L++ LE E Q+   + NV   +  +  +E 
Sbjct: 120 AHEQLVTG----DTTTADEYLNLEQEEVEKLKRQLELEQQKKHAQQNVSNSSSSSRGREK 175

Query: 173 ASLQRVGRGLGTKRVIRGGMKRPTGIP 199
            S+ +    +     +R    RP+GIP
Sbjct: 176 NSINKSNSNIRRSVPVRS---RPSGIP 199

>AAR161W [349] [Homologous to ScYGL061C (DUO1) - SH]
           complement(633395..634024) [630 bp, 209 aa]
          Length = 209

 Score =  127 bits (318), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 115/202 (56%), Gaps = 31/202 (15%)

Query: 6   LDRSNINKLIPEIFDQMRSNLSIAPSTKGARPFLSQKATSSITTQSLLEESKSLDKIIPV 65
           +D + +++LIP+IFDQMR+N        GA  +     T++++T +LL+E + LD+IIPV
Sbjct: 26  VDSAALDELIPQIFDQMRTN---QLDGSGAAAW----GTAAVSTATLLKEMEQLDQIIPV 78

Query: 66  IQKLERSLSTSGPQHLRRIKKTCESSNKILDTWIKIQSQAGYAYELMSDESYLEYVTAAQ 125
           +Q+L  SL  S  ++L RI++TCE+ N++LDTWIKIQSQAGY  ELM D  YL Y+   +
Sbjct: 79  LQQLNESLRRSTGENLSRIRRTCEAVNRVLDTWIKIQSQAGYVGELMDDSEYLSYMEKTR 138

Query: 126 KDESLTPEAFIRRKQAHVDDLRQSLEKEQRLLEESNVEQDNRQTKEMASLQRVGRGLGTK 185
            DE         ++QA+++ LR+ +E+ +R ++E    +            R        
Sbjct: 139 GDEG--------QQQAYMESLRKQVEELRRKVDERRAVEAAAAAPRAPERTRG------- 183

Query: 186 RVIRGGMKRPTGIPRSTTRITK 207
                     +GIPR  +RITK
Sbjct: 184 ---------ASGIPRGGSRITK 196

>YGL061C (DUO1) [1918] chr7 complement(388969..389712) Protein
           component of Dad1p-Duo1p-Dam1p complex
           (Dad1p-Duo1p-Dam1p-Ask1p-Spc19p-Spc34p-Dad2p), required
           for maintenance of metaphase and anaphase spindle
           integrity [744 bp, 247 aa]
          Length = 247

 Score =  125 bits (315), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 128/234 (54%), Gaps = 28/234 (11%)

Query: 6   LDRSNINKLIPEIFDQMRSNLS-----IAPSTKG-ARPFLSQKATS-----SITTQSLLE 54
           LD S I+KLIP+IF++MRSNL+        ST G A   +S  + S     SITTQSLL+
Sbjct: 7   LDDSTIDKLIPQIFNEMRSNLNNTTNKFPKSTGGGASDNISANSNSIRSFNSITTQSLLK 66

Query: 55  ESKSLDKIIPVIQKLERSLSTSGPQHLRRIKKTCESSNKILDTWIKIQSQAGYAYELMSD 114
           ES+SLDKI  +I+ +  +L  + P ++ ++ + C+S+N ILD+WI I SQAGY ++LMSD
Sbjct: 67  ESESLDKITAMIKNVTAALKNNLPVYVNQVHEVCKSTNSILDSWINIHSQAGYIHKLMSD 126

Query: 115 ESYLEYVTAAQKDESL--------TPEAFIRRKQAHVDDLRQSLEKEQRLLEESNVEQDN 166
           ++YL+ +     +E++        T    I  K+  + DLRQ LE  +   + +  +  N
Sbjct: 127 QTYLKLINDRLHNENVNTNDEDGSTLHNVIALKKKEILDLRQKLENRKGEKDAAPAKPPN 186

Query: 167 RQTKEMASLQRVGRGLGTKRVIRGG---------MKRPTGIPRSTTRITKAPVS 211
           +       +Q   R + +  +   G          KRP+GIPR T R TK   S
Sbjct: 187 QGLNPRYGVQSGRRPVPSAGISNNGRVRKTHVPASKRPSGIPRVTNRWTKPTAS 240

>CAGL0F06963g complement(683862..684500) similar to sp|P53168
           Saccharomyces cerevisiae YGL061c DUO1 essential mitotic
           spindle protein, hypothetical start
          Length = 212

 Score =  119 bits (299), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 123/213 (57%), Gaps = 15/213 (7%)

Query: 4   ETLDRSNINKLIPEIFDQMRSNLSIAPSTKGAR-PFLSQKATSSITTQSLLEESKSLDKI 62
           E+LD S IN+LIPEIFDQMR N   A  T+ A+ P    + + SITTQSLL E ++LDK+
Sbjct: 3   ESLDNSAINQLIPEIFDQMRHN---AARTRDAKKPSAMVEESGSITTQSLLRELETLDKV 59

Query: 63  IPVIQKLERSLSTSGPQHLRRIKKTCESSNKILDTWIKIQSQAGYAYELMSDESYLEYVT 122
           I  I+ ++  +  + P H+ +I   C+S+NK+LD WI IQSQAGYA+ +M   +      
Sbjct: 60  IATIRSIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQAGYAHHIMDSRT------ 113

Query: 123 AAQKDESLTPEAFIRRKQAHVDDLRQSLEKEQRLLEESNVEQD-NRQTKE--MASLQRVG 179
              K  S + E  + + +  + +L++S++ E+  L  + V+ + N  T +    +  R  
Sbjct: 114 -GSKTGSNSNEEVVEQYKQEIAELQKSIKMEEDKLIPAQVKGNGNGPTGQRLYGNSYRQP 172

Query: 180 RGLGTKR-VIRGGMKRPTGIPRSTTRITKAPVS 211
            G  TK   +R    RP+GIP+ ++R+T+   S
Sbjct: 173 TGRVTKATALRNARNRPSGIPQISSRLTRPTAS 205

>KLLA0C05742g 511607..512233 some similarities with sp|P53168
           Saccharomyces cerevisiae YGL061c DUO1 essential mitotic
           spindle protein singleton, hypothetical start
          Length = 208

 Score =  112 bits (281), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 92/152 (60%), Gaps = 14/152 (9%)

Query: 1   MNDETLDRSNINKLIPEIFDQMRSNLSIAPSTKGARPFLSQKATSSITTQSLLEESKSLD 60
           M +  LD S I+K+IP+IFDQMR          G++ F S  A  SI+TQSLL+E + LD
Sbjct: 1   MVEHKLDASTISKMIPQIFDQMRRQT-------GSKNFASTPA--SISTQSLLKEQEQLD 51

Query: 61  KIIPVIQKLERSLSTSGPQHLRRIKKTCESSNKILDTWIKIQSQAGYAYELMSDESYLEY 120
           KIIPVIQ L   +       + RIK+TC + N ILD +I IQSQA Y   +M++E YL+Y
Sbjct: 52  KIIPVIQNLNERIKDCKEGDMERIKETCHAMNTILDKFISIQSQASYVNSMMNNEEYLDY 111

Query: 121 VTAAQKDESLTPEAFIRRKQAHVDDLRQSLEK 152
           V + + +E      +I  KQ  V++L + +++
Sbjct: 112 VASGKSEEE-----YISAKQREVEELEKRVKQ 138

>ACR205W [1252] [Homologous to ScYOR127W (RGA1) - SH; ScYDR379W (RGA2)
            - SH] complement(705736..708975) [3240 bp, 1079 aa]
          Length = 1079

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 53   LEESKSLDKIIPVIQKLERSLSTSGPQHLRRIKKTCESSNKI 94
            L+ +KS     P I+KL   L T  P+HLR +   C+  N++
Sbjct: 981  LKSAKSSPVYAPAIEKLAAILKTLPPEHLRVLSVICQHVNRV 1022

>AER377C [2878] [Homologous to ScYIL128W (MET18) - SH]
           (1337499..1340537) [3039 bp, 1012 aa]
          Length = 1012

 Score = 29.3 bits (64), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 44/101 (43%), Gaps = 11/101 (10%)

Query: 6   LDRSNINKLIPEIFDQMRSNLSIAPSTKGARPFLSQKATSSITTQSLLEESKSLDKIIPV 65
           LD    +K    +FD ++SN +     K +   L     SSI + + +   + +DK++P+
Sbjct: 344 LDMGAFDKFRTHVFDDLKSNFAYEKELKQSCGIL-----SSIASVNRIAFDRVMDKVLPL 398

Query: 66  IQKLERSLSTSGPQHLRRIKKTCESSNKILDTWIKIQSQAG 106
               ++ L  S  Q L  +  +        D +IK+  + G
Sbjct: 399 FFGTQQDLDIS-KQRLLILNLSF-----FFDAYIKVFGETG 433

>YBR235W (YBR235W) [414] chr2 (686858..690220) Member of the
           cation:chloride cotransporter (CCC) family of membrane
           transporters, has similarity to human SLC12A1 associated
           with Bartter's and Long Q-T syndromes [3363 bp, 1120 aa]
          Length = 1120

 Score = 28.5 bits (62), Expect = 4.8,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 4/86 (4%)

Query: 16  PEIFDQMRSNLSIAPSTKG---ARPFLSQKAT-SSITTQSLLEESKSLDKIIPVIQKLER 71
           P +FD + S L+     K    AR  L  K   S+I  Q++ ++     K    +QKL  
Sbjct: 837 PIVFDYVNSKLADNEWWKDLVEARDTLKPKRRFSTIEPQTIAKQFTQSRKYTSGVQKLGV 896

Query: 72  SLSTSGPQHLRRIKKTCESSNKILDT 97
           S + +      RI   CES +  LDT
Sbjct: 897 SFTMNTRMPTNRIDTPCESEDSDLDT 922

>YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.6103p [7887 bp, 2628 aa]
          Length = 2628

 Score = 28.5 bits (62), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 15  IPEIFDQMRSNLSIAPSTKGARP-FLSQKATSSITTQS 51
           +P+ FD ++ N+    ST GAR  F+ +   SS+ +QS
Sbjct: 649 LPDFFDYIKINIRDISSTLGARSVFMPRDVFSSVDSQS 686

>KLLA0E00660g 69141..74684 gi|5531274|emb|CAB50899.1 Kluyveromyces
           lactis ECM29 homologue, start by similarity
          Length = 1847

 Score = 27.7 bits (60), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 5/70 (7%)

Query: 5   TLDRSNINKLIPEIF-DQMRSNLSIAPSTKGARPFLSQKATSSITTQSLLEESKSLDKII 63
           TL R N  +  P+I+ D + ++  I     GAR  LS  + S I      +ES +   II
Sbjct: 707 TLKRINTKQSPPDIYTDSLVNSFGII----GARIGLSSHSVSQILATDFDQESNNPSAII 762

Query: 64  PVIQKLERSL 73
           PV+  L  SL
Sbjct: 763 PVLVYLLASL 772

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.126    0.335 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,517,980
Number of extensions: 256394
Number of successful extensions: 1249
Number of sequences better than 10.0: 82
Number of HSP's gapped: 1239
Number of HSP's successfully gapped: 84
Length of query: 221
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 123
Effective length of database: 13,203,545
Effective search space: 1624036035
Effective search space used: 1624036035
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)